[UP]
[1][TOP] >UniRef100_B2LWX9 Ubiquitin carrier protein n=1 Tax=Brassica napus RepID=B2LWX9_BRANA Length = 148 Score = 71.2 bits (173), Expect = 3e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTDKNKYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148 [2][TOP] >UniRef100_P35133 Ubiquitin-conjugating enzyme E2 10 n=1 Tax=Arabidopsis thaliana RepID=UBC10_ARATH Length = 148 Score = 71.2 bits (173), Expect = 3e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTDKNKYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148 [3][TOP] >UniRef100_C6TAY6 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6TAY6_SOYBN Length = 148 Score = 70.1 bits (170), Expect = 7e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+NKYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRNKYESTARSWTQKYAMG 148 [4][TOP] >UniRef100_C6SX33 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6SX33_SOYBN Length = 148 Score = 70.1 bits (170), Expect = 7e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+NKYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRNKYESTARSWTQKYAMG 148 [5][TOP] >UniRef100_P35132-2 Isoform 2 of SUMO-conjugating enzyme UBC9 n=1 Tax=Arabidopsis thaliana RepID=P35132-2 Length = 178 Score = 70.1 bits (170), Expect = 7e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTDKNKYES AR+WTQK AMG Sbjct: 144 NPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 178 [6][TOP] >UniRef100_P35132 SUMO-conjugating enzyme UBC9 n=1 Tax=Arabidopsis thaliana RepID=UBC9_ARATH Length = 148 Score = 70.1 bits (170), Expect = 7e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTDKNKYES AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148 [7][TOP] >UniRef100_Q9SPF9 Ubiquitin carrier protein n=1 Tax=Mesembryanthemum crystallinum RepID=Q9SPF9_MESCR Length = 148 Score = 68.9 bits (167), Expect = 2e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTDK KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDKGKYESTARSWTQKYAMG 148 [8][TOP] >UniRef100_B9RIN0 Ubiquitin-conjugating enzyme E2, putative n=1 Tax=Ricinus communis RepID=B9RIN0_RICCO Length = 119 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+NKYE+ ARSWTQK AMG Sbjct: 85 NPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG 119 [9][TOP] >UniRef100_A9PCS3 Ubiquitin carrier protein n=2 Tax=Magnoliophyta RepID=A9PCS3_POPTR Length = 148 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+NKYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG 148 [10][TOP] >UniRef100_A9P9W1 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=A9P9W1_POPTR Length = 148 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+NKYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG 148 [11][TOP] >UniRef100_Q6RVD9 Ubiquitin carrier protein n=1 Tax=Capsicum annuum RepID=Q6RVD9_CAPAN Length = 148 Score = 68.2 bits (165), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTDK+KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDKSKYEATARSWTQKYAMG 148 [12][TOP] >UniRef100_Q38M69 Ubiquitin carrier protein n=1 Tax=Solanum tuberosum RepID=Q38M69_SOLTU Length = 148 Score = 68.2 bits (165), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTDK+KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDKSKYEATARSWTQKYAMG 148 [13][TOP] >UniRef100_A9SDW9 Ubiquitin carrier protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SDW9_PHYPA Length = 148 Score = 68.2 bits (165), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRHKYESTARSWTQKYAMG 148 [14][TOP] >UniRef100_A8VHZ9 Ubiquitin carrier protein (Fragment) n=1 Tax=Eucommia ulmoides RepID=A8VHZ9_EUCUL Length = 120 Score = 68.2 bits (165), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTDK+KYE+ ARSWTQK AMG Sbjct: 86 NPDDPLVPEIAHMYKTDKHKYETTARSWTQKYAMG 120 [15][TOP] >UniRef100_P35134 Ubiquitin-conjugating enzyme E2 11 n=1 Tax=Arabidopsis thaliana RepID=UBC11_ARATH Length = 148 Score = 68.2 bits (165), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148 [16][TOP] >UniRef100_Q5YJR0 Ubiquitin carrier protein (Fragment) n=1 Tax=Hyacinthus orientalis RepID=Q5YJR0_HYAOR Length = 140 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+NKYE+ +RSWTQK AMG Sbjct: 106 NPDDPLVPEIAHMYKTDRNKYETTSRSWTQKYAMG 140 [17][TOP] >UniRef100_Q4VSV2 Ubiquitin carrier protein n=1 Tax=Picea abies RepID=Q4VSV2_PICAB Length = 111 Score = 67.8 bits (164), Expect = 4e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 77 NPDDPLVPEIAHMYKTDRGKYESTARSWTQKYAMG 111 [18][TOP] >UniRef100_B8LMC9 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=B8LMC9_PICSI Length = 148 Score = 67.8 bits (164), Expect = 4e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRGKYESTARSWTQKYAMG 148 [19][TOP] >UniRef100_A9SCD7 Ubiquitin carrier protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SCD7_PHYPA Length = 148 Score = 67.8 bits (164), Expect = 4e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRQKYESTARSWTQKYAMG 148 [20][TOP] >UniRef100_UPI0001A7B2E6 ubiquitin-conjugating enzyme, putative n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B2E6 Length = 190 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 156 NPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 190 [21][TOP] >UniRef100_UPI0001A7B2E5 ubiquitin-conjugating enzyme, putative n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B2E5 Length = 157 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 123 NPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 157 [22][TOP] >UniRef100_UPI000198342B PREDICTED: similar to UBC9 (UBIQUITIN CONJUGATING ENZYME 9); ubiquitin-protein ligase n=1 Tax=Vitis vinifera RepID=UPI000198342B Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 148 [23][TOP] >UniRef100_Q8S919 Ubiquitin carrier protein n=1 Tax=Oryza sativa Japonica Group RepID=Q8S919_ORYSJ Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 [24][TOP] >UniRef100_Q5XUV4 Ubiquitin carrier protein n=1 Tax=Triticum aestivum RepID=Q5XUV4_WHEAT Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 [25][TOP] >UniRef100_Q38JG8 Ubiquitin carrier protein n=2 Tax=Solanum RepID=Q38JG8_SOLTU Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYETTARSWTQKFAMG 148 [26][TOP] >UniRef100_Q1XAQ1 Ubiquitin carrier protein n=1 Tax=Triticum aestivum RepID=Q1XAQ1_WHEAT Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 [27][TOP] >UniRef100_C5YZT9 Ubiquitin carrier protein n=2 Tax=Andropogoneae RepID=C5YZT9_SORBI Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRPKYESTARSWTQKYAMG 148 [28][TOP] >UniRef100_C0PPR9 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=C0PPR9_PICSI Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 [29][TOP] >UniRef100_B9RCN3 Ubiquitin carrier protein n=1 Tax=Ricinus communis RepID=B9RCN3_RICCO Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 148 [30][TOP] >UniRef100_B9HDK6 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=B9HDK6_POPTR Length = 223 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 189 NPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 223 [31][TOP] >UniRef100_B6T1C0 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6T1C0_MAIZE Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRPKYESTARSWTQKYAMG 148 [32][TOP] >UniRef100_A9PGM5 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=A9PGM5_POPTR Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 [33][TOP] >UniRef100_A9PCT2 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=A9PCT2_POPTR Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 148 [34][TOP] >UniRef100_A7QNB7 Ubiquitin carrier protein n=4 Tax=core eudicotyledons RepID=A7QNB7_VITVI Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 [35][TOP] >UniRef100_A7NXZ8 Ubiquitin carrier protein n=1 Tax=Vitis vinifera RepID=A7NXZ8_VITVI Length = 146 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSWTQK AMG Sbjct: 112 NPDDPLVPEIAHMYKTDRSKYEATARSWTQKYAMG 146 [36][TOP] >UniRef100_C5YA13 Ubiquitin carrier protein n=5 Tax=Poaceae RepID=C5YA13_SORBI Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 [37][TOP] >UniRef100_A2X368 Ubiquitin carrier protein n=1 Tax=Oryza sativa Indica Group RepID=A2X368_ORYSI Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 [38][TOP] >UniRef100_Q94F47 Ubiquitin carrier protein E2 28 n=1 Tax=Arabidopsis thaliana RepID=UBC28_ARATH Length = 148 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 [39][TOP] >UniRef100_Q43821 Ubiquitin carrier protein n=1 Tax=Pisum sativum RepID=Q43821_PEA Length = 148 Score = 66.6 bits (161), Expect = 8e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRTKYEATARSWTQKYAMG 148 [40][TOP] >UniRef100_Q1EMQ5 Ubiquitin carrier protein (Fragment) n=2 Tax=core eudicotyledons RepID=Q1EMQ5_PLAMJ Length = 82 Score = 66.6 bits (161), Expect = 8e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 48 NPDDPLVPEIAHMYKTDRTKYEATARSWTQKYAMG 82 [41][TOP] >UniRef100_C5Z3I6 Ubiquitin carrier protein n=1 Tax=Sorghum bicolor RepID=C5Z3I6_SORBI Length = 148 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRVKYESTARSWTQKYAMG 148 [42][TOP] >UniRef100_B7FMV8 Ubiquitin carrier protein n=1 Tax=Medicago truncatula RepID=B7FMV8_MEDTR Length = 148 Score = 66.6 bits (161), Expect = 8e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRTKYEATARSWTQKYAMG 148 [43][TOP] >UniRef100_B5AJV2 Ubiquitin carrier protein n=1 Tax=Cucumis melo var. cantalupensis RepID=B5AJV2_CUCMR Length = 148 Score = 66.6 bits (161), Expect = 8e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRTKYEATARSWTQKYAMG 148 [44][TOP] >UniRef100_A9RXP4 Ubiquitin carrier protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RXP4_PHYPA Length = 148 Score = 66.6 bits (161), Expect = 8e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRQKYEATARSWTQKYAMG 148 [45][TOP] >UniRef100_C6SXV5 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6SXV5_SOYBN Length = 149 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHM KTD+NKYES ARSWTQK AMG Sbjct: 115 NPDDPLVPEIAHMCKTDRNKYESNARSWTQKYAMG 149 [46][TOP] >UniRef100_Q8LJR9 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=Q8LJR9_SOYBN Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 148 [47][TOP] >UniRef100_Q6RXX3 Ubiquitin carrier protein n=1 Tax=Capsicum annuum RepID=Q6RXX3_CAPAN Length = 119 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 85 NPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 119 [48][TOP] >UniRef100_Q2V9A8 Ubiquitin carrier protein n=1 Tax=Solanum tuberosum RepID=Q2V9A8_SOLTU Length = 118 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 84 NPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 118 [49][TOP] >UniRef100_Q0JI73 Os01g0819500 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=Q0JI73_ORYSJ Length = 47 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 13 NPDDPLVPEIAHMYKTDRPKYETTARSWTQKYAMG 47 [50][TOP] >UniRef100_Q06H23 Ubiquitin carrier protein n=1 Tax=Arachis hypogaea RepID=Q06H23_ARAHY Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 148 [51][TOP] >UniRef100_O65733 Ubiquitin conjugating enzyme (Fragment) n=1 Tax=Cicer arietinum RepID=O65733_CICAR Length = 61 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 27 NPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 61 [52][TOP] >UniRef100_C6SXK4 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6SXK4_SOYBN Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 148 [53][TOP] >UniRef100_B9T334 Ubiquitin carrier protein n=1 Tax=Ricinus communis RepID=B9T334_RICCO Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 148 [54][TOP] >UniRef100_Q8L458 Ubiquitin carrier protein n=2 Tax=Oryza sativa RepID=Q8L458_ORYSJ Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRPKYETTARSWTQKYAMG 148 [55][TOP] >UniRef100_B6TDH5 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6TDH5_MAIZE Length = 201 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 167 NPDDPLVPEIAHMYKTDRPKYEATARSWTQKYAMG 201 [56][TOP] >UniRef100_C5XN94 Ubiquitin carrier protein n=2 Tax=Andropogoneae RepID=C5XN94_SORBI Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRPKYEATARSWTQKYAMG 148 [57][TOP] >UniRef100_A9PHQ5 Ubiquitin carrier protein n=2 Tax=eurosids I RepID=A9PHQ5_POPTR Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 148 [58][TOP] >UniRef100_A9P9Z9 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=A9P9Z9_POPTR Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARSWTQKYAMG 148 [59][TOP] >UniRef100_A6N0N4 Ubiquitin carrier protein n=1 Tax=Oryza sativa Indica Group RepID=A6N0N4_ORYSI Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRPKYETTARSWTQKYAMG 148 [60][TOP] >UniRef100_A6N0H7 Ubiquitin carrier protein (Fragment) n=1 Tax=Oryza sativa Indica Group RepID=A6N0H7_ORYSI Length = 118 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 84 NPDDPLVPEIAHMYKTDRPKYETTARSWTQKYAMG 118 [61][TOP] >UniRef100_A5BM41 Ubiquitin carrier protein n=1 Tax=Vitis vinifera RepID=A5BM41_VITVI Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148 [62][TOP] >UniRef100_A5AI12 Ubiquitin carrier protein n=1 Tax=Vitis vinifera RepID=A5AI12_VITVI Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148 [63][TOP] >UniRef100_P35135 Ubiquitin-conjugating enzyme E2-17 kDa n=3 Tax=Solanum RepID=UBC4_SOLLC Length = 148 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148 [64][TOP] >UniRef100_UPI0000E12814 Os06g0506600 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E12814 Length = 84 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES AR WTQK AMG Sbjct: 50 NPDDPLVPEIAHMYKTDRAKYESTARGWTQKYAMG 84 [65][TOP] >UniRef100_Q0DBY7 Os06g0506600 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=Q0DBY7_ORYSJ Length = 51 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES AR WTQK AMG Sbjct: 17 NPDDPLVPEIAHMYKTDRAKYESTARGWTQKYAMG 51 [66][TOP] >UniRef100_B9GHJ6 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=B9GHJ6_POPTR Length = 148 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRFKYETTARSWTQKYAMG 148 [67][TOP] >UniRef100_B4FBW4 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B4FBW4_MAIZE Length = 148 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAH+YKTD+ KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHLYKTDRVKYESTARSWTQKYAMG 148 [68][TOP] >UniRef100_B2LUR8 Ubiquitin carrier protein n=1 Tax=Malus x domestica RepID=B2LUR8_MALDO Length = 148 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ ARSW+QK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYETTARSWSQKYAMG 148 [69][TOP] >UniRef100_A3BC59 Ubiquitin carrier protein n=2 Tax=Oryza sativa RepID=A3BC59_ORYSJ Length = 148 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES AR WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYESTARGWTQKYAMG 148 [70][TOP] >UniRef100_C6T3B1 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6T3B1_SOYBN Length = 148 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYK DK KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKADKAKYEATARSWTQKYAMG 148 [71][TOP] >UniRef100_C6T2F1 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6T2F1_SOYBN Length = 148 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAHMYKTD++KYES ARSWTQK AM Sbjct: 114 NPDDPLVPDIAHMYKTDRDKYESTARSWTQKYAM 147 [72][TOP] >UniRef100_C0PTG1 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=C0PTG1_PICSI Length = 119 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYK DK KYES AR+WTQK AMG Sbjct: 85 NPDDPLVPEIAHMYKNDKPKYESTARNWTQKYAMG 119 [73][TOP] >UniRef100_C0PPT0 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=C0PPT0_PICSI Length = 148 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYK DK KYES AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKNDKPKYESTARNWTQKYAMG 148 [74][TOP] >UniRef100_B6T1T5 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6T1T5_MAIZE Length = 148 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYES RSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRPKYESTXRSWTQKYAMG 148 [75][TOP] >UniRef100_B2LUR9 Ubiquitin carrier protein n=1 Tax=Malus x domestica RepID=B2LUR9_MALDO Length = 148 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMY+TD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYQTDRQKYEATARSWTQKYAMG 148 [76][TOP] >UniRef100_Q84QC6 Ubiquitin carrier protein n=1 Tax=Hordeum vulgare RepID=Q84QC6_HORVU Length = 148 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD++KYE+ A SWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRSKYETTAXSWTQKYAMG 148 [77][TOP] >UniRef100_B9N5K7 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=B9N5K7_POPTR Length = 148 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ +YE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRARYETTARSWTQKYAMG 148 [78][TOP] >UniRef100_P35131-2 Isoform 2 of Ubiquitin-conjugating enzyme E2 8 n=1 Tax=Arabidopsis thaliana RepID=P35131-2 Length = 149 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ AR+WTQK AMG Sbjct: 115 NPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 149 [79][TOP] >UniRef100_P35131 Ubiquitin-conjugating enzyme E2 8 n=1 Tax=Arabidopsis thaliana RepID=UBC8_ARATH Length = 148 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148 [80][TOP] >UniRef100_Q84YH5 Ubiquitin carrier protein n=1 Tax=Gossypium arboreum RepID=Q84YH5_GOSAR Length = 148 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ AR WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARGWTQKYAMG 148 [81][TOP] >UniRef100_Q84YH3 Ubiquitin carrier protein n=2 Tax=Gossypium RepID=Q84YH3_GOSRA Length = 148 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ AR WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATARGWTQKYAMG 148 [82][TOP] >UniRef100_Q42973 Ubiquitin carrier protein n=1 Tax=Oryza sativa RepID=Q42973_ORYSA Length = 148 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP++AHMYKTD+ KYES AR WTQK AMG Sbjct: 114 NPDDPLVPEMAHMYKTDRAKYESTARGWTQKYAMG 148 [83][TOP] >UniRef100_Q39372 Ubiquitin conjugating enzyme, E2 (Fragment) n=1 Tax=Brassica oleracea RepID=Q39372_BRAOL Length = 129 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAH YKTD+ KYES ARSWTQK AMG Sbjct: 95 NPDDPLVPEIAHTYKTDRVKYESTARSWTQKYAMG 129 [84][TOP] >UniRef100_C6TKT1 Ubiquitin carrier protein n=1 Tax=Glycine max RepID=C6TKT1_SOYBN Length = 148 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHM KTDK KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMCKTDKVKYESTARSWTQKYAMG 148 [85][TOP] >UniRef100_B6UG63 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6UG63_MAIZE Length = 147 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAHMYKTD+NKYE+ AR+WTQ+ AM Sbjct: 114 NPDDPLVPEIAHMYKTDRNKYENTARTWTQRYAM 147 [86][TOP] >UniRef100_B6SYI7 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6SYI7_MAIZE Length = 147 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAHMYKTD+NKYE+ AR+WTQ+ AM Sbjct: 114 NPDDPLVPEIAHMYKTDRNKYENTARTWTQRYAM 147 [87][TOP] >UniRef100_A5YVL3 Ubiquitin carrier protein n=1 Tax=Adiantum capillus-veneris RepID=A5YVL3_ADICA Length = 148 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEGTARNWTQKYAMG 148 [88][TOP] >UniRef100_B6T3C4 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6T3C4_MAIZE Length = 148 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 N DDPLVP+IAHMYKTD+ KYES ARSWTQK AMG Sbjct: 114 NXDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148 [89][TOP] >UniRef100_A9U4R7 Ubiquitin carrier protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9U4R7_PHYPA Length = 148 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAHMYKTDK KYE AR+WTQK AM Sbjct: 114 NPDDPLVPEIAHMYKTDKTKYEGTARNWTQKYAM 147 [90][TOP] >UniRef100_B9T3W7 Ubiquitin carrier protein n=1 Tax=Ricinus communis RepID=B9T3W7_RICCO Length = 148 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYK D+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKMDRAKYETTARSWTQKYAMG 148 [91][TOP] >UniRef100_Q9FKT3 Ubiquitin carrier protein E2 30 n=1 Tax=Arabidopsis thaliana RepID=UBC30_ARATH Length = 148 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAH+YKTD+ KYES A+SWTQK AMG Sbjct: 114 NPDDPLVPEIAHIYKTDRVKYESTAQSWTQKYAMG 148 [92][TOP] >UniRef100_B9SLF2 Ubiquitin carrier protein n=1 Tax=Ricinus communis RepID=B9SLF2_RICCO Length = 148 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAH+Y+TD+ KYE+ ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHVYRTDRAKYETTARSWTQKYAMG 148 [93][TOP] >UniRef100_A5AP73 Ubiquitin carrier protein n=1 Tax=Vitis vinifera RepID=A5AP73_VITVI Length = 148 Score = 63.2 bits (152), Expect = 9e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAH+ KTDK KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHLCKTDKVKYESTARSWTQKYAMG 148 [94][TOP] >UniRef100_Q2WEA9 Ubiquitin carrier protein n=1 Tax=Oryza sativa Indica Group RepID=Q2WEA9_ORYSI Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAHMYKTD++KYE+ AR+WTQ+ AM Sbjct: 114 NPDDPLVPEIAHMYKTDRHKYENTARTWTQRYAM 147 [95][TOP] >UniRef100_B9H199 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=B9H199_POPTR Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHM K DK KYES ARSWTQK AMG Sbjct: 114 NPDDPLVPEIAHMCKADKIKYESSARSWTQKYAMG 148 [96][TOP] >UniRef100_Q8S920 Ubiquitin carrier protein n=2 Tax=Oryza sativa RepID=Q8S920_ORYSJ Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAHMYKTD++KYE+ AR+WTQ+ AM Sbjct: 114 NPDDPLVPEIAHMYKTDRHKYENTARTWTQRYAM 147 [97][TOP] >UniRef100_B6SIU1 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6SIU1_MAIZE Length = 147 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAHMYKTD++KYE+ AR+WTQ+ AM Sbjct: 114 NPDDPLVPEIAHMYKTDRHKYENTARTWTQRYAM 147 [98][TOP] >UniRef100_A9NKT3 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=A9NKT3_PICSI Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAHMYK DK KYE+ AR+WTQK AM Sbjct: 114 NPDDPLVPEIAHMYKNDKGKYEATARNWTQKYAM 147 [99][TOP] >UniRef100_Q9SLE4 Ubiquitin carrier protein E2 29 n=1 Tax=Arabidopsis thaliana RepID=UBC29_ARATH Length = 148 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTDK KYE+ ARSWTQK A+ Sbjct: 114 NPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYAL 147 [100][TOP] >UniRef100_B6T650 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6T650_MAIZE Length = 147 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAHMYKTD+NKYE+ AR+W Q+ AM Sbjct: 114 NPDDPLVPEIAHMYKTDRNKYENTARTWIQRYAM 147 [101][TOP] >UniRef100_Q84K64 Ubiquitin carrier protein n=1 Tax=Gossypium hirsutum RepID=Q84K64_GOSHI Length = 148 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYKTD+ KYE+ A WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKTDRAKYEATACGWTQKYAMG 148 [102][TOP] >UniRef100_Q9C9Y7 Probable ubiquitin-conjugating enzyme E2 12 n=1 Tax=Arabidopsis thaliana RepID=UBC12_ARATH Length = 149 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NP+DPLVP+IAH+YK DK+KYES A+ WTQK AMG Sbjct: 115 NPNDPLVPEIAHLYKVDKSKYESTAQKWTQKYAMG 149 [103][TOP] >UniRef100_Q5UAG0 Ubiquitin carrier protein n=1 Tax=Arachis hypogaea RepID=Q5UAG0_ARAHY Length = 148 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPL+P+IAHMYK+D+ KYE+ ARSWTQK AM Sbjct: 114 NPDDPLMPEIAHMYKSDRAKYENTARSWTQKYAM 147 [104][TOP] >UniRef100_Q6YUS2 Ubiquitin carrier protein n=2 Tax=Oryza sativa Japonica Group RepID=Q6YUS2_ORYSJ Length = 148 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHM KTD+ +YES AR WTQK AMG Sbjct: 114 NPDDPLVPEIAHMCKTDRLRYESTARGWTQKYAMG 148 [105][TOP] >UniRef100_Q84K93 Ubiquitin carrier protein n=1 Tax=Gossypium hirsutum RepID=Q84K93_GOSHI Length = 148 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLV +IAHMYKTD+ KYE+ AR WTQK AMG Sbjct: 114 NPDDPLVLEIAHMYKTDRAKYEATARGWTQKYAMG 148 [106][TOP] >UniRef100_B3TLV3 Ubiquitin carrier protein n=1 Tax=Elaeis guineensis RepID=B3TLV3_ELAGV Length = 148 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAH+YKT +++YE AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHIYKTQRSRYEETARAWTQKYAMG 148 [107][TOP] >UniRef100_A8JBJ3 Ubiquitin carrier protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JBJ3_CHLRE Length = 148 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAH+YKTD+ +YE AR WT+K AMG Sbjct: 114 NPDDPLVPEIAHIYKTDRRRYEETAREWTRKYAMG 148 [108][TOP] >UniRef100_A2X090 Ubiquitin carrier protein n=1 Tax=Oryza sativa Indica Group RepID=A2X090_ORYSI Length = 129 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHM KTD+ +YES AR WTQK AMG Sbjct: 95 NPDDPLVPEIAHMCKTDRLRYESTARGWTQKYAMG 129 [109][TOP] >UniRef100_C5X897 Ubiquitin carrier protein n=1 Tax=Sorghum bicolor RepID=C5X897_SORBI Length = 148 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYK + +YE AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKNQRQRYEETARAWTQKYAMG 148 [110][TOP] >UniRef100_B4FCQ9 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B4FCQ9_MAIZE Length = 148 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYK + +YE AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKNQRQRYEETARAWTQKYAMG 148 [111][TOP] >UniRef100_Q5CQI6 Ubiquitin carrier protein (Fragment) n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CQI6_CRYPV Length = 161 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK 235 NPDDPLVP+IAH+YKTD++KYE AR WTQK Sbjct: 128 NPDDPLVPEIAHLYKTDRSKYEQTAREWTQK 158 [112][TOP] >UniRef100_Q5CL58 Ubiquitin carrier protein n=1 Tax=Cryptosporidium hominis RepID=Q5CL58_CRYHO Length = 118 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK 235 NPDDPLVP+IAH+YKTD++KYE AR WTQK Sbjct: 85 NPDDPLVPEIAHLYKTDRSKYEQTAREWTQK 115 [113][TOP] >UniRef100_Q5ZFS3 Ubiquitin carrier protein n=1 Tax=Plantago major RepID=Q5ZFS3_PLAMJ Length = 148 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK DK KYES AR+WT K AM Sbjct: 114 NPDDPLVPEIAHIYKNDKPKYESMARNWTHKYAM 147 [114][TOP] >UniRef100_C0HHI6 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=C0HHI6_MAIZE Length = 138 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYK + +YE AR+WTQK AMG Sbjct: 104 NPDDPLVPEIAHMYKNQRPRYEETARAWTQKYAMG 138 [115][TOP] >UniRef100_B6U4K0 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B6U4K0_MAIZE Length = 148 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHMYK + +YE AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHMYKNQRPRYEETARAWTQKYAMG 148 [116][TOP] >UniRef100_B4FSG6 Ubiquitin carrier protein n=1 Tax=Zea mays RepID=B4FSG6_MAIZE Length = 148 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAHM KTD+ +YES AR WT K AMG Sbjct: 114 NPDDPLVPEIAHMCKTDRLRYESTARGWTHKYAMG 148 [117][TOP] >UniRef100_Q0UZR5 Ubiquitin carrier protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0UZR5_PHANO Length = 147 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+++YES AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRSRYESTAREWTRKYAI 147 [118][TOP] >UniRef100_B2VTT5 Ubiquitin carrier protein n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2VTT5_PYRTR Length = 147 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+++YES AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRSRYESTAREWTRKYAI 147 [119][TOP] >UniRef100_B0DBM3 Ubiquitin carrier protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0DBM3_LACBS Length = 147 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YKTD+ +YE+ AR WT+K AM Sbjct: 114 NPDDPLVPDIAHLYKTDRTRYEATAREWTRKYAM 147 [120][TOP] >UniRef100_Q69JN7 Ubiquitin carrier protein n=2 Tax=Oryza sativa RepID=Q69JN7_ORYSJ Length = 148 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPLVP+IAH+YK+ + +YE AR+WTQK AMG Sbjct: 114 NPDDPLVPEIAHVYKSQRPRYEETARAWTQKYAMG 148 [121][TOP] >UniRef100_Q6CNH3 Ubiquitin carrier protein n=1 Tax=Kluyveromyces lactis RepID=Q6CNH3_KLULA Length = 148 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ KYE+ AR WT+K A+ Sbjct: 115 NPDDPLVPEIAHLYKTDRAKYEATAREWTKKYAI 148 [122][TOP] >UniRef100_B6AEH9 Ubiquitin carrier protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AEH9_9CRYT Length = 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK 235 NPDDPLVP++AH++KTD+N+YE AR WTQ+ Sbjct: 114 NPDDPLVPEVAHLFKTDRNRYEQTAREWTQR 144 [123][TOP] >UniRef100_Q6FV50 Ubiquitin carrier protein n=1 Tax=Candida glabrata RepID=Q6FV50_CANGA Length = 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ KYE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEATAREWTKKYAV 147 [124][TOP] >UniRef100_Q4PFY1 Ubiquitin carrier protein n=1 Tax=Ustilago maydis RepID=Q4PFY1_USTMA Length = 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA++YKTD+ +YES AR WT+K AM Sbjct: 114 NPDDPLVPEIANLYKTDRQRYESTAREWTRKYAM 147 [125][TOP] >UniRef100_C5E0H9 Ubiquitin carrier protein n=1 Tax=Zygosaccharomyces rouxii CBS 732 RepID=C5E0H9_ZYGRC Length = 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ KYE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEAQAREWTKKYAV 147 [126][TOP] >UniRef100_A7F0Q4 Ubiquitin carrier protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7F0Q4_SCLS1 Length = 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+++YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRSRYEATAREWTRKYAI 147 [127][TOP] >UniRef100_A6SPN3 Ubiquitin carrier protein n=1 Tax=Botryotinia fuckeliana B05.10 RepID=A6SPN3_BOTFB Length = 147 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+++YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRSRYEATAREWTRKYAI 147 [128][TOP] >UniRef100_P15731 Ubiquitin-conjugating enzyme E2 4 n=3 Tax=Saccharomyces cerevisiae RepID=UBC4_YEAST Length = 148 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ KYE+ AR WT+K A+ Sbjct: 115 NPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV 148 [129][TOP] >UniRef100_Q7SXH5 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q7SXH5_DANRE Length = 147 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YK+DK+KY AR WTQK AM Sbjct: 114 NPDDPLVPDIAHIYKSDKDKYNRLAREWTQKYAM 147 [130][TOP] >UniRef100_C5LXI3 Ubiquitin carrier protein (Fragment) n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5LXI3_9ALVE Length = 81 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDP VP+IAHMYK D+NK+++ AR WTQK AM Sbjct: 48 NPDDPFVPEIAHMYKGDRNKHDAIAREWTQKYAM 81 [131][TOP] >UniRef100_C5LT04 Ubiquitin carrier protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5LT04_9ALVE Length = 147 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDP VP+IAHMYK D+NK+++ AR WTQK AM Sbjct: 114 NPDDPFVPEIAHMYKGDRNKHDAIAREWTQKYAM 147 [132][TOP] >UniRef100_Q2U549 Ubiquitin carrier protein n=1 Tax=Aspergillus oryzae RepID=Q2U549_ASPOR Length = 147 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRGRYEATAREWTRKYAI 147 [133][TOP] >UniRef100_B8NV39 Ubiquitin carrier protein n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8NV39_ASPFN Length = 531 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 498 NPDDPLVPEIAHVYKTDRGRYEATAREWTRKYAI 531 [134][TOP] >UniRef100_B2AL09 Ubiquitin carrier protein n=1 Tax=Podospora anserina RepID=B2AL09_PODAN Length = 147 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ KYE AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRAKYEQTAREWTRKYAV 147 [135][TOP] >UniRef100_Q6PC58 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q6PC58_DANRE Length = 147 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YK+DK KY AR WTQK AM Sbjct: 114 NPDDPLVPDIAHIYKSDKEKYNRLAREWTQKYAM 147 [136][TOP] >UniRef100_Q8VWV2 Ubiquitin carrier protein (Fragment) n=1 Tax=Pinus pinaster RepID=Q8VWV2_PINPS Length = 140 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK+ +++YE AR+WTQK AM Sbjct: 106 NPDDPLVPEIAHIYKSQRSRYEETARAWTQKYAM 139 [137][TOP] >UniRef100_A9NLA0 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=A9NLA0_PICSI Length = 148 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK+ +++YE AR+WTQK AM Sbjct: 114 NPDDPLVPEIAHIYKSQRSRYEETARAWTQKYAM 147 [138][TOP] >UniRef100_A7TM13 Ubiquitin carrier protein n=1 Tax=Vanderwaltozyma polyspora DSM 70294 RepID=A7TM13_VANPO Length = 148 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ KYE+ A+ WT+K A+ Sbjct: 115 NPDDPLVPEIAHLYKTDRAKYEATAKEWTKKYAV 148 [139][TOP] >UniRef100_UPI000023E5C3 UBC1_COLGL Ubiquitin-conjugating enzyme E2-16 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Colletotrichum hard-surface-induced protein 1) n=1 Tax=Gibberella zeae PH-1 RepID=UPI000023E5C3 Length = 139 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 106 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 139 [140][TOP] >UniRef100_Q7RVS7 Ubiquitin carrier protein n=1 Tax=Neurospora crassa RepID=Q7RVS7_NEUCR Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 [141][TOP] >UniRef100_Q2PEN9 Ubiquitin carrier protein n=1 Tax=Epichloe festucae RepID=Q2PEN9_9HYPO Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAV 147 [142][TOP] >UniRef100_Q0CBR7 Ubiquitin carrier protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CBR7_ASPTN Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [143][TOP] >UniRef100_O94098 Ubiquitin carrier protein n=1 Tax=Metarhizium anisopliae RepID=O94098_METAN Length = 134 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 101 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAV 134 [144][TOP] >UniRef100_C9SFL4 Ubiquitin-conjugating enzyme n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SFL4_9PEZI Length = 110 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 77 NPDDPLVPEIAHVYKTDRARYEATAREWTRKYAI 110 [145][TOP] >UniRef100_Q5B9M0 Ubiquitin carrier protein n=2 Tax=Emericella nidulans RepID=Q5B9M0_EMENI Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [146][TOP] >UniRef100_C7Z111 Predicted protein n=1 Tax=Nectria haematococca mpVI 77-13-4 RepID=C7Z111_NECH7 Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [147][TOP] >UniRef100_C5PIK5 Ubiquitin carrier protein n=2 Tax=Coccidioides RepID=C5PIK5_COCP7 Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [148][TOP] >UniRef100_C5JVG3 Ubiquitin carrier protein n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JVG3_AJEDS Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [149][TOP] >UniRef100_C5GPA9 Ubiquitin carrier protein n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GPA9_AJEDR Length = 137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 104 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 137 [150][TOP] >UniRef100_C5DIQ2 Ubiquitin carrier protein n=2 Tax=Saccharomycetaceae RepID=C5DIQ2_LACTC Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ KYE+ A+ WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKTDRAKYEATAKEWTKKYAV 147 [151][TOP] >UniRef100_C4JDR0 Ubiquitin carrier protein n=1 Tax=Uncinocarpus reesii 1704 RepID=C4JDR0_UNCRE Length = 144 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 111 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 144 [152][TOP] >UniRef100_C1H5D9 Ubiquitin carrier protein n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1H5D9_PARBA Length = 148 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 115 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 148 [153][TOP] >UniRef100_C0SDD0 Ubiquitin carrier protein n=1 Tax=Paracoccidioides brasiliensis Pb03 RepID=C0SDD0_PARBP Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [154][TOP] >UniRef100_B6HEM5 Ubiquitin carrier protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6HEM5_PENCW Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [155][TOP] >UniRef100_A8Q9R9 Ubiquitin carrier protein n=1 Tax=Malassezia globosa CBS 7966 RepID=A8Q9R9_MALGO Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YKTD+ YE+ AR WT+K AM Sbjct: 114 NPDDPLVPDIAHLYKTDRAAYENTAREWTRKYAM 147 [156][TOP] >UniRef100_A8NCA5 Ubiquitin carrier protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NCA5_COPC7 Length = 130 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK 235 NPDDPLVP IAH+YKTD+ +YE+ AR WT+K Sbjct: 100 NPDDPLVPDIAHLYKTDRTRYEATAREWTRK 130 [157][TOP] >UniRef100_A6QV53 Ubiquitin carrier protein n=3 Tax=Ajellomyces capsulatus RepID=A6QV53_AJECN Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [158][TOP] >UniRef100_A2QXW7 Ubiquitin carrier protein n=1 Tax=Aspergillus niger CBS 513.88 RepID=A2QXW7_ASPNC Length = 146 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 113 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 146 [159][TOP] >UniRef100_A1D8A7 Ubiquitin carrier protein n=3 Tax=Trichocomaceae RepID=A1D8A7_NEOFI Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [160][TOP] >UniRef100_A1CJ72 Ubiquitin carrier protein n=1 Tax=Aspergillus clavatus RepID=A1CJ72_ASPCL Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147 [161][TOP] >UniRef100_P46595 Ubiquitin-conjugating enzyme E2 4 n=1 Tax=Schizosaccharomyces pombe RepID=UBC4_SCHPO Length = 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+++YE AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147 [162][TOP] >UniRef100_C1BLB0 Ubiquitin carrier protein n=1 Tax=Osmerus mordax RepID=C1BLB0_OSMMO Length = 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YK+DK+KY A+ WTQK AM Sbjct: 114 NPDDPLVPDIAHIYKSDKDKYNRLAKEWTQKYAM 147 [163][TOP] >UniRef100_C1BKF8 Ubiquitin carrier protein n=1 Tax=Osmerus mordax RepID=C1BKF8_OSMMO Length = 125 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YK+DK+KY A+ WTQK AM Sbjct: 92 NPDDPLVPDIAHIYKSDKDKYNRLAKEWTQKYAM 125 [164][TOP] >UniRef100_B5XGQ5 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B5XGQ5_SALSA Length = 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YK DK KY AR WTQK AM Sbjct: 114 NPDDPLVPDIAHIYKQDKEKYNRLARDWTQKYAM 147 [165][TOP] >UniRef100_B5XDT0 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B5XDT0_SALSA Length = 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YK DK KY AR WTQK AM Sbjct: 114 NPDDPLVPDIAHIYKQDKEKYNRLARDWTQKYAM 147 [166][TOP] >UniRef100_B5X6W5 Ubiquitin carrier protein n=3 Tax=Euteleostei RepID=B5X6W5_SALSA Length = 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IAH+YK DK KY AR WTQK AM Sbjct: 114 NPDDPLVPDIAHIYKQDKEKYNRLARDWTQKYAM 147 [167][TOP] >UniRef100_C4YCD0 Ubiquitin carrier protein n=1 Tax=Clavispora lusitaniae ATCC 42720 RepID=C4YCD0_CLAL4 Length = 157 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK+D+ KYE+ AR WT+K A+ Sbjct: 124 NPDDPLVPEIAHVYKSDRPKYEATAREWTKKYAV 157 [168][TOP] >UniRef100_Q6ZWY6 Ubiquitin-conjugating enzyme E2 D2B n=2 Tax=Murinae RepID=U2D2B_MOUSE Length = 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY AR WTQK AM Sbjct: 114 NPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM 147 [169][TOP] >UniRef100_UPI0000F2B9B3 PREDICTED: similar to ubiquitin-conjugating enzyme HBUCE1 n=1 Tax=Monodelphis domestica RepID=UPI0000F2B9B3 Length = 164 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D++KY AR WTQK AM Sbjct: 131 NPDDPLVPEIAHTYKADRDKYNRLAREWTQKYAM 164 [170][TOP] >UniRef100_C1K734 Ubiquitin carrier protein n=1 Tax=Larimichthys crocea RepID=C1K734_LARCR Length = 147 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIAHTYKADREKYNKLARDWTQKYAM 147 [171][TOP] >UniRef100_Q3U5V6 Ubiquitin carrier protein n=1 Tax=Mus musculus RepID=Q3U5V6_MOUSE Length = 147 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVPKIA +YKTD++KY +R WTQK AM Sbjct: 114 NPDDPLVPKIARIYKTDRDKYNRISREWTQKYAM 147 [172][TOP] >UniRef100_Q9ZTZ8 Ubiquitin carrier protein n=1 Tax=Pinus resinosa RepID=Q9ZTZ8_PINRE Length = 148 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK+ + +YE AR+WTQK AM Sbjct: 114 NPDDPLVPEIAHIYKSQRARYEETARAWTQKYAM 147 [173][TOP] >UniRef100_A9NV04 Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=A9NV04_PICSI Length = 148 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK+ + +YE AR+WTQK AM Sbjct: 114 NPDDPLVPEIAHIYKSQRARYEETARAWTQKYAM 147 [174][TOP] >UniRef100_C4QFM0 Ubiquitin carrier protein n=1 Tax=Schistosoma mansoni RepID=C4QFM0_SCHMA Length = 149 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AMG 223 NPDDPL P++A YKTD+ KY+ AR WTQK AMG Sbjct: 114 NPDDPLCPEVARQYKTDRKKYDELAREWTQKYAMG 148 [175][TOP] >UniRef100_UPI0001556040 PREDICTED: similar to ubiquitin-conjugating enzyme E2D 4 (putative) n=1 Tax=Ornithorhynchus anatinus RepID=UPI0001556040 Length = 143 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ KY AR WTQK AM Sbjct: 110 NPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 143 [176][TOP] >UniRef100_UPI0000EBF33A PREDICTED: similar to ubiquitin-conjugating enzyme E2D 3 n=1 Tax=Bos taurus RepID=UPI0000EBF33A Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA MYKTD++KY +R WTQK AM Sbjct: 114 NPDDPLVPEIAWMYKTDRDKYNRVSREWTQKYAM 147 [177][TOP] >UniRef100_UPI0000E2143A PREDICTED: similar to ubiquitin-conjugating enzyme HBUCE1 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E2143A Length = 167 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ KY AR WTQK AM Sbjct: 134 NPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 167 [178][TOP] >UniRef100_UPI000069E064 Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19) (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (HBUCE1). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069E064 Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 147 [179][TOP] >UniRef100_UPI0000363DAB UPI0000363DAB related cluster n=1 Tax=Tetraodon nigroviridis RepID=UPI0000363DAB Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDREKYNKIAREWTQKYAM 147 [180][TOP] >UniRef100_Q4T7B8 Chromosome 1 SCAF8155, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4T7B8_TETNG Length = 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 16 NPDDPLVPEIARIYKTDREKYNKIAREWTQKYAM 49 [181][TOP] >UniRef100_A5PKP9 Ubiquitin carrier protein n=1 Tax=Xenopus laevis RepID=A5PKP9_XENLA Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 147 [182][TOP] >UniRef100_A4QNX5 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=A4QNX5_DANRE Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 147 [183][TOP] >UniRef100_B9IQJ4 Ubiquitin carrier protein n=1 Tax=Populus trichocarpa RepID=B9IQJ4_POPTR Length = 148 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NP+DPLVP+IAH+Y TD+ KY++ AR+WTQK AM Sbjct: 114 NPNDPLVPEIAHIYTTDRVKYDATARAWTQKYAM 147 [184][TOP] >UniRef100_A0BUC8 Ubiquitin carrier protein n=1 Tax=Paramecium tetraurelia RepID=A0BUC8_PARTE Length = 148 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK 235 NPDDPLVP+IA++YKTDK +YE+ AR WT+K Sbjct: 115 NPDDPLVPEIANIYKTDKQRYEATAREWTRK 145 [185][TOP] >UniRef100_Q9UQL0 Ubiquitin carrier protein n=1 Tax=Homo sapiens RepID=Q9UQL0_HUMAN Length = 109 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ KY AR WTQK AM Sbjct: 76 NPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 109 [186][TOP] >UniRef100_Q6BJ01 Ubiquitin carrier protein n=1 Tax=Debaryomyces hansenii RepID=Q6BJ01_DEBHA Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK D+ KYES A+ WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKQDRAKYESTAKEWTKKYAV 147 [187][TOP] >UniRef100_B6QT40 Ubiquitin carrier protein n=2 Tax=Trichocomaceae RepID=B6QT40_PENMQ Length = 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +Y++ AR WT+K A+ Sbjct: 77 NPDDPLVPEIAHVYKTDRARYDATAREWTRKYAI 110 [188][TOP] >UniRef100_B6QT39 Ubiquitin carrier protein n=2 Tax=Trichocomaceae RepID=B6QT39_PENMQ Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +Y++ AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRARYDATAREWTRKYAI 147 [189][TOP] >UniRef100_B6K767 Ubiquitin carrier protein n=1 Tax=Schizosaccharomyces japonicus yFS275 RepID=B6K767_SCHJY Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTDRARYELSAREWTRKYAI 147 [190][TOP] >UniRef100_Q9Y2X8 Ubiquitin-conjugating enzyme E2 D4 n=2 Tax=Homo sapiens RepID=UB2D4_HUMAN Length = 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 147 [191][TOP] >UniRef100_UPI000194D200 PREDICTED: ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) n=1 Tax=Taeniopygia guttata RepID=UPI000194D200 Length = 174 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 141 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 174 [192][TOP] >UniRef100_UPI0000F2B380 PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b n=1 Tax=Monodelphis domestica RepID=UPI0000F2B380 Length = 270 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 237 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 270 [193][TOP] >UniRef100_UPI0000E80EBA PREDICTED: similar to Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex n=1 Tax=Gallus gallus RepID=UPI0000E80EBA Length = 265 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 232 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 265 [194][TOP] >UniRef100_UPI000020CDAB PREDICTED: similar to Ubiquitin-conjugating enzyme E2 D2 (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) isoform 6 n=2 Tax=Eutheria RepID=UPI000020CDAB Length = 110 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 77 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 110 [195][TOP] >UniRef100_UPI00015E0721 Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2). n=1 Tax=Homo sapiens RepID=UPI00015E0721 Length = 146 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 113 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 146 [196][TOP] >UniRef100_UPI000179E95F Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2). n=1 Tax=Bos taurus RepID=UPI000179E95F Length = 146 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 113 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 146 [197][TOP] >UniRef100_Q96RP6 Ubiquitin carrier protein n=2 Tax=Amniota RepID=Q96RP6_HUMAN Length = 118 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 85 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 118 [198][TOP] >UniRef100_Q7ZUK1 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q7ZUK1_DANRE Length = 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147 [199][TOP] >UniRef100_C1BX26 Ubiquitin carrier protein n=1 Tax=Esox lucius RepID=C1BX26_ESOLU Length = 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147 [200][TOP] >UniRef100_A4SAS4 Ubiquitin carrier protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4SAS4_OSTLU Length = 149 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK 235 NPDDPLVP+IAH+YKTD+N+Y A+ WT+K Sbjct: 115 NPDDPLVPEIAHIYKTDRNRYNDLAKEWTRK 145 [201][TOP] >UniRef100_Q54FX4 Ubiquitin carrier protein n=1 Tax=Dictyostelium discoideum RepID=Q54FX4_DICDI Length = 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK 235 NPDDPLVP IA+++KTDKN++ES AR WT+K Sbjct: 114 NPDDPLVPDIANLFKTDKNRFESNAREWTRK 144 [202][TOP] >UniRef100_C4YN21 Ubiquitin carrier protein n=2 Tax=Candida RepID=C4YN21_CANAL Length = 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK D+ KYE+ A+ WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYAV 147 [203][TOP] >UniRef100_C4R5C5 Ubiquitin carrier protein n=1 Tax=Pichia pastoris GS115 RepID=C4R5C5_PICPG Length = 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK+D+ KYE+ A+ WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKSDRAKYEATAKEWTKKYAV 147 [204][TOP] >UniRef100_B9WN01 Ubiquitin carrier protein n=1 Tax=Candida dubliniensis CD36 RepID=B9WN01_CANDC Length = 148 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK D+ KYE+ A+ WT+K A+ Sbjct: 115 NPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYAV 148 [205][TOP] >UniRef100_A5E6Q3 Ubiquitin carrier protein n=2 Tax=Saccharomycetales RepID=A5E6Q3_LODEL Length = 110 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK D+ KYE+ A+ WT+K A+ Sbjct: 77 NPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYAV 110 [206][TOP] >UniRef100_P43102 Ubiquitin-conjugating enzyme E2 4 n=1 Tax=Candida albicans RepID=UBC4_CANAL Length = 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK D+ KYE+ A+ WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYAV 147 [207][TOP] >UniRef100_O74196 Ubiquitin-conjugating enzyme E2-16 kDa n=1 Tax=Colletotrichum gloeosporioides RepID=UBC1_COLGL Length = 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPD+PLVP+IAH+YKTD+ +YE+ AR WT+K A+ Sbjct: 114 NPDEPLVPEIAHVYKTDRARYEATAREWTRKYAI 147 [208][TOP] >UniRef100_P62837 Ubiquitin-conjugating enzyme E2 D2 n=8 Tax=Euteleostomi RepID=UB2D2_HUMAN Length = 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147 [209][TOP] >UniRef100_UPI00016E8B91 UPI00016E8B91 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E8B91 Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ +Y AR WTQK AM Sbjct: 114 NPDDPLVPEIAHTYKADRERYNKLARDWTQKYAM 147 [210][TOP] >UniRef100_Q4SVL6 Ubiquitin carrier protein (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SVL6_TETNG Length = 118 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH YK D+ +Y AR WTQK AM Sbjct: 85 NPDDPLVPEIAHTYKADRERYNKLARDWTQKYAM 118 [211][TOP] >UniRef100_B9EP40 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B9EP40_SALSA Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD +KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDSDKYSRIAREWTQKYAM 147 [212][TOP] >UniRef100_Q2HQ73 Ubiquitin carrier protein n=1 Tax=Oesophagostomum dentatum RepID=Q2HQ73_9BILA Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+++Y AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDRYNQLAREWTQKYAM 147 [213][TOP] >UniRef100_Q2HQ72 Ubiquitin carrier protein n=1 Tax=Oesophagostomum dentatum RepID=Q2HQ72_9BILA Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+++Y AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDRYNQLAREWTQKYAM 147 [214][TOP] >UniRef100_Q2HQ71 Ubiquitin carrier protein n=1 Tax=Oesophagostomum dentatum RepID=Q2HQ71_9BILA Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+++Y AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDRYNQLAREWTQKYAM 147 [215][TOP] >UniRef100_C7DRP2 Ubiquitin carrier protein (Fragment) n=1 Tax=Onchocerca volvulus RepID=C7DRP2_ONCVO Length = 102 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+++Y AR WTQK AM Sbjct: 69 NPDDPLVPEIARVYKTDRDRYNQLAREWTQKYAM 102 [216][TOP] >UniRef100_C3YP43 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3YP43_BRAFL Length = 121 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IA MYKTD+ KY A+ WTQK AM Sbjct: 88 NPDDPLVPDIARMYKTDRPKYNHQAKEWTQKYAM 121 [217][TOP] >UniRef100_B3TK57 Ubiquitin carrier protein n=1 Tax=Haliotis diversicolor RepID=B3TK57_HALDV Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA M+K+D +KY+S AR WT+K AM Sbjct: 114 NPDDPLVPEIARMFKSDPHKYQSTAREWTKKYAM 147 [218][TOP] >UniRef100_A8NWS2 Ubiquitin carrier protein n=1 Tax=Brugia malayi RepID=A8NWS2_BRUMA Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+++Y AR WTQK AM Sbjct: 114 NPDDPLVPEIARVYKTDRDRYNQLAREWTQKYAM 147 [219][TOP] >UniRef100_C1GFH7 Ubiquitin-conjugating enzyme n=1 Tax=Paracoccidioides brasiliensis Pb18 RepID=C1GFH7_PARBD Length = 88 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKTD+ +YE+ AR WT+ A+ Sbjct: 29 NPDDPLVPEIAHVYKTDRPRYEATAREWTRNRAV 62 [220][TOP] >UniRef100_P15732 Ubiquitin-conjugating enzyme E2-16 kDa n=2 Tax=Saccharomyces cerevisiae RepID=UBC5_YEAST Length = 148 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTDK KYE+ A+ WT+K A+ Sbjct: 115 NPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYAV 148 [221][TOP] >UniRef100_UPI000186F309 ubiquitin-conjugating enzyme E2-17 kDa, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186F309 Length = 110 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY AR WT+K AM Sbjct: 77 NPDDPLVPEIARIYKTDRDKYNELAREWTRKYAM 110 [222][TOP] >UniRef100_UPI000155C67D PREDICTED: similar to UB2D2 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C67D Length = 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 25 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 58 [223][TOP] >UniRef100_UPI0000F2D5B5 PREDICTED: similar to Ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) n=1 Tax=Monodelphis domestica RepID=UPI0000F2D5B5 Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147 [224][TOP] >UniRef100_UPI0000E46B30 PREDICTED: similar to ubiquitin-conjugating enzyme E2D 2 n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E46B30 Length = 111 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IA +YKTD+ KY AR WTQK AM Sbjct: 77 NPDDPLVPDIARVYKTDRTKYNMIAREWTQKYAM 110 [225][TOP] >UniRef100_UPI0000DA4445 PREDICTED: similar to ubiquitin-conjugating enzyme E2D 1, UBC4/5 homolog n=1 Tax=Rattus norvegicus RepID=UPI0000DA4445 Length = 384 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IA +YK+DK KY AR WTQK AM Sbjct: 351 NPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 384 [226][TOP] >UniRef100_UPI0000D8F387 PREDICTED: similar to ubiquitin conjugating enzyme n=1 Tax=Monodelphis domestica RepID=UPI0000D8F387 Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147 [227][TOP] >UniRef100_UPI00003C048F PREDICTED: similar to Ubiquitin-conjugating enzyme E2-17 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) n=1 Tax=Apis mellifera RepID=UPI00003C048F Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ KY AR WT+K AM Sbjct: 114 NPDDPLVPEIARLYKTDREKYNELAREWTRKYAM 147 [228][TOP] >UniRef100_UPI0001B7BC97 UPI0001B7BC97 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7BC97 Length = 144 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY AR WT+K AM Sbjct: 110 NPDDPLVPEIARIYKTDRDKYNRLAREWTEKYAM 143 [229][TOP] >UniRef100_UPI0001B7BC96 UPI0001B7BC96 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7BC96 Length = 146 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 113 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 146 [230][TOP] >UniRef100_UPI0000180BB2 Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19) (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase). n=1 Tax=Rattus norvegicus RepID=UPI0000180BB2 Length = 150 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 117 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 150 [231][TOP] >UniRef100_UPI0000D60F6C Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19) (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin- conjugating enzyme E2-17 kDa 1) (E2(17)KB 1). n=1 Tax=Homo sapiens RepID=UPI0000D60F6C Length = 146 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IA +YK+DK KY AR WTQK AM Sbjct: 113 NPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 146 [232][TOP] >UniRef100_UPI0000457256 Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19) (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3). n=1 Tax=Homo sapiens RepID=UPI0000457256 Length = 148 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 115 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 148 [233][TOP] >UniRef100_UPI000179EC14 UPI000179EC14 related cluster n=1 Tax=Bos taurus RepID=UPI000179EC14 Length = 146 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 113 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 146 [234][TOP] >UniRef100_UPI000179CF13 Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19) (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1). n=1 Tax=Bos taurus RepID=UPI000179CF13 Length = 146 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IA +YK+DK KY AR WTQK AM Sbjct: 113 NPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 146 [235][TOP] >UniRef100_Q6PBX6 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q6PBX6_DANRE Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDNEKYNRIAREWTQKYAM 147 [236][TOP] >UniRef100_Q9D1S1 Ubiquitin carrier protein n=1 Tax=Mus musculus RepID=Q9D1S1_MOUSE Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147 [237][TOP] >UniRef100_A5DHX8 Ubiquitin carrier protein n=1 Tax=Pichia guilliermondii RepID=A5DHX8_PICGU Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK D+ KYE+ A+ WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKQDRAKYEATAKEWTKKYAV 147 [238][TOP] >UniRef100_A3GGX4 Ubiquitin carrier protein n=1 Tax=Pichia stipitis RepID=A3GGX4_PICST Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YK D+ KYE+ A+ WT+K A+ Sbjct: 114 NPDDPLVPEIAHIYKQDRAKYEATAKEWTKKYAV 147 [239][TOP] >UniRef100_P35129 Ubiquitin-conjugating enzyme E2 2 n=4 Tax=Chromadorea RepID=UBC2_CAEEL Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD+ +Y AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRERYNQLAREWTQKYAM 147 [240][TOP] >UniRef100_Q9UVR2 Ubiquitin-conjugating enzyme E2-16 kDa n=1 Tax=Magnaporthe grisea RepID=UBC1_MAGGR Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IAH+YKT + +YES AR WT+K A+ Sbjct: 114 NPDDPLVPEIAHVYKTARAQYESTAREWTRKYAI 147 [241][TOP] >UniRef100_P61077-2 Isoform 2 of Ubiquitin-conjugating enzyme E2 D3 n=1 Tax=Homo sapiens RepID=P61077-2 Length = 148 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY AR WT+K AM Sbjct: 114 NPDDPLVPEIARIYKTDRDKYNRLAREWTEKYAM 147 [242][TOP] >UniRef100_P61077-3 Isoform 3 of Ubiquitin-conjugating enzyme E2 D3 n=1 Tax=Homo sapiens RepID=P61077-3 Length = 149 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 116 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 149 [243][TOP] >UniRef100_P61077 Ubiquitin-conjugating enzyme E2 D3 n=7 Tax=Amniota RepID=UB2D3_HUMAN Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147 [244][TOP] >UniRef100_Q3ZCF7 Ubiquitin-conjugating enzyme E2 D3 n=1 Tax=Bos taurus RepID=UB2D3_BOVIN Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147 [245][TOP] >UniRef100_Q06AA9 Ubiquitin-conjugating enzyme E2 D2 n=1 Tax=Sus scrofa RepID=UB2D2_PIG Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD++KY +R WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147 [246][TOP] >UniRef100_P51668 Ubiquitin-conjugating enzyme E2 D1 n=6 Tax=Eutheria RepID=UB2D1_HUMAN Length = 147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP IA +YK+DK KY AR WTQK AM Sbjct: 114 NPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147 [247][TOP] >UniRef100_UPI0000EBEFFA PREDICTED: similar to ubiquitin-conjugating enzyme E2D 3 n=1 Tax=Bos taurus RepID=UPI0000EBEFFA Length = 147 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 324 PDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 PDDPLVP+IA MYKTD++KY +R WTQK AM Sbjct: 115 PDDPLVPEIARMYKTDRDKYNRVSREWTQKYAM 147 [248][TOP] >UniRef100_Q7ZUR2 Ubiquitin carrier protein n=1 Tax=Danio rerio RepID=Q7ZUR2_DANRE Length = 147 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDTEKYNRIAREWTQKYAM 147 [249][TOP] >UniRef100_B9EN06 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B9EN06_SALSA Length = 147 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDTEKYNRIAREWTQKYAM 147 [250][TOP] >UniRef100_B9EMG0 Ubiquitin carrier protein n=1 Tax=Salmo salar RepID=B9EMG0_SALSA Length = 147 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 327 NPDDPLVPKIAHMYKTDKNKYESPARSWTQK*AM 226 NPDDPLVP+IA +YKTD KY AR WTQK AM Sbjct: 114 NPDDPLVPEIARIYKTDTEKYNRIAREWTQKYAM 147