[UP]
[1][TOP] >UniRef100_C0Z2T4 AT1G06680 protein n=2 Tax=Arabidopsis thaliana RepID=C0Z2T4_ARATH Length = 95 Score = 74.3 bits (181), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 60 VNGGKLYICKAQAGDKRWFKGARKFVESAATSFSVA 95 [2][TOP] >UniRef100_Q42029-2 Isoform 2 of Oxygen-evolving enhancer protein 2-1, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=Q42029-2 Length = 219 Score = 74.3 bits (181), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 184 VNGGKLYICKAQAGDKRWFKGARKFVESAATSFSVA 219 [3][TOP] >UniRef100_Q42029 Oxygen-evolving enhancer protein 2-1, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=PSBP1_ARATH Length = 263 Score = 74.3 bits (181), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 228 VNGGKLYICKAQAGDKRWFKGARKFVESAATSFSVA 263 [4][TOP] >UniRef100_UPI000034EDD4 PSBP-2 (photosystem II subunit P-2); calcium ion binding n=1 Tax=Arabidopsis thaliana RepID=UPI000034EDD4 Length = 261 Score = 73.2 bits (178), Expect = 8e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGARKFVE+AA SFSVA Sbjct: 226 VNGGKLYICKAQAGDKRWFKGARKFVENAATSFSVA 261 [5][TOP] >UniRef100_Q40457 23 kDa polypeptide of water-oxidizing complex of photosystem II n=1 Tax=Nicotiana tabacum RepID=Q40457_TOBAC Length = 268 Score = 73.2 bits (178), Expect = 8e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGARKFVE+AA SFSVA Sbjct: 233 VNGGKLYICKAQAGDKRWFKGARKFVENAATSFSVA 268 [6][TOP] >UniRef100_O49344 Putative oxygen-evolving enhancer protein 2-2 n=1 Tax=Arabidopsis thaliana RepID=PSBP2_ARATH Length = 125 Score = 73.2 bits (178), Expect = 8e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGARKFVE+AA SFSVA Sbjct: 90 VNGGKLYICKAQAGDKRWFKGARKFVENAATSFSVA 125 [7][TOP] >UniRef100_Q7DM39 Oxygen-evolving enhancer protein 2-1, chloroplastic n=1 Tax=Nicotiana tabacum RepID=PSBP1_TOBAC Length = 268 Score = 73.2 bits (178), Expect = 8e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGARKFVE+AA SFSVA Sbjct: 233 VNGGKLYICKAQAGDKRWFKGARKFVENAATSFSVA 268 [8][TOP] >UniRef100_A7LNN9 Chloroplast oxygen-evolving enhancer protein 2 n=1 Tax=Limonium bicolor RepID=A7LNN9_9CARY Length = 268 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGA+KFVE+AA SFSVA Sbjct: 233 VNGGKLYICKAQAGDKRWFKGAKKFVENAATSFSVA 268 [9][TOP] >UniRef100_Q40701 23 kDa polypeptide of photosystem II n=1 Tax=Oryza sativa RepID=Q40701_ORYSA Length = 252 Score = 71.6 bits (174), Expect = 2e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 217 VNDGKLYICKAQAGDKRWFKGARKFVESAASSFSVA 252 [10][TOP] >UniRef100_B0FFP0 Chloroplast 23 kDa polypeptide of photosystem II (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=B0FFP0_ORYSJ Length = 185 Score = 71.6 bits (174), Expect = 2e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 150 VNDGKLYICKAQAGDKRWFKGARKFVESAASSFSVA 185 [11][TOP] >UniRef100_Q8GTK4 Os07g0141400 protein n=3 Tax=Oryza sativa RepID=Q8GTK4_ORYSJ Length = 254 Score = 71.6 bits (174), Expect = 2e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 219 VNDGKLYICKAQAGDKRWFKGARKFVESAASSFSVA 254 [12][TOP] >UniRef100_P11594 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Sinapis alba RepID=PSBP_SINAL Length = 260 Score = 70.9 bits (172), Expect = 4e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGA KFVE AA SFSVA Sbjct: 225 VNGGKLYICKAQAGDKRWFKGANKFVEKAATSFSVA 260 [13][TOP] >UniRef100_Q96334 Oxygen-evolving enhancer protein 2, chloroplastic (Fragment) n=1 Tax=Brassica juncea RepID=PSBP_BRAJU Length = 217 Score = 70.9 bits (172), Expect = 4e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VNGGKLYICKAQAGDKRWFKGA KFVE AA SFSVA Sbjct: 182 VNGGKLYICKAQAGDKRWFKGANKFVEKAATSFSVA 217 [14][TOP] >UniRef100_Q04126 23-kDa ploypeptide of photosystem II oxygen-evolving complex n=1 Tax=Nicotiana tabacum RepID=Q04126_TOBAC Length = 266 Score = 70.5 bits (171), Expect = 6e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGARKFVE+AA SFSVA Sbjct: 231 VNDGKLYICKAQAGDKRWFKGARKFVENAATSFSVA 266 [15][TOP] >UniRef100_Q9SLQ8 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Cucumis sativus RepID=PSBP_CUCSA Length = 263 Score = 70.1 bits (170), Expect = 7e-11 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGARKFVE AA SFSVA Sbjct: 228 VNDGKLYICKAQAGDKRWFKGARKFVEGAASSFSVA 263 [16][TOP] >UniRef100_B9S6F7 Oxygen-evolving enhancer protein 2, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9S6F7_RICCO Length = 265 Score = 69.3 bits (168), Expect = 1e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 230 VKDGKLYICKAQAGDKRWFKGARKFVESAASSFSVA 265 [17][TOP] >UniRef100_B5BT07 23 kDa protein of the oxygen-evolving complex n=1 Tax=Salicornia europaea RepID=B5BT07_SALEU Length = 265 Score = 69.3 bits (168), Expect = 1e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 230 VKDGKLYICKAQAGDKRWFKGARKFVESAASSFSVA 265 [18][TOP] >UniRef100_B0L802 23 kDa OEC protein (Fragment) n=1 Tax=Salicornia veneta RepID=B0L802_9CARY Length = 202 Score = 69.3 bits (168), Expect = 1e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 167 VKDGKLYICKAQAGDKRWFKGARKFVESAASSFSVA 202 [19][TOP] >UniRef100_A9PGP9 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PGP9_POPTR Length = 262 Score = 69.3 bits (168), Expect = 1e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGARKFVESAA SFSVA Sbjct: 227 VKDGKLYICKAQAGDKRWFKGARKFVESAASSFSVA 262 [20][TOP] >UniRef100_P93566 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Solanum tuberosum RepID=PSBP_SOLTU Length = 260 Score = 68.9 bits (167), Expect = 2e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGA+KFVE+AA SFS+A Sbjct: 225 VNDGKLYICKAQAGDKRWFKGAKKFVENAATSFSIA 260 [21][TOP] >UniRef100_P29795 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Solanum lycopersicum RepID=PSBP_SOLLC Length = 258 Score = 68.9 bits (167), Expect = 2e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGA+KFVE+AA SFS+A Sbjct: 223 VNDGKLYICKAQAGDKRWFKGAKKFVENAATSFSIA 258 [22][TOP] >UniRef100_Q2PET1 Putative PSII-P protein (Fragment) n=1 Tax=Trifolium pratense RepID=Q2PET1_TRIPR Length = 261 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGARKFVE A SFSVA Sbjct: 226 VNDGKLYICKAQAGDKRWFKGARKFVEDTASSFSVA 261 [23][TOP] >UniRef100_B7FJ16 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FJ16_MEDTR Length = 261 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGARKFVE A SFSVA Sbjct: 226 VNDGKLYICKAQAGDKRWFKGARKFVEDTASSFSVA 261 [24][TOP] >UniRef100_A9PHM0 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PHM0_POPTR Length = 262 Score = 67.8 bits (164), Expect = 4e-10 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGARKFVES A SFSVA Sbjct: 227 VKDGKLYICKAQAGDKRWFKGARKFVESTASSFSVA 262 [25][TOP] >UniRef100_Q40407 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Narcissus pseudonarcissus RepID=PSBP_NARPS Length = 265 Score = 67.0 bits (162), Expect = 6e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V+ GKLYICKAQAGDKRWFKGA+KFVESAA SFS A Sbjct: 230 VSDGKLYICKAQAGDKRWFKGAKKFVESAASSFSAA 265 [26][TOP] >UniRef100_C6TL82 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TL82_SOYBN Length = 264 Score = 66.6 bits (161), Expect = 8e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKL+ICKAQAGDKRWFKGAR+FVESAA SFSVA Sbjct: 229 VKDGKLFICKAQAGDKRWFKGARRFVESAASSFSVA 264 [27][TOP] >UniRef100_C6T8W8 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T8W8_SOYBN Length = 265 Score = 66.6 bits (161), Expect = 8e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGAR+FVES A SFSVA Sbjct: 230 VKDGKLYICKAQAGDKRWFKGARRFVESTASSFSVA 265 [28][TOP] >UniRef100_B8LMQ7 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LMQ7_PICSI Length = 272 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V+ GKLY+CKAQAGDKRWFKGARKFVES A SF+VA Sbjct: 237 VSDGKLYVCKAQAGDKRWFKGARKFVESTASSFNVA 272 [29][TOP] >UniRef100_A9NZP7 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZP7_PICSI Length = 272 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V+ GKLY+CKAQAGDKRWFKGARKFVES A SF+VA Sbjct: 237 VSDGKLYVCKAQAGDKRWFKGARKFVESTASSFNVA 272 [30][TOP] >UniRef100_A9NP13 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NP13_PICSI Length = 272 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V+ GKLY+CKAQAGDKRWFKGARKFVES A SF+VA Sbjct: 237 VSDGKLYVCKAQAGDKRWFKGARKFVESTASSFNVA 272 [31][TOP] >UniRef100_A9NKX3 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NKX3_PICSI Length = 272 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V+ GKLY+CKAQAGDKRWFKGARKFVES A SF+VA Sbjct: 237 VSDGKLYVCKAQAGDKRWFKGARKFVESTASSFNVA 272 [32][TOP] >UniRef100_P12302 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Spinacia oleracea RepID=PSBP_SPIOL Length = 267 Score = 66.6 bits (161), Expect = 8e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGA+KFVESA SFSVA Sbjct: 232 VKDGKLYICKAQAGDKRWFKGAKKFVESATSSFSVA 267 [33][TOP] >UniRef100_Q04127 Oxygen-evolving enhancer protein 2-3, chloroplastic n=1 Tax=Nicotiana tabacum RepID=PSBP3_TOBAC Length = 266 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGA+KFVE+ A SFS+A Sbjct: 231 VNDGKLYICKAQAGDKRWFKGAKKFVENTATSFSLA 266 [34][TOP] >UniRef100_P18212 Oxygen-evolving enhancer protein 2-2, chloroplastic n=1 Tax=Nicotiana tabacum RepID=PSBP2_TOBAC Length = 265 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGA+KFVE+ A SFS+A Sbjct: 230 VNDGKLYICKAQAGDKRWFKGAKKFVENTATSFSLA 265 [35][TOP] >UniRef100_O22536 23kDa polypeptide of photosystem II n=1 Tax=Oryza sativa RepID=O22536_ORYSA Length = 254 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKL ICKAQ GDKRWFKGARKFVESAA SFSVA Sbjct: 219 VNDGKLNICKAQPGDKRWFKGARKFVESAASSFSVA 254 [36][TOP] >UniRef100_P16059 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Pisum sativum RepID=PSBP_PEA Length = 259 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGARKFVE A SFSVA Sbjct: 224 VKDGKLYICKAQAGDKRWFKGARKFVEDTASSFSVA 259 [37][TOP] >UniRef100_Q58H59 Chloroplast photosynthetic oxygen-evolving protein 23 kDa subunit (Fragment) n=1 Tax=Nicotiana benthamiana RepID=Q58H59_NICBE Length = 261 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRWFKGA+KFVE+ SFS+A Sbjct: 226 VNDGKLYICKAQAGDKRWFKGAKKFVENTVTSFSLA 261 [38][TOP] >UniRef100_C5X9F7 Putative uncharacterized protein Sb02g002690 n=1 Tax=Sorghum bicolor RepID=C5X9F7_SORBI Length = 261 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V+ GKLYICKAQAGDKRWFKGARK VE AA SFSVA Sbjct: 226 VSDGKLYICKAQAGDKRWFKGARKGVEKAAASFSVA 261 [39][TOP] >UniRef100_Q40458 23 kDa polypeptide of water-oxidizing complex of photosystem II (Fragment) n=1 Tax=Nicotiana tabacum RepID=Q40458_TOBAC Length = 205 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 VN GKLYICKAQAGDKRW KGA+KFVE+ A SFS+A Sbjct: 170 VNDGKLYICKAQAGDKRWLKGAKKFVENTATSFSLA 205 [40][TOP] >UniRef100_Q6XNL9 Probable oxygen-evolving enhancer protein 2 (Fragment) n=1 Tax=Vitis vinifera RepID=Q6XNL9_VITVI Length = 98 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICK QAGDKRWFKGARK+VES A SFS+A Sbjct: 63 VADGKLYICKVQAGDKRWFKGARKYVESTASSFSIA 98 [41][TOP] >UniRef100_A5B1D3 Chromosome chr12 scaffold_18, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A5B1D3_VITVI Length = 259 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICK QAGDKRWFKGARK+VES A SFS+A Sbjct: 224 VADGKLYICKVQAGDKRWFKGARKYVESTASSFSIA 259 [42][TOP] >UniRef100_O49080 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Fritillaria agrestis RepID=PSBP_FRIAG Length = 264 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLYICKAQAGDKRWFKGA+KFVES SF+VA Sbjct: 229 VTDGKLYICKAQAGDKRWFKGAKKFVESTTTSFNVA 264 [43][TOP] >UniRef100_Q00434 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Triticum aestivum RepID=PSBP_WHEAT Length = 258 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V GKLY+CKAQ DKRWFKGA+KFVE+AA SFSVA Sbjct: 224 VADGKLYVCKAQR-DKRWFKGAKKFVENAAGSFSVA 258 [44][TOP] >UniRef100_A9RIB5 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RIB5_PHYPA Length = 216 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V G LY+ KAQAGDKRWFKG +KFVE A SF+VA Sbjct: 181 VKDGNLYLFKAQAGDKRWFKGVKKFVEGAWNSFNVA 216 [45][TOP] >UniRef100_A9SG93 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SG93_PHYPA Length = 269 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 317 VNGGKLYICKAQAGDKRWFKGARKFVESAAPSFSVA 210 V G+LY+ KAQAGDKRWFKG +KFVE A +F+VA Sbjct: 234 VKDGQLYLFKAQAGDKRWFKGVKKFVEGAWNTFNVA 269