[UP]
[1][TOP] >UniRef100_Q9C773 MYB-family transcription factor, putative; alternative splicing isoform 2 of 2;71559-70643 (Myb-family transcription factor, putative; alternative splicing isoform 1 of 2;71559-70643) n=1 Tax=Arabidopsis thaliana RepID=Q9C773_ARATH Length = 263 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 216 METLHPFSHRPISDHRFVVQEMVGVHSASS 305 METLHPFSH PISDHRFVVQEMV +HS+SS Sbjct: 1 METLHPFSHLPISDHRFVVQEMVSLHSSSS 30 [2][TOP] >UniRef100_Q8LG33 MYB-family transcription factor, putative n=1 Tax=Arabidopsis thaliana RepID=Q8LG33_ARATH Length = 263 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 216 METLHPFSHRPISDHRFVVQEMVGVHSASS 305 METLHPFSH PISDHRFVVQEMV HS+SS Sbjct: 1 METLHPFSHLPISDHRFVVQEMVSFHSSSS 30