[UP]
[1][TOP] >UniRef100_Q9SR37 Beta-glucosidase 23 n=1 Tax=Arabidopsis thaliana RepID=BGL23_ARATH Length = 524 Score = 89.4 bits (220), Expect = 1e-16 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = +1 Query: 1 AHDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 AHDLADSQ GASIDRALDFILGWHLDTTTFGDYP +MKDIVGH Sbjct: 279 AHDLADSQDGASIDRALDFILGWHLDTTTFGDYPQIMKDIVGH 321 [2][TOP] >UniRef100_O24434 Beta-glucosidase (Fragment) n=1 Tax=Brassica nigra RepID=O24434_BRANI Length = 437 Score = 84.3 bits (207), Expect = 4e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HDLADSQ GASIDRALDFILGWHLDTT +GDYP +MKDIVGH Sbjct: 193 HDLADSQDGASIDRALDFILGWHLDTTMYGDYPQIMKDIVGH 234 [3][TOP] >UniRef100_Q94KV9 Thioglucoside glucohydrolase 1 (Fragment) n=1 Tax=Brassica napus RepID=Q94KV9_BRANA Length = 174 Score = 82.0 bits (201), Expect = 2e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HD DSQ GASIDRALDF++GWHLDTTTFGDYP +MKDIVGH Sbjct: 122 HDFDDSQDGASIDRALDFMMGWHLDTTTFGDYPQIMKDIVGH 163 [4][TOP] >UniRef100_Q9LKR7 Beta-glucosidase 24 n=1 Tax=Arabidopsis thaliana RepID=BGL24_ARATH Length = 533 Score = 77.4 bits (189), Expect = 5e-13 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HD D Q GA+IDRALDFI+GWHLDTT FGDYP MKDIVGH Sbjct: 289 HDFKDEQSGATIDRALDFIMGWHLDTTMFGDYPQTMKDIVGH 330 [5][TOP] >UniRef100_Q94KV8 Thioglucoside glucohydrolase 2 (Fragment) n=1 Tax=Brassica napus RepID=Q94KV8_BRANA Length = 115 Score = 77.0 bits (188), Expect = 6e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HD DSQ GASI RALDF+LGWHLDTT +GDYP +MKDIVGH Sbjct: 58 HDFQDSQDGASIGRALDFMLGWHLDTTMYGDYPQIMKDIVGH 99 [6][TOP] >UniRef100_Q94KV6 Thioglucoside glucohydrolase 1 (Fragment) n=1 Tax=Brassica rapa RepID=Q94KV6_BRACM Length = 166 Score = 77.0 bits (188), Expect = 6e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HD DSQ GASI RALDF+LGWHLDTT +GDYP +MKDIVGH Sbjct: 103 HDFQDSQDGASIGRALDFMLGWHLDTTMYGDYPQIMKDIVGH 144 [7][TOP] >UniRef100_Q94KV7 Thioglucoside glucohydrolase 1 (Fragment) n=1 Tax=Brassica oleracea RepID=Q94KV7_BRAOL Length = 72 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 7 DLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 D DSQ GAS D AL F+ GWHLDTTT+GDYP +MKDIVGH Sbjct: 19 DXDDSQDGASXDXALXFMXGWHLDTTTYGDYPQIMKDIVGH 59 [8][TOP] >UniRef100_Q9C8Y9-2 Isoform 2 of Beta-glucosidase 22 n=1 Tax=Arabidopsis thaliana RepID=Q9C8Y9-2 Length = 456 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HDL DS ++ R LDF+LGWHLD TTFGDYP +MKD++GH Sbjct: 280 HDLKDSNDVPTVSRVLDFMLGWHLDPTTFGDYPQIMKDLLGH 321 [9][TOP] >UniRef100_Q9C8Y9 Beta-glucosidase 22 n=1 Tax=Arabidopsis thaliana RepID=BGL22_ARATH Length = 524 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HDL DS ++ R LDF+LGWHLD TTFGDYP +MKD++GH Sbjct: 280 HDLKDSNDVPTVSRVLDFMLGWHLDPTTFGDYPQIMKDLLGH 321 [10][TOP] >UniRef100_Q9C525-2 Isoform 2 of Beta-glucosidase 21 n=1 Tax=Arabidopsis thaliana RepID=Q9C525-2 Length = 522 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HDL DS ++ R LDF+LGWHL+ TT GDYP +MKD++G+ Sbjct: 278 HDLKDSNDAPTVSRVLDFMLGWHLEPTTSGDYPQIMKDLLGY 319 [11][TOP] >UniRef100_Q9C525 Beta-glucosidase 21 n=1 Tax=Arabidopsis thaliana RepID=BGL21_ARATH Length = 524 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +1 Query: 4 HDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 HDL DS ++ R LDF+LGWHL+ TT GDYP +MKD++G+ Sbjct: 280 HDLKDSNDAPTVSRVLDFMLGWHLEPTTSGDYPQIMKDLLGY 321 [12][TOP] >UniRef100_Q84WV2 Beta-glucosidase 20 n=1 Tax=Arabidopsis thaliana RepID=BGL20_ARATH Length = 535 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +1 Query: 1 AHDLADSQHGASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 AH+L+D +H + +DFILGWHL TT+GDYP MKD +GH Sbjct: 284 AHELSDEEHETPVTGLIDFILGWHLHPTTYGDYPQSMKDHIGH 326 [13][TOP] >UniRef100_UPI00005DBF84 BGLU18 (BETA GLUCOSIDASE 18); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds n=1 Tax=Arabidopsis thaliana RepID=UPI00005DBF84 Length = 461 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 16 DSQH-GASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 D +H G SI+R LDFILGWHL TT+GDYP MKD VGH Sbjct: 288 DLEHVGGSIERVLDFILGWHLAPTTYGDYPQSMKDRVGH 326 [14][TOP] >UniRef100_Q9SE50 Beta-glucosidase 18 n=1 Tax=Arabidopsis thaliana RepID=BGL18_ARATH Length = 528 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 16 DSQH-GASIDRALDFILGWHLDTTTFGDYPHVMKDIVGH 129 D +H G SI+R LDFILGWHL TT+GDYP MKD VGH Sbjct: 288 DLEHVGGSIERVLDFILGWHLAPTTYGDYPQSMKDRVGH 326 [15][TOP] >UniRef100_Q9LIF9 Beta-glucosidase 19 n=1 Tax=Arabidopsis thaliana RepID=BGL19_ARATH Length = 527 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 31 ASIDRALDFILGWHLDTTTFGDYPHVMKDIVG 126 A+++R LDF++GWHLD TTFGDYP MKD VG Sbjct: 288 ATVNRVLDFVIGWHLDPTTFGDYPQSMKDAVG 319 [16][TOP] >UniRef100_Q42618 Beta-glucosidase n=1 Tax=Brassica napus RepID=Q42618_BRANA Length = 514 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +1 Query: 34 SIDRALDFILGWHLDTTTFGDYPHVMKDIVG 126 ++DR LDFI+GWHLD TT+GDYP MKD VG Sbjct: 289 TVDRVLDFIMGWHLDPTTYGDYPQSMKDAVG 319