[UP]
[1][TOP] >UniRef100_Q3EBX0 Putative uncharacterized protein At2g21660.2 n=1 Tax=Arabidopsis thaliana RepID=Q3EBX0_ARATH Length = 159 Score = 108 bits (269), Expect = 2e-22 Identities = 48/57 (84%), Positives = 49/57 (85%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GRREGGGGYSG GYSSRGGGGGSYGGGRR+ GGYGGGE GGYG SGGGGGW Sbjct: 103 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 159 [2][TOP] >UniRef100_C0Z304 AT2G21660 protein n=2 Tax=Arabidopsis thaliana RepID=C0Z304_ARATH Length = 115 Score = 108 bits (269), Expect = 2e-22 Identities = 48/57 (84%), Positives = 49/57 (85%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GRREGGGGYSG GYSSRGGGGGSYGGGRR+ GGYGGGE GGYG SGGGGGW Sbjct: 59 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 115 [3][TOP] >UniRef100_Q03250 Glycine-rich RNA-binding protein 7 n=1 Tax=Arabidopsis thaliana RepID=GRP7_ARATH Length = 176 Score = 108 bits (269), Expect = 2e-22 Identities = 48/57 (84%), Positives = 49/57 (85%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GRREGGGGYSG GYSSRGGGGGSYGGGRR+ GGYGGGE GGYG SGGGGGW Sbjct: 120 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 176 [4][TOP] >UniRef100_P49311 Glycine-rich RNA-binding protein GRP2A n=1 Tax=Sinapis alba RepID=GRP2_SINAL Length = 169 Score = 89.7 bits (221), Expect = 9e-17 Identities = 43/56 (76%), Positives = 44/56 (78%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 G GRREGGG YSG GYSSRGGGGG YGGG R+ GGYGGGE GGYG GGGGGW Sbjct: 116 GGGRREGGG-YSGGGGGYSSRGGGGGGYGGGGRRDGGGYGGGEGGGYG-GGGGGGW 169 [5][TOP] >UniRef100_B6VA25 Putative glycine-rich RNA-binding protein n=1 Tax=Chorispora bungeana RepID=B6VA25_CHOBU Length = 175 Score = 89.0 bits (219), Expect = 2e-16 Identities = 42/56 (75%), Positives = 44/56 (78%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GRREGG YSG GY SRGGGGG YGGG + EGGYGGGE+GGYG SGGGGG Sbjct: 120 GGGGRREGG--YSGGGGGYPSRGGGGGGYGGGGGRREGGYGGGESGGYGGSGGGGG 173 [6][TOP] >UniRef100_C0Z2N6 AT2G21660 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2N6_ARATH Length = 153 Score = 88.2 bits (217), Expect = 3e-16 Identities = 42/57 (73%), Positives = 43/57 (75%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG R GGGGYSG G S GGGGGSYGGGRR+ GGYGGGE GGYG SGGGGGW Sbjct: 100 GGGYRSGGGGGYSG---GGGSYGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW 153 [7][TOP] >UniRef100_P49310 Glycine-rich RNA-binding protein GRP1A n=1 Tax=Sinapis alba RepID=GRP1_SINAL Length = 166 Score = 77.0 bits (188), Expect = 6e-13 Identities = 39/59 (66%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = -1 Query: 310 GGDGRREGG--GGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GG GGYSG GYSSRGGGGG YGGG R+ GGE GGYG SGGGGGW Sbjct: 113 GGGGYGGGGREGGYSGGGGGYSSRGGGGGGYGGGGRR-----DGGEGGGYGGSGGGGGW 166 [8][TOP] >UniRef100_O04070 SGRP-1 protein n=1 Tax=Solanum commersonii RepID=O04070_SOLCO Length = 162 Score = 72.4 bits (176), Expect = 1e-11 Identities = 38/57 (66%), Positives = 39/57 (68%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG RREGGGG G GY RGGGGG YGGGRR EGG GGG GG E GGGGG+ Sbjct: 99 GGGRRREGGGGGYGGGGGY--RGGGGGGYGGGRR--EGGGGGGYGGGRREGGGGGGY 151 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 4/54 (7%) Frame = -1 Query: 289 GGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG----ESGGGGGW 140 GGGG G G R GGGG YGGG GGY GG GGYG E GGGGG+ Sbjct: 90 GGGGGGGGFGGGRRREGGGGGYGGG-----GGYRGGGGGGYGGGRREGGGGGGY 138 [9][TOP] >UniRef100_Q03251-2 Isoform 2 of Glycine-rich RNA-binding protein 8 n=1 Tax=Arabidopsis thaliana RepID=Q03251-2 Length = 110 Score = 70.9 bits (172), Expect = 4e-11 Identities = 35/58 (60%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGG-SYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GGGGY GY S GGGGG YGGG R+ GGYGGG+ G YG GGGGGW Sbjct: 55 GGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYG--GGGGGW 110 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/55 (56%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGE--AGGYGESGGGGG 143 G GGGG G GY S GGGG S GGG GG GG E +GGYG GGGGG Sbjct: 27 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGG 81 [10][TOP] >UniRef100_Q03251 Glycine-rich RNA-binding protein 8 n=2 Tax=Arabidopsis thaliana RepID=GRP8_ARATH Length = 169 Score = 70.9 bits (172), Expect = 4e-11 Identities = 35/58 (60%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGG-SYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GGGGY GY S GGGGG YGGG R+ GGYGGG+ G YG GGGGGW Sbjct: 114 GGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYG--GGGGGW 169 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/55 (56%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGE--AGGYGESGGGGG 143 G GGGG G GY S GGGG S GGG GG GG E +GGYG GGGGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGG 140 [11][TOP] >UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G232_9DELT Length = 136 Score = 69.3 bits (168), Expect = 1e-10 Identities = 35/60 (58%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSS----RGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGGY G GY RGGGGG YGGG GG GGG GG G GGGGG Sbjct: 60 GGGGRGGGGGGYGGGGGGYGGGGGGRGGGGGGYGGGGGGGRGGRGGGGGGGRGGRGGGGG 119 Score = 67.0 bits (162), Expect = 6e-10 Identities = 33/56 (58%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGG G GY GGG G GGGR GGYGGG GG G GGGGG Sbjct: 53 GGGGRGGGGGGRGGGGGGYGGGGGGYGGGGGGRGGGGGGYGGGGGGGRGGRGGGGG 108 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/56 (60%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGGY G G RGG GG GGGR GG GGG GGYG GGGGG Sbjct: 81 GGGGRGGGGGGYGG--GGGGGRGGRGGGGGGGR----GGRGGG-GGGYGGGGGGGG 129 [12][TOP] >UniRef100_A2C5L0 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9303 RepID=A2C5L0_PROM3 Length = 202 Score = 68.6 bits (166), Expect = 2e-10 Identities = 34/56 (60%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G GY GGGGG YGGG GG GGG GGYG GGGGG Sbjct: 95 GGGGYGGGGGGYGGGGGGY---GGGGGGYGGGGGGYGGGGGGGGGGGYGGGGGGGG 147 Score = 65.5 bits (158), Expect = 2e-09 Identities = 35/56 (62%), Positives = 35/56 (62%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G GY GGGGG YGGG GGYGGG GGYG GGGGG Sbjct: 88 GGGGYGGGGGGYGGGGGGY---GGGGGGYGGG----GGGYGGG-GGGYGGGGGGGG 135 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/58 (50%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG-GW 140 GG G GGGGY G GY GGGGG GGYGGG GG G+ G G GW Sbjct: 109 GGGGYGGGGGGYGGGGGGYGGGGGGGGG---------GGYGGGGGGGGGDRGSGARGW 157 [13][TOP] >UniRef100_Q03878 Glycine-rich RNA-binding protein n=1 Tax=Daucus carota RepID=GRP1_DAUCA Length = 157 Score = 68.6 bits (166), Expect = 2e-10 Identities = 37/69 (53%), Positives = 37/69 (53%), Gaps = 12/69 (17%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSR--GGGGGSYGGGRRKVEGGYGGGEAG----------GY 167 GG GRREGGGG G GY R GGGGG YGG R GGYGGG G GY Sbjct: 89 GGGGRREGGGGGYGGGGGYGGRREGGGGGGYGGRREGGGGGYGGGGGGYGGRREGGDGGY 148 Query: 166 GESGGGGGW 140 G GGG W Sbjct: 149 GGGGGGSRW 157 [14][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 67.8 bits (164), Expect = 4e-10 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPPL P P PPPP LP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLP 292 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPL--EE*PSTSPLYPPPPSRLPS 305 PPPPP P PP PPP PP PPP LPPPPP P+TS PP + P+ Sbjct: 256 PPPPPPPPPPPPPPPPLPPPP--PPPPPLPPPPPSLPLPLPTTSATVAPPSTSQPT 309 [15][TOP] >UniRef100_Q6YNS1 Putative glycine-rich RNA-binding protein n=1 Tax=Prunus avium RepID=Q6YNS1_PRUAV Length = 178 Score = 66.6 bits (161), Expect = 8e-10 Identities = 34/56 (60%), Positives = 35/56 (62%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GRREGGGG G G GGG YGGG R+ EGGYGGGE GG S G GG Sbjct: 116 GGGGRREGGGGGYSRGGGGGGYGSGGGGYGGGGRR-EGGYGGGEGGGARYSRGSGG 170 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/57 (56%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Frame = -1 Query: 295 REGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGG-----GEAGGYGESGGGGGW 140 R GGG G+ GYS RGGGGG YGGG GGYGG G GGY GGGGG+ Sbjct: 87 RGSGGGGGGNGGGYS-RGGGGGGYGGG-----GGYGGGGRREGGGGGYSRGGGGGGY 137 [16][TOP] >UniRef100_O24601 Glycine-rich RNA binding protein 1 n=1 Tax=Pelargonium x hortorum RepID=O24601_PELHO Length = 166 Score = 66.6 bits (161), Expect = 8e-10 Identities = 38/57 (66%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = -1 Query: 310 GGDGRREGGGGYS--GDVDGYSSRGGGGGSYGGGRRKVEGGYGGG-EAGGYGESGGG 149 GG GRREGGGGYS G GY GGGGG YGGG GGYGGG E GYG+SGGG Sbjct: 102 GGYGRREGGGGYSRGGGGGGY---GGGGGGYGGGNG---GGYGGGREQRGYGDSGGG 152 [17][TOP] >UniRef100_B0X4Q7 Putative uncharacterized protein n=1 Tax=Culex quinquefasciatus RepID=B0X4Q7_CULQU Length = 798 Score = 66.6 bits (161), Expect = 8e-10 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 8/60 (13%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY---GGGEAGGYG-----ESGGGGG 143 +R GGGG G G SS GGGGGSYGGG + +GGY GGG +GGYG SGGGGG Sbjct: 729 QRSGGGGGGGGGAGRSSYGGGGGSYGGGGSRDDGGYYRNGGGSSGGYGGSYNNNSGGGGG 788 [18][TOP] >UniRef100_B9R282 'Cold-shock' DNA-binding domain protein n=1 Tax=Labrenzia alexandrii DFL-11 RepID=B9R282_9RHOB Length = 307 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/55 (60%), Positives = 35/55 (63%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G R G GG G DG GGG G YGGG + EGGYGGG+ GGYG GGGGG Sbjct: 84 GGGDRGGYGGGGGGRDGGGYGGGGRGGYGGGGGR-EGGYGGGDRGGYGGGGGGGG 137 Score = 65.1 bits (157), Expect = 2e-09 Identities = 34/56 (60%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGD GGGG G DG GGG G YGGG + EGGYGGG+ GGYG GGGGG Sbjct: 123 GGDRGGYGGGGGGGGRDGGGYGGGGRGGYGGGGSR-EGGYGGGDRGGYG--GGGGG 175 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R+GGG G GY G G YGGG R GG GGG GGYG GGG G Sbjct: 133 GGGGGRDGGGYGGGGRGGYGGGGSREGGYGGGDRGGYGGGGGGRDGGYGGGGGGRG 188 Score = 59.3 bits (142), Expect = 1e-07 Identities = 37/67 (55%), Positives = 40/67 (59%), Gaps = 11/67 (16%) Frame = -1 Query: 310 GGD--GRREGG--GGYSGDVDGYSSRGGGGGS-------YGGGRRKVEGGYGGGEAGGYG 164 GGD G R+GG GG D G S RGG GG YGGGR +GGYGGG+ GGYG Sbjct: 36 GGDYGGGRDGGHRGGRDNDFGGGSGRGGYGGGGGGDRGGYGGGR---DGGYGGGDRGGYG 92 Query: 163 ESGGGGG 143 GGGGG Sbjct: 93 --GGGGG 97 [19][TOP] >UniRef100_Q05966 Glycine-rich RNA-binding protein 10 n=1 Tax=Brassica napus RepID=GRP10_BRANA Length = 169 Score = 66.2 bits (160), Expect = 1e-09 Identities = 34/60 (56%), Positives = 36/60 (60%), Gaps = 3/60 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG---GGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G R GGGGY G G GGGG GGG R+ GGYGGG+ GGYG GGGGW Sbjct: 111 GGYGDRRGGGGYGSGGGGRGGGGYGSGGGGYGGGGGRRDGGGYGGGD-GGYGGGSGGGGW 169 [20][TOP] >UniRef100_UPI0001867639 hypothetical protein BRAFLDRAFT_237268 n=1 Tax=Branchiostoma floridae RepID=UPI0001867639 Length = 360 Score = 65.9 bits (159), Expect = 1e-09 Identities = 34/56 (60%), Positives = 35/56 (62%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGYSG GY GGGGGSYGGG GGYGGG GGY + G G G Sbjct: 263 GGGGYGGGGGGYSGGGGGY---GGGGGSYGGGG----GGYGGGSGGGYSDFGSGYG 311 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/59 (54%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGY--GESGGGGGW 140 GG G+R+GG G G GY GG GG YGGG GGYGG GGY G GGGGG+ Sbjct: 195 GGRGQRQGGFGGRGRGGGYGGGGGRGGGYGGG-----GGYGGDRGGGYNNGNYGGGGGY 248 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/62 (54%), Positives = 36/62 (58%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREG---GGGYSGDVDGYSSRG--GGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG GR G GGGY GD G + G GGGG YGGG GG G G GGYG GGGG Sbjct: 215 GGGGRGGGYGGGGGYGGDRGGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGGYG--GGGG 272 Query: 145 GW 140 G+ Sbjct: 273 GY 274 Score = 57.4 bits (137), Expect = 5e-07 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 9/65 (13%) Frame = -1 Query: 310 GGDGRREG-GGGYSGDVDGYSS--------RGGGGGSYGGGRRKVEGGYGGGEAGGYGES 158 GG G G GGGYS GY S +GGGGG YGGG R+ G YGGG + G G Sbjct: 291 GGGGYGGGSGGGYSDFGSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPYGGGYSSGGGGG 350 Query: 157 GGGGG 143 GG GG Sbjct: 351 GGYGG 355 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = -1 Query: 304 DGRREGGGGYSGDVDGYSSRGG--GGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 +G GGGGY G G S GG GGG YGGG GG GGG GG G GGGGG Sbjct: 239 NGNYGGGGGYGGGGYGGSGGGGYGGGGGYGGGGGGYSGG-GGGYGGGGGSYGGGGG 293 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/65 (47%), Positives = 32/65 (49%), Gaps = 9/65 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGG---------SYGGGRRKVEGGYGGGEAGGYGES 158 GG GR G GG G GY GG GG +YGGG GGYGG GGYG Sbjct: 205 GGRGRGGGYGGGGGRGGGYGGGGGYGGDRGGGYNNGNYGGGGGYGGGGYGGSGGGGYGGG 264 Query: 157 GGGGG 143 GG GG Sbjct: 265 GGYGG 269 [21][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/55 (58%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PPS PPP PPPPP P SP PPPPS P P Sbjct: 206 PPPPPPPPLPPPPPPPPPPS----PPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 63.9 bits (154), Expect = 5e-09 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 3/65 (4%) Frame = +3 Query: 117 PKPN*RNYHPP-PPPLSP*PPASPPPYPPSTLRLPPP*LP--PPPPLEE*PSTSPLYPPP 287 P P + HPP PPP SP PP+ PPP PP + PPP P PPPP PS P PPP Sbjct: 2255 PSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Query: 288 PSRLP 302 PS+ P Sbjct: 2315 PSQPP 2319 Score = 63.5 bits (153), Expect = 7e-09 Identities = 32/55 (58%), Positives = 35/55 (63%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PPS PPP PPPPP P + P PPPP LP+P Sbjct: 219 PPPPPPSPPPPSPPPPPPPS----PPPPSPPPPP----PPSPP--PPPPPPLPTP 263 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP P PP PPPPL PS P PPPPS PSP Sbjct: 2725 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPP-SPPPPSPPPSP 2780 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/54 (57%), Positives = 33/54 (61%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP SP PP+ PPP PP + PPP PPPP PS P PPPPS PSP Sbjct: 2670 PPPPPSP-PPSPPPPSPPPS---PPP--SPPPPSPPPPSPPPPSPPPPSPPPSP 2717 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPP 290 P P + P PPP SP PP+ PPP PP P PP PPPP PS P PP P Sbjct: 2706 PSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAP 2765 Query: 291 SRLPSP 308 S PSP Sbjct: 2766 SPPPSP 2771 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/54 (53%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP-PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP + P PP PPPP PS P PPPPS P Sbjct: 2696 PSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2749 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/71 (43%), Positives = 36/71 (50%) Frame = +3 Query: 96 ERTFIGNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPL 275 E T I + + + PP PP SP PP+ PPP PP PP PP PP P + P Sbjct: 2518 EHTMISSDPCSPPSPPPPSPPPSP-PPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPP 2576 Query: 276 YPPPPSRLPSP 308 PPPPS P P Sbjct: 2577 SPPPPSPPPYP 2587 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPP-P*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PP PP SP PP+ PPP PP PP P PPPP PS P PPPPS P Sbjct: 2686 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2739 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP-PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 2691 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2744 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/62 (48%), Positives = 32/62 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PP PP SP PP+ PPP PP PP PPPP PS P PPPPS Sbjct: 2701 PSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSP 2757 Query: 297 LP 302 P Sbjct: 2758 PP 2759 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/54 (53%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPP-P*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPP P P PP SPPP PP PP P P PPP PS P PPPPS P Sbjct: 2676 PPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/55 (52%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP--PPPLEE*PSTSPLYPPPPSRLP 302 PPPP P PP SPPP P PPP PP PPP PS P PPPPS P Sbjct: 2680 PPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPP 2734 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P PPP SP PP+ PPP PP LPP PPP P P SP P PP R Sbjct: 2740 PSPPPPSPPPPSPPPPSPPPP--LPPAPSPPPSPPPPSPPPSPPPPSPPDR 2788 [22][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 65.9 bits (159), Expect = 1e-09 Identities = 31/58 (53%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLY---PPPPSRLPSP 308 PPPPP+ PP SPPP PP PPP PPPPP P P+Y PPPPS P+P Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/64 (48%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P Y PPPPP P P SPPP PP PPP PPPP P P+Y PPP Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPP--PPPPVYSPPPPPPPPPPPPPVYSPPPPS 486 Query: 297 LPSP 308 P P Sbjct: 487 PPPP 490 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/57 (50%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*L--PPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP+ PP PPP PP PPP PPPPP+ P SP PPPP P P Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP SP PP PPP PP PPP PPPPP P+Y PPP P P Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP--------PVYSPPPPPPPPP 505 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/62 (46%), Positives = 34/62 (54%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*L---PPPPPLEE*PSTSPLY----PPPPSRLP 302 PPPPP+ PP PPP PP PPP + PPPPP P+ +P+Y PPPP P Sbjct: 489 PPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPS---PAPTPVYCTRPPPPPPHSP 545 Query: 303 SP 308 P Sbjct: 546 PP 547 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/76 (40%), Positives = 35/76 (46%), Gaps = 11/76 (14%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPA-----------SPPPYPPSTLRLPPP*LPPPPPLEE*P 260 +P+P PPP SP PPA PPP PP + PPP PPPPP+ P Sbjct: 393 SPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPP 452 Query: 261 STSPLYPPPPSRLPSP 308 P PPPP P P Sbjct: 453 PPPPPPPPPPVYSPPP 468 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/70 (47%), Positives = 34/70 (48%), Gaps = 6/70 (8%) Frame = +3 Query: 117 PKPN*RNYHPPPPPL--SP*PPASPPPYPPSTLR-LPPP*LPPPPPLEE*PSTSPLY--- 278 P P Y PPPPP+ SP PP SP P P R PPP PPPP P P Y Sbjct: 503 PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSS 562 Query: 279 PPPPSRLPSP 308 PPPP P P Sbjct: 563 PPPPHSSPPP 572 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/57 (50%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +3 Query: 147 PPPPLSP*P---PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P P P PPP PP PPP PPPPP P SP PPPP P P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP----PVYSPPPPPPPPPPPPP 478 [23][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/53 (56%), Positives = 31/53 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PPS PPP PPPPP P P +PPPPS P Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 64.3 bits (155), Expect = 4e-09 Identities = 39/71 (54%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Frame = +3 Query: 102 TFIG-NPKPN*RNYHPPPPPLSP*PPA-SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPL 275 T IG NP P PPPPPL P PP SPPP PPS PPP LPPPPP P P Sbjct: 203 TVIGYNPPPP---SPPPPPPLPPSPPPPSPPPPPPS----PPPPLPPPPPPPPPPPPPPP 255 Query: 276 YPPPPSRLPSP 308 PPPP P P Sbjct: 256 PPPPPPPPPPP 266 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPPL P P PPPP P P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP PSP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP PS P PPPP P P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P + P PPPP P P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/53 (54%), Positives = 29/53 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P P PPPP LP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/54 (53%), Positives = 29/54 (53%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P PL P PP P P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP LPP PP P P PPPP P P Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP LPP PPPPP P P PPPP P P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPP--PPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PP P P P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 [24][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 65.5 bits (158), Expect = 2e-09 Identities = 34/56 (60%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G G GGGGG YGGG GGYGGG GGYG GGGGG Sbjct: 119 GGGGYGGGGGGYGGGGGG-GYGGGGGGGYGGGG---GGGYGGGGGGGYGGGGGGGG 170 Score = 63.2 bits (152), Expect = 9e-09 Identities = 32/51 (62%), Positives = 32/51 (62%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 R GGGGY G GY GGGGG YGGG GGYGGG GGYG GGGG Sbjct: 116 RGGGGGGYGGGGGGYG--GGGGGGYGGGG---GGGYGGGGGGGYGGGGGGG 161 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/57 (50%), Positives = 29/57 (50%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGG G G GGGGG YGGG GGYGGG GG G GW Sbjct: 126 GGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGGGG---GGYGGGGGGGGDRPSGARGW 179 [25][TOP] >UniRef100_A5JVC2 Putative uncharacterized protein (Fragment) n=1 Tax=Brassica rapa RepID=A5JVC2_BRACM Length = 250 Score = 65.5 bits (158), Expect = 2e-09 Identities = 35/56 (62%), Positives = 35/56 (62%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GR GGGG S G S GGGGGSYGGGR GG GGGE G YG GGGGG Sbjct: 170 GRQGRYGGGGGGSFGGGGGGSYGGGGGSYGGGR---YGGGGGGEGGRYGGDGGGGG 222 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/57 (45%), Positives = 29/57 (50%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGG Y G G R GG G GGGR GG GG+ GGY ++ G W Sbjct: 192 GGGGGSYGGGRYGGGGGGEGGRYGGDGGGGGGRYGGGGGGYGGDGGGYSKADGADNW 248 [26][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/55 (58%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PP PPP PP L LPPP PPPPL P P PPPPS PSP Sbjct: 984 PTPPPPAPPPPNPPPPSPPPPLPLPPP-PSPPPPLPPPPLPPPPLPPPPSPPPSP 1037 Score = 63.5 bits (153), Expect = 7e-09 Identities = 34/61 (55%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLR---LPPP*LPPPP---PLEE*PSTSPLYPPPPSRLPS 305 P PPP SP PP PPP PP L LPPP +PPPP PL P P PPPPS PS Sbjct: 1176 PNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPS 1235 Query: 306 P 308 P Sbjct: 1236 P 1236 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PP PPP PP L LPPP PPPPL P P PPPPS P P Sbjct: 897 PTPPPPAPPPPNPPPPSPPPPLPLPPP-PSPPPPLPPPPLPPPPVPPPPSPPPLP 950 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/65 (55%), Positives = 37/65 (56%), Gaps = 10/65 (15%) Frame = +3 Query: 144 PPPPPLS--P*PPASPPPYPPSTLRLPPP*LP----PPPPLEE*PSTSPL----YPPPPS 293 PP PP S P PP SPPP PP L LPPP P PPPP+ PS PL PPPPS Sbjct: 1582 PPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPS 1641 Query: 294 RLPSP 308 PSP Sbjct: 1642 PPPSP 1646 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPP--STLRLPPP*LPPPPPLEE*PSTSPLYPPP 287 +P P+ P PPP SP PP PPP PP S LPPP LPPPP P SP PP Sbjct: 1596 SPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSPPPSPPPSPPPSPP 1655 Query: 288 PSRLPSP 308 PS PSP Sbjct: 1656 PSPPPSP 1662 Score = 62.8 bits (151), Expect = 1e-08 Identities = 39/69 (56%), Positives = 40/69 (57%), Gaps = 5/69 (7%) Frame = +3 Query: 117 PKPN*RNYHPPPP-PLSP*PPASPPPYPP-STLRLPPP*LPPPP---PLEE*PSTSPLYP 281 P PN PPPP P SP PP+ PPP PP S PPP PPPP P PSTSP P Sbjct: 1719 PPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSP-SP 1777 Query: 282 PPPSRLPSP 308 PPPS PSP Sbjct: 1778 PPPSASPSP 1786 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 6/61 (9%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP------PPPPLEE*PSTSPLYPPPPSRLPS 305 P PPP +P PPA PPP PP PPP LP PPPPL P P PPPPS PS Sbjct: 801 PSPPPPTPPPPAPPPPNPPPPS--PPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPS 858 Query: 306 P 308 P Sbjct: 859 P 859 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/64 (53%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + P PPP SP PP PPP PPS LPPP PP PP PS P PPPP Sbjct: 1550 PSPPPPSPPPSPPPPSPPPPLPPPPVPPSP--LPPPSPPPSPPPSPPPSPPP-SPPPPLP 1606 Query: 297 LPSP 308 LP P Sbjct: 1607 LPPP 1610 Score = 61.2 bits (147), Expect = 3e-08 Identities = 38/70 (54%), Positives = 40/70 (57%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPP-----PPPLEE*PSTSPLY 278 +P P + PPPP LSP PP SPPP PST PPP PP PPP PS SP Sbjct: 279 SPPPPSLSPSPPPPSLSPSPPPSPPP--PSTSPSPPPRPPPSASPSPPP----PSLSPS- 331 Query: 279 PPPPSRLPSP 308 PPPPS PSP Sbjct: 332 PPPPSLSPSP 341 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/64 (53%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P PN PPPP P PP+ PPP PP LPPP LPPPP P SP PPPS Sbjct: 814 PPPNPPPPSPPPPLPLPPPPSPPPPLPPPP--LPPPPLPPPPS----PPPSPPPSPPPSP 867 Query: 297 LPSP 308 PSP Sbjct: 868 PPSP 871 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/64 (53%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P PN PPPP P PP+ PPP PP LPPP LPPPP P SP PPPS Sbjct: 992 PPPNPPPPSPPPPLPLPPPPSPPPPLPPPP--LPPPPLPPPPS----PPPSPPPSPPPSP 1045 Query: 297 LPSP 308 PSP Sbjct: 1046 PPSP 1049 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/66 (51%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPL--SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 P P+ PPP P +P PP PPP PP L LPPP PPPPL P P PPPP Sbjct: 1064 PPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP-PSPPPPLPPPPLPPPPLPPPP 1122 Query: 291 SRLPSP 308 S PSP Sbjct: 1123 SPPPSP 1128 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/64 (53%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P PN PPPP P PP+ PPP PP LPPP LPPPP P SP PPPS Sbjct: 1083 PPPNPPPPSPPPPLPLPPPPSPPPPLPPPP--LPPPPLPPPPS----PPPSPPPSPPPSP 1136 Query: 297 LPSP 308 PSP Sbjct: 1137 PPSP 1140 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/69 (50%), Positives = 36/69 (52%), Gaps = 5/69 (7%) Frame = +3 Query: 117 PKPN*RNYHPPPP-----PLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP 281 P PN PPPP P SP PP PPP PP +PPP P PPPL P P P Sbjct: 905 PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPP--VPPP--PSPPPLPPPPLPPPPLP 960 Query: 282 PPPSRLPSP 308 PPPS PSP Sbjct: 961 PPPSPPPSP 969 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/57 (57%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = +3 Query: 147 PPPPLSP*P---PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P P P SPPP PP LPPP LPPPP P SP PPPS PSP Sbjct: 1198 PPPPLPPPPVPPPPSPPPLPPPP--LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSP 1252 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/56 (57%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP-PPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PP PPP PPS PPP PPP PP PS P PPPPS PSP Sbjct: 1716 PLPPPPNPPPPLPPPPSPPSP---PPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSP 1768 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PPA PPP PP + PP PPPP P+ P PPPP LP P Sbjct: 778 PSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 832 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/62 (53%), Positives = 34/62 (54%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP----PLEE*PSTSPLYPPP---PSRLP 302 P PPP +P PP PPP PP L LPPP PPPP PL P P PPP PS P Sbjct: 806 PTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 865 Query: 303 SP 308 SP Sbjct: 866 SP 867 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PPA PPP PP + PP PPPP P+ P PPPP LP P Sbjct: 869 PSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 923 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PPA PPP PP + PP PPPP P+ P PPPP LP P Sbjct: 1047 PSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 1101 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/62 (53%), Positives = 34/62 (54%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP----PLEE*PSTSPLYPPP---PSRLP 302 P PPP +P PP PPP PP L LPPP PPPP PL P P PPP PS P Sbjct: 1075 PTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPP 1134 Query: 303 SP 308 SP Sbjct: 1135 SP 1136 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/56 (53%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLR---LPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PP PP SP PP+ PPP PP L LPPP PP PP PS P PPPP+ P Sbjct: 698 PPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 753 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/56 (53%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PPA PP PPS PPP PP PPP P+ P PPPP+ PSP Sbjct: 744 PTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSP 799 Score = 60.1 bits (144), Expect = 8e-08 Identities = 33/65 (50%), Positives = 35/65 (53%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P+ PP PP SP PP PPP PP PPP PPP PL PS P PPPP Sbjct: 964 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP-NPPPPSPPPPLPLPPPPSPPPPLPPPP- 1021 Query: 294 RLPSP 308 LP P Sbjct: 1022 -LPPP 1025 Score = 59.7 bits (143), Expect = 1e-07 Identities = 37/73 (50%), Positives = 39/73 (53%), Gaps = 8/73 (10%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPA---SPPPYPPSTLRLPPP*LPPP-----PPLEE*PSTS 269 +P P + PPPP LSP PP SP P PPS PPP PPP PP PS S Sbjct: 261 SPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSPPPPSTSPSPPPRPPPSAS 320 Query: 270 PLYPPPPSRLPSP 308 P PPPPS PSP Sbjct: 321 PS-PPPPSLSPSP 332 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/55 (60%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PPP PP LPPP LPPPP P P SP PPPS PSP Sbjct: 931 PPPPLPP-PPVPPPPSPPP---LPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 981 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/57 (59%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +3 Query: 147 PPPPLSP*PPASPPPY--PPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PPP PPS LPPP LPPPP P P SP PPPS PSP Sbjct: 1193 PPPPLPP-PPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1248 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPPL P PP PPP PP + PPP PP PP PS SPL PPP PSP Sbjct: 1626 PSPPPLPP-PPLPPPPSPPPS---PPPSPPPSPPPSPPPSPSPLPPPPTPPPPSP 1676 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/56 (57%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPP-STLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P SP PP SPPP PP S PPP PPP PL PS P PPPP +P P Sbjct: 1572 PPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPP--VPPP 1625 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/66 (48%), Positives = 37/66 (56%), Gaps = 3/66 (4%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTL---RLPPP*LPPPPPLEE*PSTSPLYPP 284 +P P + P PPP SP PP+ PPP PP L LPPP LPPP P P + P PP Sbjct: 684 SPPPPSPSPPPSPPPPSP-PPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPP 742 Query: 285 PPSRLP 302 PP+ P Sbjct: 743 PPTPPP 748 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PP SP PP PPP PP PPP PPP PL PS P PPPP LP P Sbjct: 887 PPSPPPSPPPPTPPPPAPPPP-NPPPPSPPPPLPLPPPPSPPPPLPPPP--LPPP 938 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP SPPP PP + PP PPPP P+ P PPPP LP P Sbjct: 956 PPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPP 1010 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/68 (51%), Positives = 37/68 (54%), Gaps = 3/68 (4%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PP---ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP 284 +P P + PPPP SP PP SP P PPST PPP PP P PS SP PP Sbjct: 1776 SPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPPP--PPASPSPPPPSASP-SPP 1832 Query: 285 PPSRLPSP 308 PPS PSP Sbjct: 1833 PPSSSPSP 1840 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/66 (51%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PP-ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 +P P + PPPP LSP PP A+PPP PP PPP LPPPP P P PPPP Sbjct: 349 SPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPS--PPPPLPPPPSPPP-PLPPPPIPPPP 405 Query: 291 SRLPSP 308 S P P Sbjct: 406 SPPPPP 411 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/63 (46%), Positives = 32/63 (50%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P+ PP PP SP PP PPP PP P P PPPP P+ P PPPPS Sbjct: 763 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPS 822 Query: 294 RLP 302 P Sbjct: 823 PPP 825 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/63 (46%), Positives = 32/63 (50%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P+ PP PP SP PP PPP PP P P PPPP P+ P PPPPS Sbjct: 854 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 913 Query: 294 RLP 302 P Sbjct: 914 PPP 916 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/63 (46%), Positives = 32/63 (50%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P+ PP PP SP PP PPP PP P P PPPP P+ P PPPPS Sbjct: 1032 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1091 Query: 294 RLP 302 P Sbjct: 1092 PPP 1094 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/63 (46%), Positives = 32/63 (50%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P+ PP PP SP PP PPP PP P P PPPP P+ P PPPPS Sbjct: 1123 SPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPS 1182 Query: 294 RLP 302 P Sbjct: 1183 PPP 1185 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/64 (51%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P PN + PP SP PP PPP PP PPP LPPPP PS P PPPPS Sbjct: 1692 PPPNAPSPSSMPPSQSPPPPLPPPPLPPPPN--PPPPLPPPPSP---PSPPPPSPPPPSP 1746 Query: 297 LPSP 308 PSP Sbjct: 1747 PPSP 1750 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/56 (57%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPSRLPSP 308 PP PP SP PP PPP PP PPP PPPP PL PS P PPPP LP P Sbjct: 796 PPSPPPSPPPPTPPPPAPPPPN--PPPPSPPPPLPLPPPPSPPPPLPPPP--LPPP 847 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/62 (51%), Positives = 32/62 (51%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPP---STLRLPPP*LP----PPPPLEE*PSTSPLYPPPPSRLP 302 PP PP SP PP PPP PP PPP LP PPPPL P P PPPPS P Sbjct: 1156 PPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPP 1215 Query: 303 SP 308 P Sbjct: 1216 LP 1217 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/57 (52%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP--PPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP SPPP PP + PPP PP PPP P T P PPPP+ P P Sbjct: 1227 PPPPSPPPSPPPSPPPSPPPS---PPPSPPPPTPPPPAPPPPTPPPSPPPPTPPPPP 1280 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/63 (52%), Positives = 34/63 (53%), Gaps = 8/63 (12%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPY-----PPSTLRLPPP*LPPP--PPLEE*PSTSPLYP-PPPSRL 299 PPPP P PP SPPP PPS LPPP PPP PPL P +P P PPP Sbjct: 1637 PPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNA 1696 Query: 300 PSP 308 PSP Sbjct: 1697 PSP 1699 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/70 (50%), Positives = 38/70 (54%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PP-----ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLY 278 +P P + PPPP LSP PP SPPP P S PP P PPP PS+SP Sbjct: 1785 SPPPPSASPSPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPP----PSSSP-S 1839 Query: 279 PPPPSRLPSP 308 PPPPS PSP Sbjct: 1840 PPPPSSSPSP 1849 Score = 57.4 bits (137), Expect = 5e-07 Identities = 33/66 (50%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPA---SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP 284 +P P + PPPP LSP PP SP P PPS PPP PPP P PS P PP Sbjct: 331 SPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPP--PSPPPPLPP 388 Query: 285 PPSRLP 302 PPS P Sbjct: 389 PPSPPP 394 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/54 (55%), Positives = 31/54 (57%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP+ PP SPPP PP L PPP PP PP PS P PP PS LP P Sbjct: 1618 PPPPVP--PPPSPPPLPPPPLP-PPPSPPPSPPPSPPPSPPPSPPPSPSPLPPP 1668 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/66 (45%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP-PP 290 +P P+ + P PPP SP P SPPP PP + PP P PPPL P+ P PP PP Sbjct: 2092 SPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPP 2151 Query: 291 SRLPSP 308 P P Sbjct: 2152 PPTPPP 2157 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/63 (55%), Positives = 35/63 (55%), Gaps = 8/63 (12%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPY-PPSTLRLPPP*LPPP--PPLEE*PSTSPLYPPP-----PSRL 299 PP PP SP PP PPP PPS LPPP PPP PPL P SP PPP PS L Sbjct: 2126 PPTPPPSP-PPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPL 2184 Query: 300 PSP 308 P P Sbjct: 2185 PPP 2187 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/63 (50%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPP--------STLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRL 299 PPP P P PP SPPP PP L PPP PP PP PS SPL PPP Sbjct: 2133 PPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPP 2192 Query: 300 PSP 308 PSP Sbjct: 2193 PSP 2195 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPST--LRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP SPPP PP + PPP PPPP P SP PPPS PSP Sbjct: 720 PPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSP 776 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/55 (54%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PPP PP + PPP PP PPP P+ P PPPP+ PSP Sbjct: 840 PPPPLPP-PPLPPPPSPPPS---PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSP 890 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/55 (54%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PPP PP + PPP PP PPP P+ P PPPP+ PSP Sbjct: 1018 PPPPLPP-PPLPPPPSPPPS---PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSP 1068 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/55 (54%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PPP PP + PPP PP PPP P+ P PPPP+ PSP Sbjct: 1109 PPPPLPP-PPLPPPPSPPPS---PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSP 1159 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PPA PPP PP + PP PPPP P+ P PPPP LP P Sbjct: 1138 PSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP--LPPP 1190 Score = 57.0 bits (136), Expect = 6e-07 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPST--LRLPPP*LPPPP-PLEE*PSTSPLYPPP 287 P P+ PPPP SP PP+ PPP PP + PPP LPPPP P P SP PP Sbjct: 1532 PSPSPPPPSPPPPSPSP-PPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPP 1590 Query: 288 PSRLPSP 308 PS PSP Sbjct: 1591 PSPPPSP 1597 Score = 57.0 bits (136), Expect = 6e-07 Identities = 36/70 (51%), Positives = 39/70 (55%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PP---ASPPPYPPSTLRLPPP*L--PPPPPLEE*PSTSPLY 278 +P P + PPPP SP PP ASP P PPS PPP P PPP PSTSP Sbjct: 1758 SPPPPSLSPSPPPPSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPP----PSTSPSP 1813 Query: 279 PPPPSRLPSP 308 PPPP+ PSP Sbjct: 1814 PPPPAS-PSP 1822 Score = 56.6 bits (135), Expect = 8e-07 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPST--LRLPPP*LPPPP-PLEE*PSTSPLYPPP 287 P P+ PPPP SP PP+ PPP PP + PPP LPPPP P P SP PP Sbjct: 676 PSPSPPPPSPPPPSPSP-PPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPP 734 Query: 288 PSRLPSP 308 PS PSP Sbjct: 735 PSPPPSP 741 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P P PP PPS PPP PP PPP P+ P PPPP+ PSP Sbjct: 1217 PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSP 1271 Score = 56.6 bits (135), Expect = 8e-07 Identities = 36/70 (51%), Positives = 39/70 (55%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLS---P*PPASPPPYPPSTLRLPPP--*LPPPPPLEE*PSTSPLY 278 +P P + PPPP S P PPASP P PPS PPP P PPP PS+SP Sbjct: 1794 SPPPPSLSPSPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPP----PSSSP-S 1848 Query: 279 PPPPSRLPSP 308 PPPPS PSP Sbjct: 1849 PPPPSLSPSP 1858 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PPP PP + PPP PP PPP P+ P PPPP+ P+P Sbjct: 710 PPPPLPP-PPLPPPPLPPPS---PPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAP 760 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/53 (52%), Positives = 29/53 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP +P PPA PP PPS PP PPPP PS P PPPPS P Sbjct: 1143 PTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPP 1195 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/65 (49%), Positives = 36/65 (55%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P + P PPP SP PP+ PPP PP LPPP +PP P P SP PPPS Sbjct: 1540 SPPPPSPSPPPSPPPPSP-PPSPPPPSPPPP--LPPPPVPPSPLPPPSPPPSPPPSPPPS 1596 Query: 294 RLPSP 308 PSP Sbjct: 1597 PPPSP 1601 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/72 (50%), Positives = 39/72 (54%), Gaps = 7/72 (9%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PP---ASPPPYPPSTLRLPPP--*LPPPPPLEE*PSTSPLY 278 +P P + PPPPP SP PP ASP P PPS+ PPP P PPP PS SP Sbjct: 1803 SPPPPSTSPSPPPPPASPSPPPPSASPSPPPPSSSPSPPPPSSSPSPPP----PSLSPSP 1858 Query: 279 P--PPPSRLPSP 308 P PPPS P P Sbjct: 1859 PPSPPPSSPPPP 1870 Score = 55.8 bits (133), Expect = 1e-06 Identities = 35/72 (48%), Positives = 37/72 (51%), Gaps = 7/72 (9%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PP---ASPPPYPPSTLRLPPP*L----PPPPPLEE*PSTSP 272 +P P + PPPP LSP PP SP P PPS PPP PPPP L P SP Sbjct: 243 SPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPSP 302 Query: 273 LYPPPPSRLPSP 308 PPPS PSP Sbjct: 303 ---PPPSTSPSP 311 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/63 (46%), Positives = 33/63 (52%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P + P PPP +P PP+ PPP PP L PP PP PP P SP PPPP Sbjct: 356 SPSPPPPSLSPSPPPATP-PPSPPPPSPPPPLPPPPSPPPPLPPPPIPPPPSPPPPPPPP 414 Query: 294 RLP 302 P Sbjct: 415 LAP 417 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/57 (50%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP--PPPSRLPSP 308 PPP P P PP SPPP PP + PP PPPP P+ P P PPPS PSP Sbjct: 716 PPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSP 772 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/66 (45%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPY--PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 P P+ PP PP SP PP PPP PP+ PPP PP PP PS P PPP Sbjct: 725 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPT 784 Query: 291 SRLPSP 308 P+P Sbjct: 785 PPPPAP 790 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/62 (50%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP-------PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPP P P PP SPPP PP P PP PPPPL PS P PPPP LP Sbjct: 1146 PPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPP--LP 1203 Query: 303 SP 308 P Sbjct: 1204 PP 1205 Score = 55.8 bits (133), Expect = 1e-06 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Frame = +3 Query: 144 PPPPPLSP*PPA-SPPPYPPSTLRLPPP--*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ SP P PPST PPP P PPP PS SP PPPPS PSP Sbjct: 1752 PSPPPPSPPPPSLSPSPPPPSTSPSPPPPSASPSPPP----PSASP-SPPPPSLSPSP 1804 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/71 (43%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPP------PPPLEE*PSTSPL 275 +P P P PPPL P P PP PPS LPPP PP PPP P + PL Sbjct: 2103 SPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPPL 2162 Query: 276 YPPPPSRLPSP 308 PPP P+P Sbjct: 2163 PSPPPPSPPTP 2173 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPSRLPSP 308 P PPP P PP PP PPS LPPP +PPPP P P SPL P PP P P Sbjct: 2163 PSPPP--PSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPP 2216 Score = 55.5 bits (132), Expect = 2e-06 Identities = 36/70 (51%), Positives = 38/70 (54%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PP---ASPPPYPPSTLRLPPP--*LPPPPPLEE*PSTSPLY 278 +P P + PPPP LSP PP SP P PPS PPP P PPP PS SP Sbjct: 225 SPPPPSLSPSPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPP----PSLSP-S 279 Query: 279 PPPPSRLPSP 308 PPPPS PSP Sbjct: 280 PPPPSLSPSP 289 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP SPPP PP + P P P PPP PS P PPP P+P Sbjct: 850 PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 904 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/57 (50%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP--PPSRLPSP 308 PPP P P PP SPPP PP PP PP PP P PL PP PP LP P Sbjct: 877 PPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPP 933 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP SPPP PP + P P P PPP PS P PPP P+P Sbjct: 1028 PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1082 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP SPPP PP + P P P PPP PS P PPP P+P Sbjct: 1119 PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAP 1173 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/53 (52%), Positives = 31/53 (58%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPS 305 PPPP+ P P SPPP+PP LPP PPPPP P P PPPS+ PS Sbjct: 2185 PPPPIPP--PPSPPPHPPPQSPLPPSPPPPPPP----PPLPPPPSPPPSQPPS 2231 Score = 55.1 bits (131), Expect = 2e-06 Identities = 35/70 (50%), Positives = 38/70 (54%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PP---ASPPPYPPSTLRLPPP--*LPPPPPLEE*PSTSPLY 278 +P P + PPPP +SP PP SP P PPS PPP P PPP PS SP Sbjct: 234 SPPPPSLSPSPPPPSISPSPPPPSLSPSPPPPSVSPSPPPPSLSPSPPP----PSLSP-S 288 Query: 279 PPPPSRLPSP 308 PPPPS PSP Sbjct: 289 PPPPSLSPSP 298 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/54 (51%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP P+ PPP PP+ LPPP P PPP P + P +PPP S LP Sbjct: 2153 PTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLP 2206 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPP-PPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PP PPS PPP PPP PP P +P PPPS PSP Sbjct: 715 PPPPLPP-PPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSP 768 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/53 (52%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP PPP PP LPPP PPP P P + P PPPP+ P Sbjct: 939 PVPPPPSP-PPLPPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 988 Score = 54.3 bits (129), Expect = 4e-06 Identities = 34/70 (48%), Positives = 36/70 (51%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPA---SPPPYPPSTLRLPPP--*LPPPPPLEE*PSTSPLY 278 +P P + PPPP LSP PP SP P PPS PPP P PPP PS P Sbjct: 322 SPPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPSPPPPSLSPSPPPATPPPSPPPPS 381 Query: 279 PPPPSRLPSP 308 PPPP LP P Sbjct: 382 PPPP--LPPP 389 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/53 (52%), Positives = 29/53 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPPL P PP PPP PP PPP PP PP PS P PPPP+ P Sbjct: 944 PSPPPLPP-PPLPPPPLPPPP--SPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 993 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPY--PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPPL P PP PPP PPS PPP PP PP PS P PPPP+ P Sbjct: 1211 PSPPPLPP-PPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 1264 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/52 (51%), Positives = 29/52 (55%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPP P PP PPP PP LPPP PPP P P + P PPPP+ P Sbjct: 830 PPPPSPP-PPLPPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 878 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/52 (51%), Positives = 29/52 (55%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPP P PP PPP PP LPPP PPP P P + P PPPP+ P Sbjct: 1008 PPPPSPP-PPLPPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 1056 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/52 (51%), Positives = 29/52 (55%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPP P PP PPP PP LPPP PPP P P + P PPPP+ P Sbjct: 1099 PPPPSPP-PPLPPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 1147 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/62 (45%), Positives = 32/62 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PP PP SP PP+ PPP PP PP P PPP P+ P PPPP+ Sbjct: 1120 PPPSPPPSPPPSPPPSP-PPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNP 1178 Query: 297 LP 302 P Sbjct: 1179 PP 1180 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP PPP PP LPPP PPP P P + P PPP P+P Sbjct: 1206 PVPPPPSP-PPLPPPPLPPPP--LPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTP 1257 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP SPPP PP + PPP PPP P P P PPPS PSP Sbjct: 846 PPPLPPPPSPPPSPPPSPPPS---PPPSPPPPTPP---PPAPPPPAPPPSPPPSP 894 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP SPPP PP + PPP PPP P P P PPPS PSP Sbjct: 1024 PPPLPPPPSPPPSPPPSPPPS---PPPSPPPPTPP---PPAPPPPAPPPSPPPSP 1072 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP SPPP PP + PPP PPP P P P PPPS PSP Sbjct: 1115 PPPLPPPPSPPPSPPPSPPPS---PPPSPPPPTPP---PPAPPPPAPPPSPPPSP 1163 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/54 (50%), Positives = 27/54 (50%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P PP SPPP PP PPP PPPP P SP P PP P P Sbjct: 764 PPPSPPPSPPPSPPPSPPPPT--PPPPAPPPPTPPPSPPPSPPPPTPPPPAPPP 815 [27][TOP] >UniRef100_Q5CLM1 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CLM1_CRYHO Length = 2646 Score = 65.5 bits (158), Expect = 2e-09 Identities = 33/73 (45%), Positives = 39/73 (53%) Frame = +3 Query: 90 ARERTFIGNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTS 269 A + G P P ++ PPPPP+ P P SPPP P + PP PPPPP+ E P S Sbjct: 2133 AEVSSIAGTPIPTPPSFSPPPPPIPPPPSFSPPPPP---IPPPPSSPPPPPPVPEYPPLS 2189 Query: 270 PLYPPPPSRLPSP 308 PPPPS P P Sbjct: 2190 SAIPPPPSFSPPP 2202 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/58 (46%), Positives = 33/58 (56%) Frame = +3 Query: 135 NYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 ++ PPPPP+ P PP P P PPS + P +P PP P P YPPP S +PSP Sbjct: 2197 SFSPPPPPIPPPPP--PIPSPPSPIPSSPSPIPSPPSSPPPPPPKPEYPPPSSPIPSP 2252 [28][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PPA PPP PP+ PPP PPPPP P P PPPP P P Sbjct: 630 PPPPPAPPPPPAPPPPPPPAP---PPPPAPPPPPAPAPPPAPPPPPPPPPAPPPP 681 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PPA PPP P+ PPP PPPPP P P PPPP+ P P Sbjct: 644 PPPPPAPPPPPAPPPPPAPA----PPPAPPPPPPPPPAPPPPPAPPPPPAPPPPP 694 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/54 (48%), Positives = 31/54 (57%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP +P PP +P P P+ PPP PPPPP P +P PPPP+ P P Sbjct: 601 PPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPP 654 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/58 (48%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = +3 Query: 144 PPPPPLSP*P---PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P P PA PPP PP PPP PPPP P P PPPP+ P P Sbjct: 609 PPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPPP 666 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/59 (50%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +3 Query: 144 PPP---PPLSP*PPA-SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP PP +P PPA +PPP PP PPP PPPPP P P PPPP+ P P Sbjct: 603 PPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPP-PPPPPAPPPPPAPPPPP 660 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/54 (50%), Positives = 28/54 (51%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP +P PP PPP PP PPP P PPP P P PPPP P P Sbjct: 636 PPPPPAPPPP--PPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPP 687 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP PPA PP P PPP PPPPP P P PPPP P P Sbjct: 601 PPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPA---PPPPPAPPPPPPPAPPP 652 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/51 (52%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 144 PPPPPLSP*PPA-SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 PPPPP P PPA +PPP PP PPP PP PP P P PPPP+ Sbjct: 650 PPPPPAPPPPPAPAPPPAPP-----PPPPPPPAPPPPPAPPPPPAPPPPPA 695 [29][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 65.1 bits (157), Expect = 2e-09 Identities = 33/55 (60%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP SPPP PP PPP PPPPP PS SP PPPS PSP Sbjct: 112 PPPPPPPPPPPPSPPPPPPPPP--PPPPNPPPPPPPPPPSPSPPPSPPPSPPPSP 164 Score = 63.5 bits (153), Expect = 7e-09 Identities = 33/64 (51%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPPP P PP PPP PP PPP PPPPP P SP PPPS Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP--PPPPPPSPSPPPSPPPSPPPSP 164 Query: 297 LPSP 308 PSP Sbjct: 165 PPSP 168 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP SPPP PP PP PPPPP P P PPPP PSP Sbjct: 98 PPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP PPP PP + PPP PPPPP P P PP PS PSP Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPP--PPPPPPPNPPPPPPPPPPSPSPPPSP 156 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/67 (53%), Positives = 37/67 (55%), Gaps = 5/67 (7%) Frame = +3 Query: 117 PKPN*RNYHPP-PPPLSP*PPASPPPYPPSTLRLPPP*LPPPP----PLEE*PSTSPLYP 281 P P + PP PPP P PPA PPP PP PPP LPPPP PL PS P P Sbjct: 229 PPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPS--PPPPLPPPPSPPPPLPPPPSPPPPSP 286 Query: 282 PPPSRLP 302 PPPS LP Sbjct: 287 PPPSPLP 293 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP+ P P Sbjct: 89 PPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/56 (57%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPA-SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ SPPP PP + PPP PPPPP PS P PPPP PSP Sbjct: 73 PPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPP---PSPPPPPPPPPPPPPSP 125 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP PS P PPPP P+P Sbjct: 87 PPPPPPPPVPPPPPPPPPPPPPPSPPP--PPPPPPPPPPSPPPPPPPPPPPPPNP 139 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/64 (46%), Positives = 33/64 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ + PPPPP P PP P P PS PPP +PPPPP P P PPPP Sbjct: 58 PTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPP 117 Query: 297 LPSP 308 P P Sbjct: 118 PPPP 121 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/66 (51%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP--PPP 290 P P+ PPPPP P PP PPP PPS PPP PP PP PS P P PPP Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPPSP--SPPPSPPPSPPPSPPPSPPPSPPPSPPP 178 Query: 291 SRLPSP 308 S PSP Sbjct: 179 SPPPSP 184 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/66 (50%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP--PPP 290 P PN PPPPP PP+ PP PPS PPP PP PP PS P P PPP Sbjct: 135 PPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPP 194 Query: 291 SRLPSP 308 S PSP Sbjct: 195 SPPPSP 200 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +3 Query: 117 PKPN*-RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 PKP+ N P PPP +P PP PPP P+ R PPP PPPP PS +P PPPPS Sbjct: 299 PKPSPPNNPFPRPPPPNP-PPPRPPPPSPNPPRPPPP--SPPPPRPPPPSPNPPRPPPPS 355 Query: 294 RLPSP 308 PSP Sbjct: 356 --PSP 358 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PPL P P PPP PP PPP PPPPP P P PPPPS P P Sbjct: 76 PPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPP-PPPPPPPPPPPSPPPPP 129 Score = 56.6 bits (135), Expect = 8e-07 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +3 Query: 117 PKPN*RNYHPP-PPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 P+P N PP PPP SP PP PPP PP PP PP PP PS SP PPPP Sbjct: 309 PRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPP---PSPSPPKPPPP- 364 Query: 294 RLPSP 308 PSP Sbjct: 365 --PSP 367 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/65 (49%), Positives = 36/65 (55%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P+ PP PP SP PP+ PP PPS PPP PP PP PS +P P PPS Sbjct: 163 SPPPSPPPSPPPSPPPSP-PPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPS 221 Query: 294 RLPSP 308 PSP Sbjct: 222 --PSP 224 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/72 (48%), Positives = 35/72 (48%), Gaps = 7/72 (9%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPP-----PYPPSTLRLPPP*LPPPPPLEE*PSTSPLY 278 NP P PPPPP SP PP SPP PPS PPP PP PP P P Sbjct: 138 NPPPP-----PPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSP 192 Query: 279 P--PPPSRLPSP 308 P PPPS PSP Sbjct: 193 PPSPPPSPPPSP 204 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPP 290 +P P+ PP PP SP PP PP PPS PPP PP PPP PS P P PP Sbjct: 167 SPPPSPPPSPPPSPPPSP-PPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPP 225 Query: 291 SRLPSP 308 S P P Sbjct: 226 SPRPPP 231 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/64 (48%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPP-PLSP*PPASPPPYPPSTLRLP-PP*LPPPPPLEE*PSTSPLYPPPP 290 P PN + PP P P SP PP PP+PP + P PP PPPP PS P PPPP Sbjct: 210 PSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPP 269 Query: 291 SRLP 302 S P Sbjct: 270 SPPP 273 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/67 (46%), Positives = 35/67 (52%), Gaps = 2/67 (2%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*P--PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPP 287 +P P+ PP PP SP P P SPPP PP + PPP PP PP PS P PP Sbjct: 151 SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS---PPPRPPPSPPPSPPPSPPPSPPPR 207 Query: 288 PSRLPSP 308 P P+P Sbjct: 208 PPPSPNP 214 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP PPP PP LPPP PPPP P SPL P P PSP Sbjct: 254 PRPPPPSPPPPLPPPPSPPPP--LPPPPSPPPP---SPPPPSPLPPSPRPPKPSP 303 [30][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/55 (58%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPPP PS P PPPPS P P Sbjct: 261 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP----PSPPPPSPPPPSPPPPP 311 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPPP P P PPPP P P Sbjct: 416 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/53 (56%), Positives = 31/53 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP+ PPP PP PPP PPPPP P P PPPPS P Sbjct: 256 PPPPPPSPPPPSPPPPSPPP----PPPPSPPPPPPPSPPPPPPPSPPPPSPPP 304 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/53 (58%), Positives = 32/53 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PPS PPP PPPPP PS P PPPPS P Sbjct: 318 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP----PSPPPPSPPPPSPPP 366 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 347 PPPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 400 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/53 (58%), Positives = 32/53 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PPS PPP PPPPP PS P PPPPS P Sbjct: 362 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP----PSPPPPSPPPPSPPP 410 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/62 (50%), Positives = 33/62 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP P PP SPPP PP + PPP PPPPP P P PPPPS Sbjct: 414 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 473 Query: 297 LP 302 P Sbjct: 474 PP 475 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 461 PPPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 514 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/53 (58%), Positives = 32/53 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PPS PPP PPPPP PS P PPPPS P Sbjct: 476 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP----PSPPPPSPPPPSPPP 524 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPP P SP PPPPS P P Sbjct: 243 PSPPPPSPPPPSPPPPPPPS----PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP--PPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP PPP PPP PP P SP PPPPS P P Sbjct: 290 PPPPPPSPPPPSPPPPSPPP----PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP PPP PP PP PPPPP PS P PPPPS P P Sbjct: 282 PPPPPPSPPPP--PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPP 334 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/54 (55%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPY-PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP+ PPP PP + PPP PPPPP P P PPPPS P Sbjct: 308 PPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 361 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/64 (48%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPPP P PP PP PP PPP PPPP PS P PPPPS Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 488 Query: 297 LPSP 308 P P Sbjct: 489 PPPP 492 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/68 (48%), Positives = 35/68 (51%), Gaps = 4/68 (5%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LP----PPPPLEE*PSTSPLYPP 284 P P+ PPPP P PP SPPP PP + PPP P PPPP PS P PP Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 533 Query: 285 PPSRLPSP 308 PPS P P Sbjct: 534 PPSPPPPP 541 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP PPP PPP P P SP PPPPS P P Sbjct: 238 PPPPPPSPPPPSPPPPSPPPP---PPPSPPPPSP----PPPSPPPPPPPSPPPPP 285 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP+ PPP PPS PPP PPPPP P P PPP PSP Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP+ PPP PP PP PP PP PS P PPPPS P Sbjct: 505 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 557 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPPP PS P PPPPS P P Sbjct: 210 PSPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPPP----PSPPPPSPPPPSPPPPP 259 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTL--RLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPPP PS P PPPPS P P Sbjct: 225 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP----PSPPPPSPPPPSPPPPP 277 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/64 (50%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP P PP SPPP PP + PPP PPPP PS P PPPPS Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP-PSPPPPSPPPPSPPPPSPPPPSP 374 Query: 297 LPSP 308 P P Sbjct: 375 PPPP 378 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPP P SP PPPPS P P Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP----PPPSPPPPPPPSPPPPP 456 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 411 PSPPPPSPPPPSPPPPSPPPP---PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 462 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPS-TLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPP P SP PPPPS P P Sbjct: 295 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP PPPPP P P PPPPS P Sbjct: 357 PSPPPPSPPPPSPPPPSPPP----PPPPSPPPPPPPSPPPPPPPSPPPPSPPP 405 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/58 (53%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP---PPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP P P PP PPP P PPPP PS P PPPPS P P Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 432 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPP P SP PPPPS P P Sbjct: 396 PSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP PPPPP P P PPPPS P Sbjct: 471 PSPPPPSPPPPSPPPPSPPP----PPPPSPPPPPPPSPPPPPPPSPPPPSPPP 519 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 401 PSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 454 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/67 (47%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPL---SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPP 287 P P+ PPPPP P PP SPPP PP + PPP PPPPP P SP P P Sbjct: 419 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478 Query: 288 PSRLPSP 308 P P P Sbjct: 479 PPPSPPP 485 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/52 (51%), Positives = 30/52 (57%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRL 299 P PPP SP PP+ PPP PP PP PPPPP PS P PPPP ++ Sbjct: 510 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPCQV 561 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP PP PP P SP PPPPS P Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPP--PPSPPPPSPPPPSPPPPPPPSPPP 265 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/62 (50%), Positives = 33/62 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP P PP SPPP PP + PPP PP PP P SP PPPPS Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPS---PPPPPPPSPPPPSPPPPSPPPPPPPSP 315 Query: 297 LP 302 P Sbjct: 316 PP 317 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP P P PPS PPP PPP P P SP PPPPS P P Sbjct: 339 PPPPPPSPPPPPPPSPPPPSP---PPPSPPPPSP----PPPSPPPPPPPSPPPPP 386 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP P P PPS PPP PPP P P SP PPPPS P P Sbjct: 453 PPPPPPSPPPPPPPSPPPPSP---PPPSPPPPSP----PPPSPPPPPPPSPPPPP 500 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PPPP PS P PPPPS P P Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP P P PPS PPP PPPPP P P PPPP P P Sbjct: 248 PSPPPPSPPPPPPPSPPPPSP---PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP+ PPP PP PPP PPPP P SP PPPPS P P Sbjct: 342 PPPSPPPPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP+ PPP PP PP PP PP P SP PPPPS P P Sbjct: 386 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP+ PPP PP PPP PPPP P SP PPPPS P P Sbjct: 456 PPPSPPPPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/53 (52%), Positives = 29/53 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PP PP PP P SP PPPPS P Sbjct: 195 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 247 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 303 PPPSPPPPPPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/55 (56%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP--PPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP P P PPS PPP PPP PP P SP PPPPS P Sbjct: 497 PPPPPPSPPPPPPPSPPPPS----PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 547 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLR---LPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP PPP PPPP P SP PPPP P P Sbjct: 391 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP-PPPPPSPPPP 447 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/64 (46%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP PP SPPP PP + PPP PPPPP P SP P PP Sbjct: 311 PPPSPPPPSPPPPSP---PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Query: 297 LPSP 308 P P Sbjct: 368 SPPP 371 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/64 (46%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP PP SPPP PP + PPP PPPPP P SP P PP Sbjct: 355 PPPSPPPPSPPPPSP---PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Query: 297 LPSP 308 P P Sbjct: 412 SPPP 415 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPP P PP PP PP PPP PPPP PS P PPPPS P Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 420 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/64 (46%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP PP SPPP PP + PPP PPPPP P SP P PP Sbjct: 469 PPPSPPPPSPPPPSP---PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Query: 297 LPSP 308 P P Sbjct: 526 SPPP 529 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/53 (49%), Positives = 27/53 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPP P P PP+ PPP PP PP PP PP P P PPPPS P Sbjct: 500 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 552 [31][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/59 (52%), Positives = 31/59 (52%) Frame = +3 Query: 132 RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 RN H PPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 40 RNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/54 (51%), Positives = 29/54 (53%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPS 305 PPPPP P PP PPP PP PPP PPPPP P P PPPP P+ Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPA 103 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/55 (50%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP--PPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P P + P PPS+ P Sbjct: 60 PPPPPPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPQWEPADPPSKWP 110 [32][TOP] >UniRef100_UPI0001862007 hypothetical protein BRAFLDRAFT_58365 n=1 Tax=Branchiostoma floridae RepID=UPI0001862007 Length = 178 Score = 64.7 bits (156), Expect = 3e-09 Identities = 33/57 (57%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKV-EGGYGGGEAGGYGESGGGGG 143 GG R GGGGY G G GGGGG YGGG GGYGGG GG G S GGGG Sbjct: 107 GGGYRGRGGGGYGGSYGGGGGYGGGGGGYGGGGGSYGGGGYGGGSYGGGGGSYGGGG 163 Score = 61.2 bits (147), Expect = 3e-08 Identities = 37/62 (59%), Positives = 38/62 (61%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGG--GGSYGGGRRKVEGGYGGGEAGGYGESG---GGG 146 GG R GGGGY G GY RGGG GGSYGGG GGYGGG GGYG G GGG Sbjct: 93 GGGYRGRGGGGYGGG-GGYRGRGGGGYGGSYGGG-----GGYGGG-GGGYGGGGGSYGGG 145 Query: 145 GW 140 G+ Sbjct: 146 GY 147 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/55 (54%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGG-RRKVEGGYGGGEAGGYGESGGGGGW 140 G R GGGG G Y RGGGG GGG R + GGYGG GG G GGGGG+ Sbjct: 85 GERRGGGGGGG----YRGRGGGGYGGGGGYRGRGGGGYGGSYGGGGGYGGGGGGY 135 [33][TOP] >UniRef100_Q7SXQ3 Zgc:66127 n=1 Tax=Danio rerio RepID=Q7SXQ3_DANRE Length = 388 Score = 64.7 bits (156), Expect = 3e-09 Identities = 35/61 (57%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEG--GY---GGGEAGGYGESGGGG 146 GG G R GGGGY G DGY+ GGG G YGGG G GY GGG GGYG GGG Sbjct: 225 GGGGGRGGGGGYGGG-DGYNGYGGGNGGYGGGGPNYGGNRGYGSGGGGGGGGYGNQGGGY 283 Query: 145 G 143 G Sbjct: 284 G 284 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/68 (48%), Positives = 33/68 (48%), Gaps = 13/68 (19%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGG--------SYGGGRRKVEGGYGGGEAG-----GY 167 G G GGGGY G G RGGGGG YGGG GGYGGG GY Sbjct: 210 GRGGGGGGGGYGGGYGGGGGRGGGGGYGGGDGYNGYGGG----NGGYGGGGPNYGGNRGY 265 Query: 166 GESGGGGG 143 G GGGGG Sbjct: 266 GSGGGGGG 273 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/46 (56%), Positives = 26/46 (56%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAG 173 GG G R GGG Y G GY GGGG YGGG GGYGGG G Sbjct: 343 GGGGGRSGGGPYGG---GYGGGSGGGGGYGGGSGGGGGGYGGGSGG 385 [34][TOP] >UniRef100_A1VW19 RNP-1 like RNA-binding protein n=1 Tax=Polaromonas naphthalenivorans CJ2 RepID=A1VW19_POLNA Length = 148 Score = 64.7 bits (156), Expect = 3e-09 Identities = 33/56 (58%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R GGGGY G R GGGG YGGG R GGYGGG+ G G GGGGG Sbjct: 95 GGGGDRSGGGGYGG-----GDRSGGGGGYGGG-RSGGGGYGGGDRSGGGGYGGGGG 144 [35][TOP] >UniRef100_O24184 Glycine-rich RNA-binding protein n=1 Tax=Oryza sativa RepID=O24184_ORYSA Length = 165 Score = 64.7 bits (156), Expect = 3e-09 Identities = 36/57 (63%), Positives = 40/57 (70%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G+R GGGGY G GY GGGGG G G+R+ EGGYGGG GGYG GGGGG+ Sbjct: 95 GGYGQRGGGGGYGGR--GY---GGGGGGGGYGQRR-EGGYGGG--GGYGGGGGGGGY 143 Score = 55.8 bits (133), Expect = 1e-06 Identities = 34/64 (53%), Positives = 34/64 (53%), Gaps = 7/64 (10%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG----GGGGSYGGGRRKVEGGYGGGEAGGYGESGGG-- 149 G GR GGGG G GY R GGGG YGGG GGYGGG GGYG GGG Sbjct: 105 GYGGRGYGGGGGGG---GYGQRREGGYGGGGGYGGGGG--GGGYGGGYGGGYGSRGGGNS 159 Query: 148 -GGW 140 G W Sbjct: 160 DGNW 163 [36][TOP] >UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR Length = 207 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/59 (62%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGG--GGSYGGGRRKVEGG-YGGGEAGGYGESGGGGG 143 GG G GGGGY G GY GGG GG YGGGRR GG YGGG GGYG GGGGG Sbjct: 90 GGRGGGRGGGGYGGG-GGYGGGGGGYGGGGYGGGRRGGGGGGYGGG--GGYGGGGGGGG 145 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/73 (47%), Positives = 35/73 (47%), Gaps = 17/73 (23%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGG------------- 170 GG G GGGGY G G RGGGGG YGGG GGYGGG GG Sbjct: 103 GGGGYGGGGGGYGGGGYGGGRRGGGGGGYGGG-----GGYGGGGGGGGGCYSCGESGHMA 157 Query: 169 ----YGESGGGGG 143 G SGGGGG Sbjct: 158 RDCPQGGSGGGGG 170 [37][TOP] >UniRef100_B9QIA3 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG RepID=B9QIA3_TOXGO Length = 481 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G GY GGG G+ GGG GGYG G GGYG GGGGG+ Sbjct: 68 GGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGYGAG-GGGYGAGGGGGGY 123 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG-GGEAGGYGESGGGGG 143 GG G GGGGY G GY + GGG G+ GGG GGYG GG GGYG GG G Sbjct: 75 GGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSG 131 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/52 (61%), Positives = 32/52 (61%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 R GGGGY G GY GGGGG YGGG GGYGGG GGYG GGG G Sbjct: 58 RGYGGGGYGGGGGGY---GGGGGGYGGG----GGGYGGG-GGGYGAGGGGYG 101 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/57 (52%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY--GGGEAGGYGESGGGG 146 GG G GGGGY GY + GGG G+ GGG GGY GGG +GGYG GGG Sbjct: 89 GGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGG-----GGYGAGGGNSGGYGSGYGGG 140 [38][TOP] >UniRef100_B9PV72 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9PV72_TOXGO Length = 488 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G GY GGG G+ GGG GGYG G GGYG GGGGG+ Sbjct: 75 GGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGYGAG-GGGYGAGGGGGGY 130 Score = 62.4 bits (150), Expect = 2e-08 Identities = 34/56 (60%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G GY GGGGG YGGG GGYGGG GGYG GGG G Sbjct: 61 GGGGYGGGGGGYGGGGGGY---GGGGGGYGGG----GGGYGGG-GGGYGAGGGGYG 108 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG-GGEAGGYGESGGGGG 143 GG G GGGGY G GY + GGG G+ GGG GGYG GG GGYG GG G Sbjct: 82 GGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSG 138 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/52 (61%), Positives = 32/52 (61%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 R GGGGY G GY GGGGG YGGG GGYGGG GGYG GGG G Sbjct: 58 RGYGGGGYGGGGGGY---GGGGGGYGGG----GGGYGGG-GGGYGGGGGGYG 101 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/57 (52%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY--GGGEAGGYGESGGGG 146 GG G GGGGY GY + GGG G+ GGG GGY GGG +GGYG GGG Sbjct: 96 GGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGG-----GGYGAGGGNSGGYGSGYGGG 147 [39][TOP] >UniRef100_B6KPI0 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KPI0_TOXGO Length = 538 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G GY GGG G+ GGG GGYG G GGYG GGGGG+ Sbjct: 125 GGGGYGGGGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGYGAG-GGGYGAGGGGGGY 180 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG-GGEAGGYGESGGGGG 143 GG G GGGGY G GY + GGG G+ GGG GGYG GG GGYG GG G Sbjct: 132 GGGGYGGGGGGYGGGGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSG 188 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/52 (61%), Positives = 32/52 (61%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 R GGGGY G GY GGGGG YGGG GGYGGG GGYG GGG G Sbjct: 115 RGYGGGGYGGGGGGY---GGGGGGYGGG----GGGYGGG-GGGYGAGGGGYG 158 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/57 (52%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY--GGGEAGGYGESGGGG 146 GG G GGGGY GY + GGG G+ GGG GGY GGG +GGYG GGG Sbjct: 146 GGGGYGAGGGGYGAGGGGYGAGGGGYGAGGGG-----GGYGAGGGNSGGYGSGYGGG 197 [40][TOP] >UniRef100_C9SP10 ATP-dependent RNA helicase DBP2 n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SP10_9PEZI Length = 577 Score = 64.7 bits (156), Expect = 3e-09 Identities = 39/83 (46%), Positives = 40/83 (48%), Gaps = 17/83 (20%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG------GSYGGGRRKVE-----------GGYGGG 182 GG G GGGGY G GY GGGG G YGGGR + GGYGGG Sbjct: 6 GGGGYGGGGGGYGGGGGGYGGGGGGGYGGGGRGGYGGGRNDRDRGDDRGGYGGGGGYGGG 65 Query: 181 EAGGYGESGGGGGW*FL*LGLGL 113 GG G GGGGG LG GL Sbjct: 66 YGGGGGYGGGGGGDRMSNLGAGL 88 [41][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/64 (48%), Positives = 31/64 (48%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P Y PPPPP PP PPP PP PPP PPPPP P P Y PPP Sbjct: 214 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPP 273 Query: 297 LPSP 308 P P Sbjct: 274 PPPP 277 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/57 (50%), Positives = 29/57 (50%) Frame = +3 Query: 138 YHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 Y PPPPP P PP S P PP PPP PPPPP P P Y PPP P P Sbjct: 114 YAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPP 170 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/71 (45%), Positives = 34/71 (47%), Gaps = 7/71 (9%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRL--PPP*LPPPPPLEE*PSTSPLY---- 278 P P Y PPPPP PP PPP PP+ PPP PPPPP P P Y Sbjct: 252 PPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPP 311 Query: 279 -PPPPSRLPSP 308 PPPP+ P P Sbjct: 312 PPPPPAYAPPP 322 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/57 (49%), Positives = 29/57 (50%) Frame = +3 Query: 138 YHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 Y PPPPP P PP + P PP PPP PPPPP P P Y PPP P P Sbjct: 137 YGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPP 193 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/57 (49%), Positives = 29/57 (50%) Frame = +3 Query: 138 YHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 Y PPPPP P PP + P PP PPP PPPPP P P Y PPP P P Sbjct: 160 YGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPP 216 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/57 (49%), Positives = 29/57 (50%) Frame = +3 Query: 138 YHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 Y PPPPP P PP + P PP PPP PPPPP P P Y PPP P P Sbjct: 183 YGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPP 239 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/60 (48%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Frame = +3 Query: 138 YHPPPPPLSP*PPASPPPY---PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 Y PPPPP + PP PP Y PP PPP PPPPP P P Y PPP P P Sbjct: 88 YAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPP 147 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/67 (46%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*L----PPPPPLEE*PSTSPLYPP 284 P P Y PPPPP PP PPP PP PPP PPPPP P+ SP PP Sbjct: 191 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPP 250 Query: 285 PPSRLPS 305 PP P+ Sbjct: 251 PPPPPPA 257 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PPA PP PP+ PPP PPPPP P P PPP + P P Sbjct: 209 PPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPP 263 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/67 (46%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLE---E*PSTSPLYPPP 287 P P Y PPPPP P PPA+ P PP PPP PPPPP P P PPP Sbjct: 237 PPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPP 296 Query: 288 PSRLPSP 308 P+ P P Sbjct: 297 PAYSPPP 303 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/59 (49%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*----LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PPA PP PP+ PPP PPPPP P+ P PPPP+ P P Sbjct: 287 PPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPP 345 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/72 (44%), Positives = 34/72 (47%), Gaps = 8/72 (11%) Frame = +3 Query: 117 PKPN*RNYHPPPPPL-----SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLY- 278 P P Y PPPPP P PPA PP PP+ PP PPPPP P P Y Sbjct: 292 PPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYA 351 Query: 279 --PPPPSRLPSP 308 PPPP+ P P Sbjct: 352 PPPPPPAYAPPP 363 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/67 (46%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLS---P*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPP 287 P P Y PPPPP + P PPA PP PP PP PPPPP P P PPP Sbjct: 90 PPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPP 149 Query: 288 PSRLPSP 308 P+ P P Sbjct: 150 PAYGPPP 156 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/67 (46%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLY---PPP 287 P P Y PPPPP PPA PPP PP P PPPPP P P Y PPP Sbjct: 311 PPPPPPAYAPPPPPAYG-PPAPPPPPPPPPAYAP----PPPPPAYAPPPPPPAYAPPPPP 365 Query: 288 PSRLPSP 308 P P+P Sbjct: 366 PKYSPAP 372 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/57 (49%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPL--SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PPA PP PP PP PPPPP P P PPPP+ P P Sbjct: 192 PPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPP 248 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 8/63 (12%) Frame = +3 Query: 144 PPPPPLSP*PPA------SPPPYPPSTLRLPPP*L--PPPPPLEE*PSTSPLYPPPPSRL 299 PPPPP P PPA PPP PP+ PPP PPPPP P + Y PPP Sbjct: 232 PPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPP 291 Query: 300 PSP 308 P P Sbjct: 292 PPP 294 [42][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/72 (51%), Positives = 40/72 (55%), Gaps = 8/72 (11%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYP-PSTLRLPPP----*LPPPPPLEE*PSTSPLY- 278 P P Y PPPPP SP PP+ PPP P P +R PPP PPPPPL P +P Y Sbjct: 326 PSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYY 385 Query: 279 --PPPPSRLPSP 308 PPPPS SP Sbjct: 386 SSPPPPSPPHSP 397 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/69 (49%), Positives = 36/69 (52%), Gaps = 4/69 (5%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPA-SPPPYPPSTLRLPPP---*LPPPPPLEE*PSTSPLYP 281 +P P Y PPPPP SP PP SPPP PP PPP PPPPP P P+Y Sbjct: 257 SPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYS 316 Query: 282 PPPSRLPSP 308 PPP P P Sbjct: 317 PPPPPSPPP 325 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/66 (51%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP---PLEE*PSTSPLYPP 284 +P P Y PPPPP SP PP PP Y P PPP PPPP P PS P PP Sbjct: 290 SPPPPPPVYSPPPPPPSP-PPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPP 348 Query: 285 PPSRLP 302 PPS LP Sbjct: 349 PPSPLP 354 Score = 58.5 bits (140), Expect = 2e-07 Identities = 35/70 (50%), Positives = 35/70 (50%), Gaps = 6/70 (8%) Frame = +3 Query: 117 PKPN*RNYHPPPPP---LSP*PPA---SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLY 278 P P Y PPPPP SP PP SPPP PPS PPP PPPP PS P Sbjct: 272 PSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPP----PSPPPPS 327 Query: 279 PPPPSRLPSP 308 PPPP P P Sbjct: 328 PPPPVYSPPP 337 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +3 Query: 138 YHPPPPPLSP*PPASPPPYPPSTLRLPPP*LP-PPPPLEE*PSTSPLYPPPPSRLPSP 308 Y PPPPP SP P PPP PP PPP P PPPP + P SP PPPP SP Sbjct: 446 YSPPPPP-SPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSP 502 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPY---PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPP 287 P P Y PPPPP SP PP+ PPP PP PPP PPP PL P P PPP Sbjct: 308 PPPPPPVYSPPPPP-SPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLP--PCVRPPPPPP 364 Query: 288 PSRLPSP 308 P+ P P Sbjct: 365 PNSPPPP 371 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/74 (41%), Positives = 36/74 (48%), Gaps = 6/74 (8%) Frame = +3 Query: 105 FIGNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*L------PPPPPLEE*PST 266 + +P P + PPPPP SP PP SPP PP PPP + PPPP P Sbjct: 384 YYSSPPPPSPPHSPPPPPHSP-PPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPP 442 Query: 267 SPLYPPPPSRLPSP 308 P+Y PPP P P Sbjct: 443 PPVYSPPPPPSPPP 456 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/85 (42%), Positives = 41/85 (48%), Gaps = 17/85 (20%) Frame = +3 Query: 105 FIGNPKPN*RNYHPPPPPL-SP*PPASPPPY------PPSTLRLPPP*LPPPPP---LEE 254 ++ P P Y PPPPP+ SP PP SPPP PP PPP P PPP + Sbjct: 427 YLSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKP 486 Query: 255 *PSTSP-------LYPPPPSRLPSP 308 PS SP PPPPS+ P P Sbjct: 487 PPSPSPPPPPVHYYSPPPPSQSPPP 511 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/60 (50%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Frame = +3 Query: 138 YHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLY---PPPPSRLPSP 308 Y PPPPP PP PPP PP + PP PPPPP+ P P+Y PPPPS P P Sbjct: 256 YSPPPPPPVYSPP-PPPPSPPPPVYSPP---PPPPPVYSPPPPPPVYSPPPPPPSPPPPP 311 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/72 (44%), Positives = 37/72 (51%), Gaps = 7/72 (9%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPL--SP*PPASPPPYPPSTLRLPPP*LP-PPPPLEE*PSTSPLY-- 278 +P P + PPPPP+ P PP+ PPP PP + PPP P PPPP PS P Sbjct: 299 SPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVR 358 Query: 279 --PPPPSRLPSP 308 PPPP P P Sbjct: 359 PPPPPPPNSPPP 370 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/62 (48%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPA---SPPPYPPSTLRLPPP*LPP----PPPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP SPPP P PPP PP PPP P + P PPPP P Sbjct: 361 PPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSP 420 Query: 303 SP 308 P Sbjct: 421 PP 422 [43][TOP] >UniRef100_B6AGG8 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AGG8_9CRYT Length = 497 Score = 64.7 bits (156), Expect = 3e-09 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 15/70 (21%) Frame = +3 Query: 144 PPPPPLS-------P*PPASPPPYPPSTLRLPPP*-----LPPPPPLEE*PST--SPL-Y 278 PPPPP S P PP+S PP PPS+L PPP +PPPPP+ PS+ SPL Sbjct: 363 PPPPPSSLPLPPPIPPPPSSLPPSPPSSLPPPPPIPPPPPIPPPPPIPPPPSSLPSPLPI 422 Query: 279 PPPPSRLPSP 308 PPPPS LPSP Sbjct: 423 PPPPSSLPSP 432 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 11/66 (16%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYP-PSTLRLPPP--------*LPPPPP--LEE*PSTSPLYPPPP 290 PPPPP+ P PP+ PPP P PS ++PPP +PPP P L+ S+SPL PPPP Sbjct: 309 PPPPPI-PPPPSIPPPPPKPSIQKIPPPPPPKPSIRKIPPPKPLLLKSLVSSSPLPPPPP 367 Query: 291 SRLPSP 308 S LP P Sbjct: 368 SSLPLP 373 Score = 58.2 bits (139), Expect = 3e-07 Identities = 38/85 (44%), Positives = 42/85 (49%), Gaps = 21/85 (24%) Frame = +3 Query: 117 PKPN*RNYHPPPP----------PLSP*PPAS---PPPYPPSTLRLPPP*---LPPPPPL 248 PKP+ R PP P PL P PP+S PPP PP LPP LPPPPP+ Sbjct: 338 PKPSIRKIPPPKPLLLKSLVSSSPLPPPPPSSLPLPPPIPPPPSSLPPSPPSSLPPPPPI 397 Query: 249 EE*PSTSPL-----YPPPPSRLPSP 308 P P+ PPPPS LPSP Sbjct: 398 ---PPPPPIPPPPPIPPPPSSLPSP 419 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/55 (52%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 144 PPPPPLSP*PP-ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPS 305 PPPPP+ P PP PPP PP LP P LP PPP PS P+ PP S L S Sbjct: 392 PPPPPIPPPPPIPPPPPIPPPPSSLPSP-LPIPPPPSSLPSPLPIPPPKSSLLRS 445 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/79 (41%), Positives = 37/79 (46%), Gaps = 15/79 (18%) Frame = +3 Query: 117 PKPN*RNYHPPPPP---LSP*PPASP------------PPYPPSTLRLPPP*LPPPPPLE 251 PKP+ + PPPPP + PP P PP PPS+L LPPP PPPP Sbjct: 325 PKPSIQKIPPPPPPKPSIRKIPPPKPLLLKSLVSSSPLPPPPPSSLPLPPP--IPPPPSS 382 Query: 252 E*PSTSPLYPPPPSRLPSP 308 PS PPPP P P Sbjct: 383 LPPSPPSSLPPPPPIPPPP 401 [44][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/64 (48%), Positives = 33/64 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPPP P PP SPPP PP + P P PPPPP P P PPPP Sbjct: 10 PPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPS 69 Query: 297 LPSP 308 P P Sbjct: 70 SPPP 73 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/64 (51%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPPP P PP SPPP PPS PPP L PPPP P P PPPP Sbjct: 106 PPPPLPSSPPPPPPSPPPPPLSPPPPPPSP--PPPPLLSPPPPPPSPPPPPPPSPPPPPP 163 Query: 297 LPSP 308 P P Sbjct: 164 SPPP 167 Score = 63.5 bits (153), Expect = 7e-09 Identities = 32/58 (55%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP---PPPSRLPSP 308 PPPPPLSP PP PP PP PPP PPPPP P P P PPPS LP P Sbjct: 121 PPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPP 178 Score = 63.5 bits (153), Expect = 7e-09 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Frame = +3 Query: 144 PPPPPLSP*P-PASPPPYPPSTLRLPPP*LPPPPPLEE*PS---TSPLYPPPPSRLPSP 308 PPPPP P P P SPPP PP + PPP PPPPPL P+ SP PPPP PSP Sbjct: 176 PPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSP 234 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/64 (51%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPL-YPPPPS 293 P P + PPPP P PP+SPPP PP PPP PPPPL P PL PPPP Sbjct: 49 PPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPP 108 Query: 294 RLPS 305 LPS Sbjct: 109 PLPS 112 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/64 (51%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPPP SP PP P P PP PPP LP PPP PS+ P PPPPS Sbjct: 64 PPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPP--PPPPSP 121 Query: 297 LPSP 308 P P Sbjct: 122 PPPP 125 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/60 (51%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPP-----P*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP L PP P PPPPPL P P PPPP P P Sbjct: 71 PPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPP 130 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/64 (50%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPPP P PP S PP PPS+ PPP PPPP P PPPP Sbjct: 41 PSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPP 100 Query: 297 LPSP 308 LPSP Sbjct: 101 LPSP 104 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/63 (55%), Positives = 35/63 (55%), Gaps = 4/63 (6%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPA--SPPPYPPSTLRLPPP*LPPPPPL--EE*PSTSPLYPP 284 P P PPPPP SP PP SPPP PPS PPP PPPPP P SPL PP Sbjct: 119 PSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPP 178 Query: 285 PPS 293 PPS Sbjct: 179 PPS 181 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/64 (53%), Positives = 36/64 (56%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPP P PP SPPP PPS PPP LPPP PL P SP +P PPS Sbjct: 136 PPPPLLSPPPPPPSPPPPPPPSPPPPPPS----PPPPLPPPSPLPP-PPPSPPHPLPPSP 190 Query: 297 LPSP 308 P P Sbjct: 191 PPPP 194 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/66 (50%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*P-PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 +P P + PPPPP P P P SPPP PP + PPP PPPPP P P PPPP Sbjct: 24 SPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPP 83 Query: 291 SRLPSP 308 PSP Sbjct: 84 PP-PSP 88 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/56 (53%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPP-PYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPPL PP PP P PP PPP PPPPPL P P PPPP P P Sbjct: 105 PPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPP 160 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PP P PP+SPPP PP + PPP PPPPP PS P PPPP PSP Sbjct: 4 PPSPPPPPPPPSSPPPPPPPSPPPPPP-SPPPPPPPSPPSPLPPSPPPPPP-PSP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 37/73 (50%), Positives = 39/73 (53%), Gaps = 8/73 (10%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPP--YPPSTLRLPPP----*LPPPPPLEE*PSTSPL 275 +P P + PPPPP P PP SPPP PPS L PPP LPP PP PS P Sbjct: 142 SPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPP 201 Query: 276 YP--PPPSRLPSP 308 P PPP LPSP Sbjct: 202 PPPSPPPPPLPSP 214 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +3 Query: 144 PPPPPLSP*PPA-SPPPYPPSTLRLPPP*L---PPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP SPPP PP PPP L PPPPP P PL PPPP P P Sbjct: 81 PPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPS--PPPPPLSPPPPPPSPPP 137 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP PP PP L PP PP PPL P P PPPP P P Sbjct: 191 PPPPPPSP-PPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPP 244 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/50 (60%), Positives = 30/50 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 PPPPPL P PPA PP PP PPP PPPPP P SP PPPPS Sbjct: 206 PPPPPL-PSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSP-PPPPPS 253 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP P P PP+ PP PPPPP P P PPPPS P P Sbjct: 199 PPPPPPSPPPP--PLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPPP 251 [45][TOP] >UniRef100_UPI0000DB7202 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB7202 Length = 344 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/56 (58%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GGGGYSG +GYS GGGGG Y GG GG GG GG G SGGGGG Sbjct: 279 GGGYSGGGGGGYSGGGNGYS--GGGGGGYSGGNGGYSGGNGGYSGGGGGYSGGGGG 332 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 6/61 (9%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGG------GGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 G G GGGGYSG +GYS GGG GG Y GG GGY GG GGY GGG Sbjct: 223 GSGGYSGGGGGYSGGGNGYSGGGGGGYSGGNGGGYSGGGN--GGGYSGGNGGGYSGGGGG 280 Query: 148 G 146 G Sbjct: 281 G 281 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -1 Query: 310 GGDGRREGGGG-YSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG+G GGGG YSG G S GG GG Y GG GGY GG GGY GGGG Sbjct: 237 GGNGYSGGGGGGYSGGNGGGYSGGGNGGGYSGGNG---GGYSGGGGGGYSGGGGGG 289 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 G G G GGYSG GYS GGG G GGG GGY GG GGY G GGG+ Sbjct: 217 GGGSFGGSGGYSGGGGGYS--GGGNGYSGGG----GGGYSGGNGGGYSGGGNGGGY 266 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/62 (53%), Positives = 34/62 (54%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREG-GGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGY-----GESGGG 149 GG G G GGGYSG +G GG GG Y GG GGY GG GGY G SGGG Sbjct: 245 GGGGYSGGNGGGYSGGGNGGGYSGGNGGGYSGGGG---GGYSGGGGGGYSGGGNGYSGGG 301 Query: 148 GG 143 GG Sbjct: 302 GG 303 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/57 (50%), Positives = 30/57 (52%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GGGYSG G S GGGGG GGG GG GG G G SGG GG+ Sbjct: 263 GGGYSGGNGGGYSGGGGGGYSGGGGGGYSGGGNGYSGGGGGGYSGGNGGYSGGNGGY 319 [46][TOP] >UniRef100_Q7QDL5 AGAP003388-PA n=1 Tax=Anopheles gambiae RepID=Q7QDL5_ANOGA Length = 430 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/57 (57%), Positives = 34/57 (59%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GR GGGGY G GGGGG YGGG GGYGGG GG G GGGGG+ Sbjct: 164 GGRGRG-GGGGYGG-----GGGGGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGGY 214 [47][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/55 (58%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPPL P PP PPP P PPP LPPPPPL P PL PP P LP P Sbjct: 77 PPPPPLPPPPPLPPPPPLPPPPPPPPP-LPPPPPLPPPPPPPPLPPPLPPPLPPP 130 [48][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/55 (58%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPP PS P PPPPS PSP Sbjct: 70 PSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPSP 123 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/64 (50%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ + P PPP SP PP+ PPP PP PP P PPP PS P PPPPS Sbjct: 83 PPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSI 142 Query: 297 LPSP 308 PSP Sbjct: 143 SPSP 146 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/62 (50%), Positives = 33/62 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PP PP SP PP+ PPP PP PP PP PP PS SP PPPPS Sbjct: 78 PPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSP 137 Query: 297 LP 302 P Sbjct: 138 PP 139 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP LPPP PP PPP PS P PPP PSP Sbjct: 20 PSPPPPSPPPPSPPPPSPPP---LPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSP 72 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/62 (51%), Positives = 34/62 (54%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPP-------PSRLP 302 PP PP SP PP+ PPP PP P P PPPPP + PS SP PPP PS P Sbjct: 120 PPSPPPSPSPPSPPPPSPPPPSISPSP-PPPPPPWWQAPSASPSPPPPPPPWWQAPSASP 178 Query: 303 SP 308 SP Sbjct: 179 SP 180 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PP--ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP +SP PP ASP P PPS PPP PPPP P P PPPP PSP Sbjct: 180 PPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPP---SPPPPPPPPPPPPPSPPSP 233 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/70 (50%), Positives = 38/70 (54%), Gaps = 6/70 (8%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPA---SPPPYPPSTLRLP---PP*LPPPPPLEE*PSTSPLY 278 P P P PPP SP PP+ SPPP PP + P P PPPPP + PS SP Sbjct: 121 PSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASP-S 179 Query: 279 PPPPSRLPSP 308 PPPPS PSP Sbjct: 180 PPPPSISPSP 189 Score = 57.0 bits (136), Expect = 6e-07 Identities = 34/64 (53%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PP PP SP PP SPPP PP L P P P PPP PS P PPPPS Sbjct: 33 PPPSPPPLPPPLPPPSP-PPPSPPPSPPPPLPPPSPSPPSPPP----PSPPPPSPPPPSP 87 Query: 297 LPSP 308 PSP Sbjct: 88 -PSP 90 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PP PP SP PP+ PPP PP PPP P PPP PS P PPPPS P Sbjct: 60 PPLPPPSPSPPSPPPPSPPPPSP-PPPSPPSPPPSPPPPSPPPPSPPPPSPPP 111 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 6/59 (10%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP------PPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP SPPP PP LPPP PP PPP PS SP PPPPS P Sbjct: 25 PSPPPPSP-PPPSPPPLPPP---LPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPP 79 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/62 (46%), Positives = 30/62 (48%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPP P P PP SP P P PPP PPP P PS P PPPPS Sbjct: 45 PPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSP 104 Query: 297 LP 302 P Sbjct: 105 PP 106 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/62 (51%), Positives = 33/62 (53%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPP-------PSRLP 302 P PPP SP PP SPPP PP + P P P PPP PS SP PPP PS P Sbjct: 107 PSPPPPSP-PPPSPPPSPPPSPSPPSPPPPSPPP----PSISPSPPPPPPPWWQAPSASP 161 Query: 303 SP 308 SP Sbjct: 162 SP 163 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*L-PPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P ASP P PPS PP P PPP PS P PPPPS P P Sbjct: 165 PPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPP 220 [49][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/56 (60%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP-PPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP SPPP PP R PPP PPP PP P SP PPPPS P P Sbjct: 331 PPPPPPSPPPPPSPPPPPPP--RPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 384 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP PP PPPPP PS P PPPP PSP Sbjct: 285 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPP-PSP 338 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPPP P P PPP PSP Sbjct: 248 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSP 302 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/64 (51%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P R P PPP SP PP+ PPP PP PP PPPPP PS P PPPPS Sbjct: 346 PPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP--PPPPPRPPPPSPPPPSPPPPSP 403 Query: 297 LPSP 308 P P Sbjct: 404 PPPP 407 Score = 62.8 bits (151), Expect = 1e-08 Identities = 32/56 (57%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP-PPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPP PP P SP PPPPS P P Sbjct: 360 PSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPP 415 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/64 (48%), Positives = 33/64 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP P PP SPPP PP + PPP PPPPP P SP P PP Sbjct: 246 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305 Query: 297 LPSP 308 P P Sbjct: 306 SPPP 309 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/64 (48%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPPP P PP PP PP PPP PPPP PS P PPPPS Sbjct: 253 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 312 Query: 297 LPSP 308 P P Sbjct: 313 PPPP 316 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP+ PPP PP PPP PPPPP P P PPPPS P Sbjct: 345 PPPPPPRPPPPSPPPPSPPPPS--PPPPSPPPPPPPSPPPPPPPRPPPPSPPP 395 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/59 (54%), Positives = 33/59 (55%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 P P R P PPP SP PP+ PPP PPS PPP PPPP PS P PPPPS Sbjct: 382 PPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP--RPPPPSPPPPSPPPPSPPPPS 438 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 243 PSPPPPSPPPPSPPPPSPPPP---PPPSPPPPPPPSPPPPPPPRPPPPPPPSPPP 294 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PP PP P SP PPPPS P P Sbjct: 290 PSPPPPSPPPPSPPPPSPPPPSPPPPP--PPRPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPPP P SP P PP P P Sbjct: 318 PRPPPPSPPPPSPPPPPPPSP---PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP 369 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PP PP P SP PPPPS P P Sbjct: 218 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 272 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPP P SP PPPPS P P Sbjct: 228 PSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 280 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 233 PSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPP 286 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*P---PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPP 287 P P + PPPPP P P P SPPP PP + PP PPPPP PS P PPP Sbjct: 305 PSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPP 364 Query: 288 PSRLP 302 PS P Sbjct: 365 PSPPP 369 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/56 (53%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP-PPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP PPP PP PPP P PPPP PS P PPPPS P P Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPP 376 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPPP P SP P PP P P Sbjct: 386 PRPPPPSPPPPSPPPPSPPP----PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP 436 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP--PPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PP PPP PS P PPPPS P P Sbjct: 208 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 264 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/54 (55%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPS-TLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP P P PPS PPP PPPPP P P PPPPS P Sbjct: 373 PPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPP 426 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP P P PPS PPP PPPPP P SP PPPP R P P Sbjct: 305 PSPPPPSPPPPPPPRPPPPSP---PPPSPPPPPPPSPPPPPSP-PPPPPPRPPPP 355 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/57 (50%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPP--STLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP PP S PPP PPPPP P + P PPP P P Sbjct: 381 PPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 437 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/62 (48%), Positives = 32/62 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP PP SPPP PP + PPP PPPPP P P PPPPS Sbjct: 241 PPPSPPPPSPPPPSP---PPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSP 297 Query: 297 LP 302 P Sbjct: 298 PP 299 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 188 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 242 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 193 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 247 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 198 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 252 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP+ PPP PP PP PP PP P P PPPPS P P Sbjct: 280 PPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPP 334 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P P PP PPP PP PPP PPPP P P PPP PSP Sbjct: 308 PPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSP 362 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/56 (50%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PP PPP P P PPPP P P Sbjct: 223 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 278 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP PPP PP + P P P PPP P + P PPPP R P P Sbjct: 271 PPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPPPPRPPPP 323 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPP P PP PPP PP PP PP PP P P PPPPS P Sbjct: 276 PPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPP 327 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP PPP P PPP PPP P P + P PPPP R P P Sbjct: 339 PPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP--PPPPPRPPPP 391 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/60 (50%), Positives = 32/60 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP P PP SPPP PP R PPP PPP P P SP P PP+R Sbjct: 389 PPPSPPPPSPPPPSPPPPPPPSPPPPPPP--RPPPPSPPPPSP----PPPSPPPPSPPAR 442 [50][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP LP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/64 (48%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P+P PPPPP P PP PPP PP PPP PPPPP P P PPPP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Query: 297 LPSP 308 P P Sbjct: 85 PPPP 88 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/53 (52%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P PL PPP + +P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIP 107 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/52 (51%), Positives = 28/52 (53%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRL 299 PPPPP P PP PPP PP PPP PPPPP P P PPPP + Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNI 105 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 24 PPRPPPPPPPPPPPPPPPP-----PPP--PPPPPPPPPPPPPPPPPPPPPPPPPP 71 [51][TOP] >UniRef100_Q6RY61 Glycine-rich RNA-binding protein RGP-1c (Fragment) n=1 Tax=Nicotiana sylvestris RepID=Q6RY61_NICSY Length = 136 Score = 63.9 bits (154), Expect = 5e-09 Identities = 38/68 (55%), Positives = 39/68 (57%), Gaps = 13/68 (19%) Frame = -1 Query: 307 GDGRREGGGGYSGDV-DGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG----------- 164 G GRREGGGGY G +G GGGG YGGGRR EGGYGGG GGYG Sbjct: 64 GGGRREGGGGYGGGRREGGGGGYGGGGGYGGGRR--EGGYGGG-GGGYGGGDRYNDGGSR 120 Query: 163 -ESGGGGG 143 GGGGG Sbjct: 121 YSRGGGGG 128 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/64 (53%), Positives = 35/64 (54%), Gaps = 8/64 (12%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGG-YGGG-------EAGGYGESG 155 GG G R GGGGY G R GGG YGGGRR+ GG YGGG GGYG G Sbjct: 52 GGGGGRGGGGGYGG------GRREGGGGYGGGRREGGGGGYGGGGGYGGGRREGGYGGGG 105 Query: 154 GGGG 143 GG G Sbjct: 106 GGYG 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/56 (55%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -1 Query: 304 DGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG-EAGGYGESGGGGGW 140 + + GGGG G RGGGGG YGGGRR+ GGYGGG GG G GGGGG+ Sbjct: 45 EAQSRGGGGGGG-------RGGGGG-YGGGRREGGGGYGGGRREGGGGGYGGGGGY 92 [52][TOP] >UniRef100_Q43472 Low temperature-responsive RNA-binding protein n=1 Tax=Hordeum vulgare RepID=Q43472_HORVU Length = 161 Score = 63.9 bits (154), Expect = 5e-09 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGD--VDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G G GGGGG YGGGR GGYG + GG G GGGGG+ Sbjct: 89 GGGGFGGGGGGYGGQRREGGGGGYGGGGGGYGGGRSGGGGGYGSRDGGGGGYGGGGGGY 147 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/61 (52%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Frame = -1 Query: 310 GGDGRREGGGGY----SGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY SG GY SR GGGG YGGG GGYGG G GGG Sbjct: 108 GGGGYGGGGGGYGGGRSGGGGGYGSRDGGGGGYGGG----GGGYGGSRGG-----SGGGN 158 Query: 142 W 140 W Sbjct: 159 W 159 [53][TOP] >UniRef100_A9PIZ6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PIZ6_9ROSI Length = 171 Score = 63.9 bits (154), Expect = 5e-09 Identities = 34/66 (51%), Positives = 35/66 (53%), Gaps = 9/66 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGG------- 152 GG GRREGGGGYS GY GGGG YG G GGYGGG GYG+ G Sbjct: 107 GGGGRREGGGGYSRGGGGY---GGGGSGYGSGGGGGGGGYGGGRDRGYGDGGSRYSSRGE 163 Query: 151 --GGGW 140 GG W Sbjct: 164 SEGGSW 169 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGGY+ + G GGG GGG + GGYGGG GYG GGGGG Sbjct: 87 GSGGGGGGGGYNRNSGGGGYGGGGRREGGGGYSRGGGGYGGG-GSGYGSGGGGGG 140 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/61 (49%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY--------GGGEAGGYGESGGGGG 143 R GGGG G GY+ GGGG GGGRR+ GGY GGG G G GGGGG Sbjct: 86 RGSGGGGGGG---GYNRNSGGGGYGGGGRREGGGGYSRGGGGYGGGGSGYGSGGGGGGGG 142 Query: 142 W 140 + Sbjct: 143 Y 143 [54][TOP] >UniRef100_C9J285 Putative uncharacterized protein ENSP00000392404 (Fragment) n=1 Tax=Homo sapiens RepID=C9J285_HUMAN Length = 446 Score = 63.9 bits (154), Expect = 5e-09 Identities = 35/56 (62%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGG G G+SS GGGGGS GGG GG GGG GG G SGGGGG Sbjct: 307 GGGGRGGGGGGGGGGGGGHSSGGGGGGSDGGGHSS--GGGGGGSDGG-GHSGGGGG 359 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/56 (58%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG D G+SS GGGGGS GGG GG GGG GG SGGGGG Sbjct: 321 GGGGHSSGGGGGGSDGGGHSSGGGGGGSDGGGHSG--GGGGGGSDGGGHSSGGGGG 374 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/55 (58%), Positives = 33/55 (60%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG D G+SS GGGGGS GGG GG GGG GG SGGGGG Sbjct: 378 GGGHSSGGGGGGRDGGGHSSGGGGGGSDGGGHS--SGGGGGGRDGGGHSSGGGGG 430 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG D G+S GGGGGS GGG GG GGG GG SGGGGG Sbjct: 336 GGGHSSGGGGGGSDGGGHSGGGGGGGSDGGGHSS--GGGGGGRDGGGHSSGGGGG 388 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R GGGG G G S GGGGG GG GG GG + GG+ GGGGG Sbjct: 306 GGGGGRGGGGGGGGGGGGGHSSGGGGGGSDGGGHSSGGGGGGSDGGGHSGGGGGGG 361 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG D G+SS GGGGG GGG GG GGG GG SGGGGG Sbjct: 392 GGGHSSGGGGGGSDGGGHSSGGGGGGRDGGGHSS--GGGGGGRDGGGHSSGGGGG 444 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG D G+SS GGGGG GGG GG GGG GG SGGGGG Sbjct: 350 GGGHSGGGGGGGSDGGGHSSGGGGGGRDGGGHSS--GGGGGGRDGGGHSSGGGGG 402 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG D G+SS GGGGG GGG GG GGG GG SGGGGG Sbjct: 364 GGGHSSGGGGGGRDGGGHSSGGGGGGRDGGGHSS--GGGGGGSDGGGHSSGGGGG 416 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/56 (57%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG GD DG GGGGG GGG GG G G GG G GGGGG Sbjct: 29 GGDG---GGGGGDGDGDGGVGDGGGGGGGGGGGGGGGGGRGSGGDGGGGGGGGGGG 81 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/56 (58%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R GGGGYS G SS GGG S GGG GG GGG GG G GGGGG Sbjct: 274 GGIGGRVGGGGYSSGSSG-SSDGGGDSSGGGG-----GGGGGGRGGGGGGGGGGGG 323 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG +GG G DG GGGGG GGG + GG GGG GG G GGGGG Sbjct: 36 GGDGDGDGGVG-----DGGGGGGGGGGGGGGGGGRGSGGDGGGGGGGGGGGGGGGG 86 Score = 57.0 bits (136), Expect = 6e-07 Identities = 33/60 (55%), Positives = 33/60 (55%), Gaps = 4/60 (6%) Frame = -1 Query: 310 GGDGRREGGGGYS----GDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGG GD G S GGGGG GGG R G GGG GG G GGGGG Sbjct: 135 GGGGRGAGGGGGGRGGGGDGGGGGSSGGGGGDGGGGGRGGGDGGGGGRGGG-GRGGGGGG 193 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG-GGEAGGYGESGGGGG 143 GG G R GGGG G G GGGGG GGG GG G GG GG G+ GGGGG Sbjct: 189 GGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGGEGGGGGDGDGGGGGGDGDGGGGGG 245 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G RGGGG GGG R GG GG GG G GGGGG Sbjct: 161 GGGGGDGGGGGRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGGGG 216 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G R GGGG G G RGGGG GGG GG GGG G G+ GGGG Sbjct: 127 GGGGGRGGGGGGRGAGGGGGGRGGGGDGGGGGSSGGGGGDGGGGGRGGGDGGGGG 181 Score = 55.5 bits (132), Expect = 2e-06 Identities = 34/65 (52%), Positives = 36/65 (55%), Gaps = 9/65 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDG----YSSRGGGGGSYGGGRRKVEGG-----YGGGEAGGYGES 158 GGDG GGGG GD DG GGGGG GGG + GG GGG+ GG G S Sbjct: 104 GGDG---GGGGGDGDGDGGVGDGDGGGGGGGRGGGGGGRGAGGGGGGRGGGGDGGGGGSS 160 Query: 157 GGGGG 143 GGGGG Sbjct: 161 GGGGG 165 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/56 (53%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGG G G RG GGG GGGR G GGG +GG G GGGGG Sbjct: 118 GGVGDGDGGGGGGGRGGGGGGRGAGGG--GGGRGGGGDGGGGGSSGGGGGDGGGGG 171 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGG G G GGG G GGG GG GGG GG G+ GGGGG Sbjct: 183 GGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGGGGDGGGGEGGG--GGDGDGGGGGG 236 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/56 (53%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GG G G G GGGGG GGGR G GGG +GG G+ GGGGG Sbjct: 61 GGGGRGSGGDGGGG---GGGGGGGGGGGGGGGRGSGRDGGGGGGSGG-GDGGGGGG 112 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/56 (50%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GG G GD G GGGGG GGG + G GGG G G GGGGG Sbjct: 56 GGGGGGGGGRGSGGDGGGGGGGGGGGGGGGGGGGRGSGRDGGGGGGSGGGDGGGGG 111 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG SG G GG GG GGG + GG GGG GG G GGGGG Sbjct: 151 GGDG---GGGGSSGGGGGDGGGGGRGGGDGGGGGRGGGGRGGG-GGGRGGGGGGGG 202 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGG GGG R GG GGG GG G G GGG Sbjct: 154 GGGGGSSGGGGGDGGGGGRGGGDGGGGGRGGGGR---GGGGGGRGGGGGGGGRGGG 206 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/58 (51%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVE--GGYGGGEAGGYGESGGGGG 143 GGDG GGGG GD G GGG G GGG + GG GGG+ GG G+ GGG G Sbjct: 206 GGDG---GGGGGGGDGGGGEGGGGGDGDGGGGGGDGDGGGGGGGGDGGGGGDGGGGDG 260 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGG G S GGG G GGG +GG G G GG G GGGGG Sbjct: 11 GGGGRGGGGGGGGG-----GSSGGGDGGGGGGDGDGDGGVGDGGGGGGGGGGGGGG 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG GR GGGG G G GGGGG GGG GG GGG GG GE GGGG Sbjct: 178 GGGGR--GGGGRGGGGGGRGGGGGGGGRGGGGD---GGGGGGGGDGGGGEGGGGG 227 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/60 (50%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEA----GGYGESGGGGG 143 GG G GGGG G GGGGG GGGR GG GGG GG G+ GGGGG Sbjct: 155 GGGGSSGGGGGDGGGGGRGGGDGGGGGRGGGGRGGGGGGRGGGGGGGGRGGGGDGGGGGG 214 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/68 (44%), Positives = 31/68 (45%), Gaps = 13/68 (19%) Frame = -1 Query: 307 GDGRREGGGGYSGDV-------------DGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGY 167 G G GGGG G V DG GGGG GGG R GG GGG GG+ Sbjct: 266 GGGGDNGGGGIGGRVGGGGYSSGSSGSSDGGGDSSGGGGGGGGGGRGGGGGGGGGGGGGH 325 Query: 166 GESGGGGG 143 GGGGG Sbjct: 326 SSGGGGGG 333 [55][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 63.9 bits (154), Expect = 5e-09 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP SPPP PP + PPP PPPPP P P PPPP P P Sbjct: 139 PPPPPPSPPPPPSPPPPPPPS--PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 63.5 bits (153), Expect = 7e-09 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 PPPPP SP PP SPPP PP + PPP PPPPP P P PPPP Sbjct: 153 PPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/66 (53%), Positives = 35/66 (53%) Frame = +3 Query: 111 GNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 G P P PPPPP SP PP PPP PP PPP PPPPP P SP PPPP Sbjct: 120 GCPPPPPEPECPPPPPPSPPPP--PPPSPP-----PPPSPPPPPPPSPPPPPSPPPPPPP 172 Query: 291 SRLPSP 308 S P P Sbjct: 173 SPPPPP 178 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/49 (57%), Positives = 29/49 (59%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 PPPPP P PP+ PPP PPS PPP PPPPP P P PPPP Sbjct: 154 PPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PP PPS PPP PPPPP P P PPPP P P Sbjct: 146 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/64 (48%), Positives = 31/64 (48%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P PPPPP P PP PP PPS PPP PPPP P SP PPPP Sbjct: 123 PPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPP 182 Query: 297 LPSP 308 P P Sbjct: 183 PPPP 186 [56][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 63.9 bits (154), Expect = 5e-09 Identities = 31/55 (56%), Positives = 34/55 (61%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+SPPP PS PPP PPPP P+ +P PPPPS PSP Sbjct: 826 PPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTP--PPPPSPPPSP 878 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 6/61 (9%) Frame = +3 Query: 144 PPPPPLSP*PPA-SPPPYPPSTLRLPPP*LP-----PPPPLEE*PSTSPLYPPPPSRLPS 305 PPPPP SP PP+ SPPP PP PPP P PPPP PS P PPPPS P Sbjct: 832 PPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPP 891 Query: 306 P 308 P Sbjct: 892 P 892 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP+ PPP PPPPP P SP PP P PSP Sbjct: 805 PPPPPPPPSPP--PPPNPPTPPSPPPPPSPPPPPSSP-PPPSPSPPPSPPPAPSP 856 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/64 (48%), Positives = 31/64 (48%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P PN PPPP P PP SPPP PP PPP PPP P S PL PPP Sbjct: 858 PPPNPPPAPTPPPP--PSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLS 915 Query: 297 LPSP 308 P P Sbjct: 916 SPPP 919 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/57 (52%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPP--PYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP +PP P PP PPP PPPP PS SP PPP+ P P Sbjct: 807 PPPPPPSPPPPPNPPTPPSPP-----PPPSPPPPPSSPPPPSPSPPPSPPPAPSPPP 858 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/56 (50%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPA-SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP PP PPP P PPP P +P PPPP+ P+P Sbjct: 814 PPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPS---PPPAPSPPPPPNPPPAP 866 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P SP PP SPPP PP PPP PP PP P P PPPPS P P Sbjct: 792 PPPLPPSPPPPPSPPPPPPPPSPPPPP-NPPTPPS---PPPPPSPPPPPSSPPPP 842 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/56 (50%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPP-P*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PP P PP+ PPP PP + PP P PP PP P P PPPPS P P Sbjct: 793 PPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPP 848 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/66 (50%), Positives = 34/66 (51%), Gaps = 11/66 (16%) Frame = +3 Query: 144 PP--PPPLSP*PPASPPPYP---------PSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 PP PPP SP PP SPPP P P+ PPP PP PP P SP PPPP Sbjct: 835 PPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSP--PPPP 892 Query: 291 SRLPSP 308 S PSP Sbjct: 893 SPPPSP 898 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/63 (47%), Positives = 33/63 (52%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P+ PPPP +P PPA PP PPS PPP PPPP PS P PPPS Sbjct: 845 SPPPSPPPAPSPPPPPNP-PPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPS 903 Query: 294 RLP 302 P Sbjct: 904 SNP 906 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/73 (43%), Positives = 33/73 (45%), Gaps = 19/73 (26%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYP------------PSTLRLPPP*LPPPPPLEE*PSTSPLYP--- 281 PPPP SP PP SPPP P P L PPP PPPP P + PL P Sbjct: 882 PPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPSPP 941 Query: 282 ----PPPSRLPSP 308 PPP PSP Sbjct: 942 LPPNPPPPPSPSP 954 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/55 (56%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPP-PPLEE*PSTSPLYPPPPSRLPSP 308 PPPPL P PP PPP PP PPP PPP PP P T P PPPPS P P Sbjct: 791 PPPPLPPSPP--PPPSPP-----PPP--PPPSPPPPPNPPTPPSPPPPPSPPPPP 836 [57][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP SPPP PP PPP PPPPP P P PPPP P P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/64 (48%), Positives = 33/64 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + P PPP P PP SPPP PP PPP PPPPP P + P PPPP Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Query: 297 LPSP 308 P P Sbjct: 287 PPPP 290 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/54 (53%), Positives = 29/54 (53%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP SPPP PP PPP PPPPP P P PPPP P P Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP PPP PPPPP P P PPPP P P Sbjct: 242 PPPPPPSP-PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/58 (50%), Positives = 30/58 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 P P+ PPPPP P PP PPP PP PPP PPPPP P P PPPP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/53 (52%), Positives = 28/53 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P P PPPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPL-SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 P P + PPPPP P PP PPP PPS PPP PPPPP P P PPPPS Sbjct: 219 PSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPP--PPPPPPPPPPPPPPPPPPPPS 276 Query: 294 RLPSP 308 P P Sbjct: 277 PPPPP 281 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/64 (46%), Positives = 31/64 (48%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P PN PP PL P PP PPP PP + PPP PP PP P P PPPP Sbjct: 213 PLPN-----APPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Query: 297 LPSP 308 P P Sbjct: 268 PPPP 271 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/64 (46%), Positives = 31/64 (48%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + P PPP P PP PPP PP PPP PPPPP P P PPPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPP---PPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Query: 297 LPSP 308 P P Sbjct: 299 PPPP 302 [58][TOP] >UniRef100_UPI00016C4BFC hypothetical protein GobsU_21505 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C4BFC Length = 121 Score = 63.5 bits (153), Expect = 7e-09 Identities = 33/56 (58%), Positives = 34/56 (60%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 G G R GGGG G G S GGGGG GGGR GG GGG+ GG G GGGGGW Sbjct: 60 GGGGRGGGGGRGGGAGGGGSHGGGGG--GGGRG---GGGGGGDGGGVGGRGGGGGW 110 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGG-SYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G + RGGGGG GGG R GG GGG GG GGGGG Sbjct: 30 GGGGELGGGGGGGGGGGAWGGRGGGGGGGEGGGGRGGGGGRGGGAGGGGSHGGGGGG 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/56 (50%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G++ G GGGGG++GG GG GGG GG G GGG G Sbjct: 20 GGWGTGGGGGGGGGELGGGGGGGGGGGAWGGRGGGGGGGEGGGGRGGGGGRGGGAG 75 [59][TOP] >UniRef100_A8JGT1 RNA helicase n=1 Tax=Chlamydomonas reinhardtii RepID=A8JGT1_CHLRE Length = 737 Score = 63.5 bits (153), Expect = 7e-09 Identities = 34/62 (54%), Positives = 36/62 (58%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGG-----SYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGGY G GY RGGGGG YGGG R GGYG G G +G GGGG Sbjct: 657 GGGGY--GGGGYGGG--GYGGRGGGGGYGGRGGYGGGGRGGSGGYGRGGGGSFGRGGGGG 712 Query: 145 GW 140 G+ Sbjct: 713 GF 714 [60][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/55 (54%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP PP PPP PPPPP P + P PPPPS P P Sbjct: 217 PPPPPPPPPPPSPPPPPPP-----PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP PP PPP PPPPP PS P PPPP P P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP----PSPPPPPPPPPPPSPPP 255 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP + PPP PPP P P P PPPP PSP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/64 (53%), Positives = 36/64 (56%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPPP SP PP PPP PPS PPP P PPP PS P PPPPS Sbjct: 225 PPPSPPPPPPPPPPPSP-PPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPP-PPPPPSP 282 Query: 297 LPSP 308 P+P Sbjct: 283 PPAP 286 Score = 60.8 bits (146), Expect = 4e-08 Identities = 36/65 (55%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPS 293 P P+ PPPPP SP PP PPP PPS PPP PP PPP PS SP PPPPS Sbjct: 213 PPPSPPPPPPPPPPPSP-PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSP-PPPPPS 270 Query: 294 RLPSP 308 P P Sbjct: 271 PSPPP 275 [61][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 63.5 bits (153), Expect = 7e-09 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPPLSP PP PP PP+ L PPP LPPP P P P +PPPPS P P Sbjct: 2044 PSPPPLSPPPP---PPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPP 2095 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/55 (60%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP SPPP PPS PP LPPPPP S P PPPPS PSP Sbjct: 2114 PSPPPPSPPPPPSPPPPPPSP---PPAPLPPPPP-----SPPPSPPPPPSPPPSP 2160 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/74 (47%), Positives = 38/74 (51%), Gaps = 9/74 (12%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPP-----PYPPSTLRLPPP*LPPPPPLEE*PSTS--- 269 +P P + PPP P P PPA PP P+PP PPP PPPPP P S Sbjct: 2077 SPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPPPSPPP 2136 Query: 270 -PLYPPPPSRLPSP 308 PL PPPPS PSP Sbjct: 2137 APLPPPPPSPPPSP 2150 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/69 (44%), Positives = 34/69 (49%), Gaps = 5/69 (7%) Frame = +3 Query: 117 PKPN*RNYHPPPPPL-----SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP 281 P P PPPPPL SP PP PPP+PP PP PPPPP + +P Sbjct: 2055 PPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPP-----PPSPPPPPPPAPPPGAAQAPWP 2109 Query: 282 PPPSRLPSP 308 PPPS P P Sbjct: 2110 PPPSPSPPP 2118 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/66 (45%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP--PP 290 P P + PP PP P PP PP PP+ L PPP PP PP P SP PP PP Sbjct: 2109 PPPPSPSPPPPSPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPPPHPP 2168 Query: 291 SRLPSP 308 P+P Sbjct: 2169 PEPPAP 2174 [62][TOP] >UniRef100_B7ZQP4 Putative uncharacterized protein n=1 Tax=Xenopus laevis RepID=B7ZQP4_XENLA Length = 348 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/61 (54%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG-----GGEAGGYGESGGGG 146 GG GR GGGY G DGY+ GG GG+YGGG GYG G + GGYG GGGG Sbjct: 209 GGGGR---GGGYGGGGDGYNGFGGDGGNYGGGPGYGGRGYGGSPGYGNQGGGYGGGGGGG 265 Query: 145 G 143 G Sbjct: 266 G 266 [63][TOP] >UniRef100_A9P8S6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9P8S6_POPTR Length = 170 Score = 63.2 bits (152), Expect = 9e-09 Identities = 34/66 (51%), Positives = 35/66 (53%), Gaps = 9/66 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGG------- 152 GG GRREGGGGYS GY G G GS GGG GGYGGG GYG+ G Sbjct: 108 GGGGRREGGGGYSRGGGGYGGGGSGYGSGGGG-----GGYGGGRDRGYGDGGSRYSSRGE 162 Query: 151 --GGGW 140 GG W Sbjct: 163 SEGGSW 168 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = -1 Query: 304 DGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY---GGGEAGG---YGESGGGGG 143 + + G GG G GY+ GGGG GGGRR+ GGY GGG GG YG GGGGG Sbjct: 82 EAQSRGSGGGGGGGGGYNRNSGGGGYGGGGRREGGGGYSRGGGGYGGGGSGYGSGGGGGG 141 Query: 142 W 140 + Sbjct: 142 Y 142 [64][TOP] >UniRef100_B4Q273 GE17654 n=1 Tax=Drosophila yakuba RepID=B4Q273_DROYA Length = 185 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRR--KVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGG G G+ GGGGG +GGG +GGYGGG GG+G GG GGW Sbjct: 38 GGQGGYGGGGGGGGGQGGWQKNGGGGGGHGGGGHGGGGQGGYGGGSQGGHG-GGGQGGW 95 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGG--GGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GG GG+ G G + GGGG GGG +GGYGGG GG+G GG GG Sbjct: 74 GGQGGYGGGSQGGHGGGGQGGWQKNGGGGHGGGG----QGGYGGGNQGGHGGQGGYGG 127 [65][TOP] >UniRef100_B4NET8 GK25701 n=1 Tax=Drosophila willistoni RepID=B4NET8_DROWI Length = 211 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/66 (53%), Positives = 38/66 (57%), Gaps = 10/66 (15%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEA----------GGYGE 161 GG G GGGYSG G+SS GGGGG YGGG GGYGGG + GG+G Sbjct: 80 GGGGGWSSGGGYSGGSSGWSS-GGGGGGYGGGGGYGGGGYGGGGSSIKIIKVISDGGHGS 138 Query: 160 SGGGGG 143 SGG GG Sbjct: 139 SGGYGG 144 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/64 (46%), Positives = 31/64 (48%), Gaps = 7/64 (10%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYS-------SRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGG 152 GG G GGGGY G S GGGG YGGG GG GGG + G G SGG Sbjct: 37 GGGGGGYGGGGYGGGASTVKVVKVISDSGAGGGGGYGGGG--YSGGGGGGWSSGGGYSGG 94 Query: 151 GGGW 140 GW Sbjct: 95 SSGW 98 [66][TOP] >UniRef100_B4JYE9 GH14280 n=1 Tax=Drosophila grimshawi RepID=B4JYE9_DROGR Length = 214 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/56 (58%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGYSG GYS G GG Y GG GGYGGG GG G GGGGG Sbjct: 29 GGGGGGYGGGGYSGG--GYSGGGYSGGGYSGGGYSGGGGYGGGGYGGGGGYGGGGG 82 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGGY G GYS G GG Y GG GGYGGG GGYG GG GG Sbjct: 92 GHGGGGYGGGGYGGG--GYSGGGYSGGGYSGGGYSGGGGYGGG--GGYGGGGGYGG 143 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/67 (46%), Positives = 33/67 (49%), Gaps = 10/67 (14%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSS----------RGGGGGSYGGGRRKVEGGYGGGEAGGYGE 161 GG G GGGGY G G+ GGGGG YGGG GGYGGG GG G Sbjct: 130 GGGGGYGGGGGYGGGHGGHVQVYKVYTTTVHTGGGGGGYGGGGYG-GGGYGGGGYGGGGH 188 Query: 160 SGGGGGW 140 G GG+ Sbjct: 189 GGYSGGY 195 [67][TOP] >UniRef100_P51992 Heterogeneous nuclear ribonucleoprotein A3 homolog 2 n=1 Tax=Xenopus laevis RepID=RO32_XENLA Length = 385 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/61 (54%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG-----GGEAGGYGESGGGG 146 GG GR GGGY G DGY+ GG GG+YGGG GYG G + GGYG GGGG Sbjct: 247 GGGGR---GGGYGGGGDGYNGFGGDGGNYGGGPGYGGRGYGGSPGYGNQGGGYGGGGGGG 303 Query: 145 G 143 G Sbjct: 304 G 304 [68][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/77 (46%), Positives = 43/77 (55%), Gaps = 4/77 (5%) Frame = +3 Query: 90 ARERTFIGNPKPN*RNYHPPPPP--LSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PS 263 +R + G P P HPPPPP L+P PP++PPP PP PP PPPPP P+ Sbjct: 680 SRSSSSHGVPPP-----HPPPPPPSLAPKPPSAPPPPPPPPPAPKPPGAPPPPPPPP-PT 733 Query: 264 TSPL--YPPPPSRLPSP 308 T PL +PPPP P P Sbjct: 734 TKPLGAHPPPPPPPPPP 750 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/71 (47%), Positives = 38/71 (53%), Gaps = 7/71 (9%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPP---STLRL----PPP*LPPPPPLEE*PSTSPL 275 PKP PPPPP +P PP +PPP PP +T L PPP PPPPP + P P Sbjct: 702 PKPPSAPPPPPPPPPAPKPPGAPPPPPPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPP 761 Query: 276 YPPPPSRLPSP 308 P PPS P P Sbjct: 762 PPKPPSAPPPP 772 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/69 (43%), Positives = 31/69 (44%), Gaps = 5/69 (7%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*P-----PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP 281 P P R PPPPP P P P PPP P S PP PPPP S P P Sbjct: 600 PTPASRGPPPPPPPPPPLPGPSPPPPPPPPPPTSISSKGPPPPPPPPDFSSSSSNKPTLP 659 Query: 282 PPPSRLPSP 308 PPP P+P Sbjct: 660 PPPPPPPAP 668 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = +3 Query: 141 HPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 HPPPPP P PPA PP P PP PPPPP P +P PPPP +LP Sbjct: 740 HPPPPPPPPPPPAPKPPGAPPPPPKPPSAPPPPPPK---PPGAP--PPPPPKLP 788 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/60 (48%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +3 Query: 117 PKPN*RNYHP--PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 P PN N +P PP P S PP PPP PP PPP PPPPP P PPPP Sbjct: 587 PLPNVSNGNPLMPPTPASRGPPPPPPPPPPLPGPSPPPPPPPPPPTSISSKGPPPPPPPP 646 [69][TOP] >UniRef100_UPI0001982977 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982977 Length = 1622 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/55 (54%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPPLSP PP PPP+P LPPP PPPP P P PPPP+ P P Sbjct: 1224 PPPPPLSPSPPPPPPPFPSQLPPLPPPPAGPPPPTGPPP---PAGPPPPTVHPPP 1275 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/56 (48%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*P--STSPLYPPPPSRLPSP 308 PPPP+ P PP PPP P L PPP PPPP P P+ PPPP+ P P Sbjct: 1296 PPPPMGPPPPMGPPPRGPPPLMGPPPPTGPPPPTGPPPPRGPPPIGPPPPAGPPLP 1351 Score = 56.2 bits (134), Expect = 1e-06 Identities = 39/108 (36%), Positives = 49/108 (45%), Gaps = 12/108 (11%) Frame = +3 Query: 21 VTSNLKHNQNLIENTHNQVEA*QARERTFIGNPKPN*RNYHPP------------PPPLS 164 V+ +LK + L N ++++ Q +R I N N PP PPP Sbjct: 1158 VSGHLKDERPLFRNGSFEMDSHQDSDR--ISELASNNSNELPPLPEGSPPLPIDSPPPPP 1215 Query: 165 P*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PP+ PPP PP PPP PPPP PS P PPPP+ P P Sbjct: 1216 PLPPSPPPPPPPPLSPSPPP---PPPPF---PSQLPPLPPPPAGPPPP 1257 [70][TOP] >UniRef100_C1MSQ5 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MSQ5_9CHLO Length = 1516 Score = 63.2 bits (152), Expect = 9e-09 Identities = 32/55 (58%), Positives = 34/55 (61%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ P P PP+ PPP PPPPPL PS P PPPPS PSP Sbjct: 1047 PPPPPPPPPPPSPPSPPPPNGSPQPPPPPPPPPPL---PSPPP-SPPPPSPSPSP 1097 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/54 (53%), Positives = 29/54 (53%), Gaps = 5/54 (9%) Frame = +3 Query: 144 PPPPPLSP*PP-----ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 PPPPP P PP PPP PP PPP LP PPP PS SP PPPP Sbjct: 1053 PPPPPSPPSPPPPNGSPQPPPPPP-----PPPPLPSPPPSPPPPSPSPSPPPPP 1101 [71][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/55 (54%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P P PPP PP + PPP PPPPP P SP+ PPPPS +P P Sbjct: 1173 PPPPPSPPPPRPPPPPSPPPPVHEPPP-SPPPPPNPSPPPPSPM-PPPPSPMPPP 1225 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/70 (45%), Positives = 34/70 (48%), Gaps = 6/70 (8%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*------LPPPPPLEE*PSTSPLY 278 P P+ PPPPP P P PPP PP PPP PPPPP PS P Sbjct: 1106 PPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSP 1165 Query: 279 PPPPSRLPSP 308 PPPPS +P P Sbjct: 1166 PPPPSPMPPP 1175 Score = 60.1 bits (144), Expect = 8e-08 Identities = 33/60 (55%), Positives = 35/60 (58%), Gaps = 5/60 (8%) Frame = +3 Query: 144 PPPPPLSP*PP-ASPPPYPPSTLRLPPP*LP----PPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP PPP PP + PPP P PPPP + P SP PPPPS PSP Sbjct: 1103 PPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPPTPDAPPPSP-PPPPPSPPPSP 1161 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/69 (47%), Positives = 38/69 (55%), Gaps = 5/69 (7%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP----*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYP 281 P P+ PPPPP P PP SPPP PP+ PP +PPPP P+ PS P P Sbjct: 1175 PPPSPPPPRPPPPPSPPPPVHEPPPSPPP-PPNPSPPPPSPMPPPPSPMPPPPSPPPPSP 1233 Query: 282 PPPSRLPSP 308 PPPS +P P Sbjct: 1234 PPPSPMPPP 1242 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/65 (47%), Positives = 34/65 (52%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 NP P + PPPP P PP+ PPP PP +PPP P PPP P SP PPP Sbjct: 1206 NPSPPPPSPMPPPPSPMPPPPSPPPPSPPPPSPMPPP--PSPPP----PIPSPPPPPPTP 1259 Query: 294 RLPSP 308 R P P Sbjct: 1260 RSPPP 1264 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/55 (49%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PP P PP+ PPP PPS PPP PPP P P++ PPPS P P Sbjct: 1082 PPSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPP 1136 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/66 (48%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLS--P*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 P P+ PPPPP S P PP SPPP PPS + PPP PPP P P++ PPP Sbjct: 1141 PTPDAPPPSPPPPPPSPPPSPPPSPPP-PPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPP 1199 Query: 291 SRLPSP 308 S P P Sbjct: 1200 SPPPPP 1205 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/54 (53%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*P-PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P P P +PPP PP PPP PP PP P SP+ PPPPS P Sbjct: 1132 PPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPP----PPPSPMPPPPPSPPP 1181 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/70 (47%), Positives = 37/70 (52%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPS--TLRLPPP*LPPPPPLEE*PSTSP---LY 278 +P P + P PPP P PP+ PP PPS R PPP PPPP E PS P Sbjct: 1149 SPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPS 1208 Query: 279 PPPPSRLPSP 308 PPPPS +P P Sbjct: 1209 PPPPSPMPPP 1218 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP PP SP P PPS + PP PPPP PS P P PP +PSP Sbjct: 1201 PPPPPNPSPPPPSPMPPPPSPMPPPP---SPPPPSPPPPSPMPPPPSPPPPIPSP 1252 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/54 (51%), Positives = 29/54 (53%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP+ P P PP PPP PPPPP PS P PPPP P P Sbjct: 1080 PPPPSPPSPPSPPSPPPP-----PPPSPPPPPP----PSPPPPRPPPPPSPPPP 1124 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/64 (45%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ + PP P P PP+ PPP PPS PPP PPPPP P P PPP Sbjct: 1081 PPPSPPSPPSPPSPPPPPPPSPPPPPPPS----PPPPRPPPPPSPPPPVHEPPPSPPPPP 1136 Query: 297 LPSP 308 P P Sbjct: 1137 SPPP 1140 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/53 (50%), Positives = 29/53 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPP+ E P + P P PP P Sbjct: 1094 PPPPPP-PSPPPPPPPSPPPPRPPPPP--SPPPPVHEPPPSPPPPPSPPPPTP 1143 [72][TOP] >UniRef100_B9RS81 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RS81_RICCO Length = 516 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/64 (54%), Positives = 36/64 (56%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPPP SP PP SPP PP PPP PPPPP PS SPL PPPP Sbjct: 406 PNPSPPLSSPPPPPFSPPPPPSPPLSPPP----PPP--PPPPP----PSPSPLPPPPPPP 455 Query: 297 LPSP 308 SP Sbjct: 456 FYSP 459 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/62 (51%), Positives = 33/62 (53%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*-----LPPPPPLEE*PSTSP--LYPPPPSRLP 302 PP PPLSP PP PPP PPS LPPP PPPPP + P SP PPP P Sbjct: 425 PPSPPLSPPPPPPPPPPPPSPSPLPPPPPPPFYSPPPPPTYQSPPPSPPPCVNPPPPPSP 484 Query: 303 SP 308 P Sbjct: 485 PP 486 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/68 (50%), Positives = 37/68 (54%), Gaps = 11/68 (16%) Frame = +3 Query: 138 YHPPPPPL---SP*PPASPPPYPPSTLRLPPP-----*LPPPPPLEE*PSTSP---LYPP 284 + PPPPP SP PP PPP PPS LPPP PPPPP + P SP + PP Sbjct: 420 FSPPPPPSPPLSPPPPPPPPPPPPSPSPLPPPPPPPFYSPPPPPTYQSPPPSPPPCVNPP 479 Query: 285 PPSRLPSP 308 PP PSP Sbjct: 480 PP---PSP 484 [73][TOP] >UniRef100_UPI000155E705 PREDICTED: similar to Keratin 77 isoform 1 n=1 Tax=Equus caballus RepID=UPI000155E705 Length = 593 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/58 (56%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSS-RGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G G GGY G G SS RGG GGSYGG GGYGGG GGYG GGG + Sbjct: 506 GGGGGGRGSGGYCGGGGGSSSSRGGYGGSYGG---SYGGGYGGGSRGGYGSGSGGGSY 560 [74][TOP] >UniRef100_B9EN93 Cold-inducible RNA-binding protein n=1 Tax=Salmo salar RepID=B9EN93_SALSA Length = 161 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/61 (55%), Positives = 35/61 (57%), Gaps = 4/61 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG----GGEAGGYGESGGGGG 143 GG G R GGGGY G G GGGG YGGG R GG G GGE GYG GGGGG Sbjct: 84 GGGGGRGGGGGYRGSRGGGGY--GGGGGYGGGERSYGGGGGGRSYGGEDRGYGGGGGGGG 141 Query: 142 W 140 + Sbjct: 142 Y 142 [75][TOP] >UniRef100_Q7UEZ2 RNA-binding protein n=1 Tax=Rhodopirellula baltica RepID=Q7UEZ2_RHOBA Length = 206 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/55 (61%), Positives = 34/55 (61%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGGY G G RGGGGG YGGG GGYGGG GGYG GGGG Sbjct: 150 GGGG---GGGGYGGGGGG-RGRGGGGGGYGGGGGNRGGGYGGG-GGGYGGGGGGG 199 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/52 (53%), Positives = 29/52 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESG 155 GG G GGGG G G GGGGG+ GGG GGYGGG GGYG G Sbjct: 153 GGGGGYGGGGGGRGRGGGGGGYGGGGGNRGGGYGGGGGGYGGGGGGGYGGRG 204 [76][TOP] >UniRef100_Q9FNR1 Putative uncharacterized protein At5g61030 n=1 Tax=Arabidopsis thaliana RepID=Q9FNR1_ARATH Length = 309 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G G GGY G GY GG GG GG GGYGG AGGYG SG GG Sbjct: 132 GGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGG 186 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/62 (48%), Positives = 31/62 (50%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGY-----GESGGGG 146 GG G G GGY G GY GGG YGG GGYGG AGGY G G GG Sbjct: 145 GGAGGYGGSGGYGGGAGGYGGNSGGG--YGG---NAAGGYGGSGAGGYGGDATGHGGAGG 199 Query: 145 GW 140 G+ Sbjct: 200 GY 201 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/51 (60%), Positives = 32/51 (62%) Frame = -1 Query: 295 REGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 R GGG+ G GY GGGGG YGG GGYGGG AGGYG SGG GG Sbjct: 119 RTSGGGFGGG--GY---GGGGGGYGGS-----GGYGGG-AGGYGGSGGYGG 158 [77][TOP] >UniRef100_Q7Y218 Putative uncharacterized protein At5g46730 n=1 Tax=Arabidopsis thaliana RepID=Q7Y218_ARATH Length = 290 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/68 (50%), Positives = 36/68 (52%), Gaps = 13/68 (19%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG----GSYGGGRRK---------VEGGYGGGEAGG 170 GG+G GGGG G GY GGGG G+YGGG GGYGGG AGG Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGG 250 Query: 169 YGESGGGG 146 YG GGGG Sbjct: 251 YGGGGGGG 258 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG + G GY S GG GG YGGG GGYGGG GG G G GG Sbjct: 218 GGGGAYGGGGAHGG---GYGSGGGEGGGYGGG---AAGGYGGGGGGGEGGGGSYGG 267 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/57 (49%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY--GGGEAGGYGESGGGGG 143 G G EG GG G +GY+S GG G GGG GGY G GE GG G G GG Sbjct: 62 GGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGG 118 [78][TOP] >UniRef100_C5YNX7 Putative uncharacterized protein Sb08g015580 n=1 Tax=Sorghum bicolor RepID=C5YNX7_SORBI Length = 250 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/54 (57%), Positives = 31/54 (57%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 G R GGGGY G G GGGGG YGGG GGYGGG G YG GGGG Sbjct: 111 GGFRGSGGGGYGGGGFGGGGYGGGGGGYGGG----GGGYGGGYGGNYGNRGGGG 160 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/61 (54%), Positives = 35/61 (57%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGG-----RRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGGY G GY GGGGG YGGG + GGYGGG G YG +GG G Sbjct: 122 GGGGF--GGGGYGGGGGGY---GGGGGGYGGGYGGNYGNRGGGGYGGG-VGDYGAAGGAG 175 Query: 145 G 143 G Sbjct: 176 G 176 [79][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/60 (55%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSY----GGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGGY G G GGGGG Y GGGR GG+GGG GG G GG GG Sbjct: 34 GGRGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGGGGGGFGGGGRGGVGGGGGRGG 93 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/55 (60%), Positives = 33/55 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G R GGGG G RGGGGG YGGG GGYGGG GGYG GGGG Sbjct: 22 GGYGGRGGGGGGGG-----RGRGGGGGGYGGGGGG--GGYGGGGGGGYGGGGGGG 69 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/57 (54%), Positives = 32/57 (56%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 G D R GGGG GY RGGGGG G GR GGYGGG GG GGGGG+ Sbjct: 6 GSDDYRGGGGGGGYGSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGY 62 [80][TOP] >UniRef100_A1BQW1 Glycine-rich RNA-binding protein (Fragment) n=1 Tax=Nicotiana attenuata RepID=A1BQW1_9SOLA Length = 152 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/60 (58%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG----ESGGGGG 143 GG G R GGGG G GGGG YGGGRR EGGYGGG GGYG E G GGG Sbjct: 92 GGGGYRGGGGGGYGGGGRREGGYGGGGGYGGGRR--EGGYGGGGGGGYGGGRREGGYGGG 149 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/50 (62%), Positives = 31/50 (62%), Gaps = 4/50 (8%) Frame = -1 Query: 310 GGDGRREGG----GGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAG 173 GG GRREGG GGY G GGGGG YGGGRR EGGYGGG G Sbjct: 105 GGGGRREGGYGGGGGYGGGRREGGYGGGGGGGYGGGRR--EGGYGGGSEG 152 [81][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 267 PPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPP 321 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 264 PPPPPPPPPPPPPPPPPPPC----PPPCPPPPPPCPPPPPPPPPCPPPPPPPPPP 314 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/53 (50%), Positives = 27/53 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PP PP PPP PPPPP P P PPPP P Sbjct: 313 PPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCP 365 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPP P P PPPP P P Sbjct: 275 PPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCP 329 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/59 (50%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Frame = +3 Query: 141 HPP-PPPLSP*PPASPPPYPPSTLRLPPP*L--PPPPPLEE*PSTSPLYPPPPSRLPSP 308 HPP PPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 239 HPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPP 297 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 288 PPPPPPCPPPPPPPPPCPP-----PPPPPPPPPP----PCPPPPPPPPPCPPPCP 333 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPP P P P PPPP P P Sbjct: 296 PPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPP 350 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PP P PP PPP PP PPP PPP P P P PPPP P P Sbjct: 255 PPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPP 309 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PP PP P P PPPP P P Sbjct: 298 PPPPPPCP-PPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPP 351 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/60 (46%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = +3 Query: 144 PPPPPLSP*-----PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP P PPP P P PPPP P P Sbjct: 248 PPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPP 307 [82][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPP 82 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPP 85 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP R PP PPPPP P P PPPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 60.1 bits (144), Expect = 8e-08 Identities = 33/64 (51%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P R PPPPP P PP PPP PP PPP PPPPP P P PPPP+R Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPP-----PPP--PPPPPPPPPPPPRPCPPPPPAR 112 Query: 297 LPSP 308 P P Sbjct: 113 -PCP 115 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PP PPPPP P P PPPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PP PP PPP PPPPP P P PPPP P P Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPP 108 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP P PPP P P PPPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP P P PPPPP P P PPPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP P P PPPPP P P PPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPP P P PPPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/56 (51%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYP-PSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP P P PPP PPPPP P P PPPP P P Sbjct: 49 PPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 [83][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/59 (49%), Positives = 33/59 (55%) Frame = +3 Query: 132 RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 R PPPPP P P + PPP PP + PPP PPPPP+ P P+ PPPP P P Sbjct: 1260 RAVSPPPPPPPPPPVSPPPPPPPPPVSPPPP--PPPPPVSPPPPPPPVSPPPPPPPPPP 1316 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/58 (53%), Positives = 31/58 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 P P PPPPP P PP SPPP PP PPP PPPPP P SP PPPP Sbjct: 1267 PPPPPPPVSPPPPP--PPPPVSPPPPPP-----PPPVSPPPPP----PPVSPPPPPPP 1313 [84][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/52 (53%), Positives = 31/52 (59%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRL 299 PPPPP SP PP+ PPP PP PP PPPPP PS P PPPP ++ Sbjct: 210 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPCKV 261 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP PPP PPPPP P SP P PP P P Sbjct: 184 PPPPPPSPPPPSPPPPSPPP----PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 234 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PPS PPP PPPP PS P PPPPS P P Sbjct: 189 PSPPPPSPPPPSPPPPPPPSPPPPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/53 (56%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP P P PPS PPP PPPPP P P PPPPS P Sbjct: 176 PPPPPPSPPPPPPPSPPPPS----PPPPSPPPPPPPSPPPPPPPSPPPPSPPP 224 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/64 (50%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP--PPLEE*PSTSPLYPPPP 290 P P+ PPPP P PP SPPP PP + PPP PPP PP P SP PPPP Sbjct: 187 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPS---PPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Query: 291 SRLP 302 S P Sbjct: 244 SPPP 247 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPP---PYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPP P PP SPP P PPS PPP PPPPP PS P PPPPS P Sbjct: 178 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP----PSPPPPSPPPPSPPP 229 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/53 (50%), Positives = 28/53 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPP P P PP+ PPP PP PP PP PP PS P PPPPS P Sbjct: 205 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 [85][TOP] >UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4IYP5_MAIZE Length = 441 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/70 (48%), Positives = 37/70 (52%), Gaps = 6/70 (8%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LP--PPPPLEE*PSTSPL----Y 278 P P+ PPPP +SP PP+ PPP PP LPPP P PPPPL P PL Sbjct: 260 PPPSPPPPSPPPPLMSPPPPSPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHS 319 Query: 279 PPPPSRLPSP 308 PPPP P P Sbjct: 320 PPPPLSSPPP 329 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/64 (46%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + P PPP SP PP+ PPP PPP PPPPPL P P PPPP Sbjct: 248 PPPRLPSPPPSPPPPSPPPPSPPPPLMSPPPPSPPPPSPPPPPLLP-PPPQPHSPPPPLS 306 Query: 297 LPSP 308 P P Sbjct: 307 SPPP 310 Score = 57.0 bits (136), Expect = 6e-07 Identities = 33/72 (45%), Positives = 35/72 (48%), Gaps = 8/72 (11%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LP----PPPPLEE*PSTSPL--- 275 P P+ PPPPPL P PP P PP + PPP LP PPPPL P PL Sbjct: 277 PPPSPPPPSPPPPPLLPPPPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQP 336 Query: 276 -YPPPPSRLPSP 308 PPPP P P Sbjct: 337 HSPPPPLSSPPP 348 Score = 57.0 bits (136), Expect = 6e-07 Identities = 34/67 (50%), Positives = 36/67 (53%), Gaps = 11/67 (16%) Frame = +3 Query: 141 HPPPPPLS--P*PPASPPPY-PPSTLRLPPP*LP------PPPPLEE*PSTSPL--YPPP 287 H PPPPLS P PP P P+ PP L PPP P PPPPL P PL PPP Sbjct: 299 HSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPPPPPPLPHSPPP 358 Query: 288 PSRLPSP 308 PS P+P Sbjct: 359 PSPAPAP 365 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/74 (43%), Positives = 34/74 (45%), Gaps = 6/74 (8%) Frame = +3 Query: 105 FIGNPKPN*RNYH------PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PST 266 F P N +H P PPP P PP SPPP P PPP + PPP PS Sbjct: 227 FYARPPVNCAAFHCKPFVPPMPPPRLPSPPPSPPPPSPPPPSPPPPLMSPPP-----PSP 281 Query: 267 SPLYPPPPSRLPSP 308 P PPPP LP P Sbjct: 282 PPPSPPPPPLLPPP 295 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/58 (50%), Positives = 30/58 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 P P R PPP P PP+ PPP PP L PPP PPPP P PL PPPP Sbjct: 246 PMPPPRLPSPPPSPP---PPSPPPPSPPPPLMSPPPPSPPPPS----PPPPPLLPPPP 296 Score = 53.1 bits (126), Expect = 9e-06 Identities = 34/74 (45%), Positives = 37/74 (50%), Gaps = 10/74 (13%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*L---PPPPPLEE*P-----STSP 272 P P H PPPPLS PP P P P S PPP L PPPPPL P + +P Sbjct: 310 PPPPLPQPHSPPPPLSSPPPPPPLPQPHS----PPPPLSSPPPPPPLPHSPPPPSPAPAP 365 Query: 273 LY--PPPPSRLPSP 308 +Y PPPP P P Sbjct: 366 VYHPPPPPQCPPCP 379 [86][TOP] >UniRef100_B9EXV1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9EXV1_ORYSJ Length = 532 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP P PPP PPPP P PS P PPPPS P P Sbjct: 362 PPPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPP 417 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/63 (50%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPS 293 P P+ PPPP SP PP+ PPP PP PPP PPPP P PS P PPPPS Sbjct: 365 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPS 424 Query: 294 RLP 302 P Sbjct: 425 PPP 427 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/60 (50%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYP-PSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 P P+ P PPP SP PP+ PPP P P PPP PPP P PS P PPPPS Sbjct: 370 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPS 429 [87][TOP] >UniRef100_Q8L3T8 cDNA clone:001-201-A04, full insert sequence n=2 Tax=Oryza sativa RepID=Q8L3T8_ORYSJ Length = 570 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP P PPP PPPP P PS P PPPPS P P Sbjct: 400 PPPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPP 455 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/63 (50%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPS 293 P P+ PPPP SP PP+ PPP PP PPP PPPP P PS P PPPPS Sbjct: 403 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPS 462 Query: 294 RLP 302 P Sbjct: 463 PPP 465 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/60 (50%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYP-PSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 P P+ P PPP SP PP+ PPP P P PPP PPP P PS P PPPPS Sbjct: 408 PPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPS 467 [88][TOP] >UniRef100_A8MSW5 Putative uncharacterized protein TNRC18 n=1 Tax=Homo sapiens RepID=A8MSW5_HUMAN Length = 1308 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/68 (51%), Positives = 38/68 (55%), Gaps = 6/68 (8%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP------PPLEE*PSTSPLY 278 P P R + PPPPP P PP PPP+PP LPPP LPPP PPL P P + Sbjct: 1118 PAPG-RPHRPPPPPPHPPPPPPPPPHPP----LPPPPLPPPPLPLRLPPLPPPPLPRP-H 1171 Query: 279 PPPPSRLP 302 PPPP LP Sbjct: 1172 PPPPPPLP 1179 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/59 (52%), Positives = 32/59 (54%), Gaps = 8/59 (13%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTL-----RLPPP*LP---PPPPLEE*PSTSPLYPPPPSR 296 PPPPP P PP PPP PP L LPPP LP PPPP P PL PPP +R Sbjct: 1134 PPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPP----PPLPPLLPPPQTR 1188 [89][TOP] >UniRef100_UPI000186773D hypothetical protein BRAFLDRAFT_237208 n=1 Tax=Branchiostoma floridae RepID=UPI000186773D Length = 378 Score = 62.4 bits (150), Expect = 2e-08 Identities = 34/57 (59%), Positives = 35/57 (61%), Gaps = 3/57 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGG---YGGGEAGGYGESGGG 149 GG G GGGGYSG GY GGGGGSYGGG GG YGGG +G G SGGG Sbjct: 267 GGGGYGGGGGGYSGGGGGY---GGGGGSYGGGGGSYGGGGGSYGGGSSGYGGSSGGG 320 Score = 60.1 bits (144), Expect = 7e-08 Identities = 34/61 (55%), Positives = 37/61 (60%), Gaps = 4/61 (6%) Frame = -1 Query: 310 GGDGRREG---GGGYSGDVDGYSSRG-GGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR G GGGY GD GY++ GGGG YGGG GG G G GGYG GGGGG Sbjct: 220 GGGGRGGGYGGGGGYGGDRGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGGYG--GGGGG 277 Query: 142 W 140 + Sbjct: 278 Y 278 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG Y G G S GGGGGSYGGG GYGG GGY + G G G Sbjct: 281 GGGGYGGGGGSYGG---GGGSYGGGGGSYGGG----SSGYGGSSGGGYSDFGSGYG 329 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 10/65 (15%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKV-------EGGYGGGEA---GGYGE 161 GG G+R+GG G G GY GG GG YGGG G YGGG GGYG Sbjct: 200 GGRGQRQGGFGGRGRGGGYGGGGGRGGGYGGGGGYGGDRGGYNNGNYGGGGGYGGGGYGG 259 Query: 160 SGGGG 146 SGGGG Sbjct: 260 SGGGG 264 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = -1 Query: 304 DGRREGGGGYSGDVDGYSSRGG--GGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 +G GGGGY G G S GG GGG YGGG GG GGG GG G GGGGG Sbjct: 243 NGNYGGGGGYGGGGYGGSGGGGYGGGGGYGGGGGGYSGG-GGGYGGGGGSYGGGGG 297 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/56 (51%), Positives = 32/56 (57%), Gaps = 8/56 (14%) Frame = -1 Query: 286 GGGYSGDVDGYSS--------RGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGGYS GY S +GGGGG YGGG R+ G YGGG + G G GG GG Sbjct: 318 GGGYSDFGSGYGSQQSNYGPMKGGGGGGYGGGGRQGGGPYGGGYSSGGGGGGGYGG 373 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/67 (46%), Positives = 32/67 (47%), Gaps = 11/67 (16%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG-----------GSYGGGRRKVEGGYGGGEAGGYG 164 GG G R GGGY G GGGG G+YGGG GGYGG GGYG Sbjct: 207 GGFGGRGRGGGYGGGGGRGGGYGGGGGYGGDRGGYNNGNYGGGGGYGGGGYGGSGGGGYG 266 Query: 163 ESGGGGG 143 GG GG Sbjct: 267 GGGGYGG 273 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/58 (51%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG---EAGGYGESGGGGG 143 G G GGGGY G G GGG G GGG GGYGGG GG G GGGGG Sbjct: 247 GGGGGYGGGGYGGSGGGGYGGGGGYGGGGGGYSGGGGGYGGGGGSYGGGGGSYGGGGG 304 [90][TOP] >UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3D7B Length = 211 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/56 (57%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDGR GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 104 GGDGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/56 (53%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG +G G GGGGG GGG + GG GGG GG G GGGGG Sbjct: 74 GGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGG 129 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG GGG GG GGG G G GGGGG Sbjct: 50 GGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGG 105 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G+ GGGGG Sbjct: 120 GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGDGGGGGG 175 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG +GG GGG GG G GGGGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGG 83 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G+ GGGGG Sbjct: 29 GGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGG 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G DG GGGGG GGG GG GGG GG G GGGGG Sbjct: 90 GGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGG-----GGGGGGGGGGDGGGGGGGG 140 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GGGGG GGG +GG GGG AGG G GG GG Sbjct: 45 GGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGG---DGGGGGGAAGGGGGGGGSGG 97 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G DG GGGG + GGG GG GGG GG G GGGGG Sbjct: 62 GGDGGGGGGGGGGGGGDG---GGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGG 114 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G DG GGGGG GGG GG GGG GG G GGGGG Sbjct: 116 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG-----GGGGGGGGGGGGGGGGGGG 166 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG GGG GG GGG GG G GGGG Sbjct: 118 GGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGDGGGG 173 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG+ GG G GGGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGG-----GGGGGGDGGGGGGGGGGGG 76 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GG G G S GGGGG G GR GG GGG GG G GGGGG Sbjct: 76 GGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGGGGGGGGG 131 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GGGG GD G GGGGG GGG GG GGG+ GG G GGGGG Sbjct: 92 GGGSGGGGGGGGGGDGRGGGGGGGGGGGGGGGG---GGGGGGGDGGGGGGGGGGGG 144 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GG GG G +GGGGG Sbjct: 36 GGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGGG 91 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G + GGGGG GGG GG G G GG G GGGGG Sbjct: 67 GGGGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGGGDGRGGGGGGGGGGGGGG 122 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 113 GGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGG-----GGGGGGGGGGGGGGGGGGG 163 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 114 GGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGG-----GGGGGGGGGGGGGGGGGGG 164 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GGDG GGGG G G GGGGG GGG G GGG GG G GGGG Sbjct: 130 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGDGGGGGGGGGRGGGGG 184 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG G G GGGGG GGG GG GGG GG G+ GGGGG Sbjct: 21 GSGGGGGGGGGGGGGGGGGGGGGGGGDGGGG-----GGGGGGGGGGGGDGGGGGG 70 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGG--GRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG GG G GG GGG+ GG G + GGGG Sbjct: 33 GGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGDGGGGGGAAGGGG 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G G GGG Sbjct: 117 GGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGDGGG 172 [91][TOP] >UniRef100_UPI0000DA2377 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA2377 Length = 132 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GGGGG GGG GG GGG+ GG G GGGGG Sbjct: 13 GGDGGGSGGGGDGGGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGGGGGGGGG 68 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG +GG GGG GG G GG GG Sbjct: 20 GGGGDGGGGGGGDGGGGGGGGGGGGGGDGGGGDGGGDGGGGGGGGGGGGGGGGDGG 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G DG GGGGG GGG GG GG + GG G GGGGG Sbjct: 36 GGGGGGGGGGGDGGGGDGGGDGGGGGGGGGGGGG--GGGDGGDDGGGGGGGGGGGG 89 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/56 (50%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGG G G GGGGG GGG +GG GGG GG G GG G Sbjct: 41 GGGGGGDGGGGDGGGDGGGGGGGGGGGGGGGGDGGDDGGGGGGGGGGGGGGDGGSG 96 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGG G DG GG GG GGG GG GGG GG G+ GGGGG Sbjct: 8 GGDGGGGDGGGSGGGGDGGGGGGGDGGGGGGGGGGGGGGDGGGGDGG-GDGGGGGG 62 [92][TOP] >UniRef100_UPI00004367E2 hypothetical protein LOC323529 n=1 Tax=Danio rerio RepID=UPI00004367E2 Length = 305 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/55 (54%), Positives = 32/55 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G R GG G +GY RGGG G+YGGG GYGGG GGYG GGG Sbjct: 190 GGRGGRGGGRGMGRPQNGYGGRGGGYGNYGGGGYGGNDGYGGGYGGGYGGGYGGG 244 [93][TOP] >UniRef100_Q6NYB0 Zgc:77366 n=1 Tax=Danio rerio RepID=Q6NYB0_DANRE Length = 305 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/55 (54%), Positives = 32/55 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G R GG G +GY RGGG G+YGGG GYGGG GGYG GGG Sbjct: 190 GGRGGRGGGRGMGRPQNGYGGRGGGYGNYGGGGYGGNDGYGGGYGGGYGGGYGGG 244 [94][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/51 (60%), Positives = 32/51 (62%) Frame = -1 Query: 295 REGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 R GGGGY G GY GGGGG YGGG GG GGG +GG G GGGGG Sbjct: 88 RSGGGGYGGGGGGYG--GGGGGGYGGGGGGGYGGGGGGRSGGGGGYGGGGG 136 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/56 (57%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G G GGGGG YGGG GG GG GG G SGGGGG Sbjct: 90 GGGGYGGGGGGYGGGGGG-GYGGGGGGGYGGGGGGRSGGGGGYGGGGGGRSGGGGG 144 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 6/61 (9%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGS------YGGGRRKVEGGYGGGEAGGYGESGGG 149 GG GR GGGGY G G S GGGGG YG G R GG GGG +GG G GGG Sbjct: 120 GGGGRSGGGGGYGGGGGGRSGGGGGGGDGGFRSPYGAGPR---GGGGGGRSGGGGGYGGG 176 Query: 148 G 146 G Sbjct: 177 G 177 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/62 (50%), Positives = 32/62 (51%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGY------GESGGG 149 GG G GGGG G G R GGGG YGGG GG GGG GG+ G GGG Sbjct: 103 GGGGGGYGGGGGGGYGGGGGGRSGGGGGYGGGGGGRSGGGGGGGDGGFRSPYGAGPRGGG 162 Query: 148 GG 143 GG Sbjct: 163 GG 164 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/57 (54%), Positives = 32/57 (56%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G R GGGG G G S GGGGG GG R G GG GG G SGGGGG+ Sbjct: 119 GGGGGRSGGGGGYGGGGGGRSGGGGGGGDGGFRSPYGAGPRGG--GGGGRSGGGGGY 173 [95][TOP] >UniRef100_A2SMG9 RNA-binding region RNP-1 n=1 Tax=Methylibium petroleiphilum PM1 RepID=A2SMG9_METPP Length = 162 Score = 62.4 bits (150), Expect = 2e-08 Identities = 34/57 (59%), Positives = 35/57 (61%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGG SG GY GGGGG YGGG GG GGG GG G SGGGGG+ Sbjct: 100 GGGGYGGGGGGRSGGGGGY---GGGGGGYGGGGGGRSGG-GGGYGGGGGRSGGGGGY 152 Score = 60.8 bits (146), Expect = 4e-08 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY--GGGEAGGYGESGGGGG 143 GG GR GGGGY G GY GGGGG GGG GGY GGG +GG G GGGGG Sbjct: 107 GGGGRSGGGGGYGGGGGGYG--GGGGGRSGGG-----GGYGGGGGRSGGGGGYGGGGG 157 [96][TOP] >UniRef100_A1VWW4 RNP-1 like RNA-binding protein n=1 Tax=Polaromonas naphthalenivorans CJ2 RepID=A1VWW4_POLNA Length = 150 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/56 (57%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R GGGGY G R GGGG Y GG R GGYGGG+ G G GGGGG Sbjct: 95 GGGGDRSGGGGYGG-----GDRSGGGGGYSGG-RSGGGGYGGGDRSGGGGYGGGGG 144 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/49 (59%), Positives = 29/49 (59%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG 164 GG R GGGGYSG R GGGG YGGG R GGYGGG GG G Sbjct: 107 GGGDRSGGGGGYSG------GRSGGGG-YGGGDRSGGGGYGGGGGGGRG 148 [97][TOP] >UniRef100_Q2QQ97 Os12g0502200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QQ97_ORYSJ Length = 258 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/60 (58%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVD----GYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGYSG GYS GGGGG Y GG GGYGG GGYG GGGGG Sbjct: 127 GGGGGGYGGGGYSGGGGYGGGGYSGGGGGGGGYQGGG----GGYGGNN-GGYGNRGGGGG 181 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/68 (45%), Positives = 39/68 (57%), Gaps = 12/68 (17%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYG----------GGRRKVEGGYGGGEAGGYGE 161 GG G + GGGGY G+ GY +RGGGGG YG G +G +GG AG +G+ Sbjct: 155 GGGGYQGGGGGYGGNNGGYGNRGGGGGGYGVAEGSADAFSGINLGGDGSFGGNPAGSFGD 214 Query: 160 SGG--GGG 143 +GG GGG Sbjct: 215 AGGSTGGG 222 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/54 (53%), Positives = 30/54 (55%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 G R GGGGY G G G GGG Y GG GGY GG GG G GGGGG+ Sbjct: 113 GFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGGGYQGGGGGY 166 [98][TOP] >UniRef100_Q08I87 Putative glycine-rich RNA-binding protein n=1 Tax=Dianthus caryophyllus RepID=Q08I87_DIACA Length = 163 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/60 (55%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGG-YGGGEAGGYG---ESGGGGGW 140 G G GGGGY G GGGGG YGG R GG YGGG GGYG E GGGGG+ Sbjct: 86 GSGGGGGGGGYRSGGGGGGGYGGGGGGYGGRREGGGGGGYGGGSGGGYGGRREGGGGGGY 145 Score = 61.6 bits (148), Expect = 3e-08 Identities = 36/64 (56%), Positives = 36/64 (56%), Gaps = 9/64 (14%) Frame = -1 Query: 310 GGDGRREGGGG---YSGDVDGYSSR--GGGGGSYGGGRRKVEGGYGG----GEAGGYGES 158 GG G R GGGG Y G GY R GGGGG YGGG GGYGG G GGYG Sbjct: 92 GGGGYRSGGGGGGGYGGGGGGYGGRREGGGGGGYGGGSG---GGYGGRREGGGGGGYGGG 148 Query: 157 GGGG 146 GGGG Sbjct: 149 GGGG 152 [99][TOP] >UniRef100_C1E508 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E508_9CHLO Length = 867 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 8/65 (12%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVD-----GYSSR---GGGGGSYGGGRRKVEGGYGGGEAGGYGESG 155 GG GR G GG SG G+ +R GGGGG YGGG GGYGGG GGYG G Sbjct: 802 GGGGRGGGSGGKSGKCHKCGQLGHWARDCPGGGGGGYGGG-----GGYGGG-GGGYGGGG 855 Query: 154 GGGGW 140 GGGGW Sbjct: 856 GGGGW 860 [100][TOP] >UniRef100_B6SP74 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6SP74_MAIZE Length = 156 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/54 (61%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG-EAGGYGESGG 152 GG GRR+GGGGY G GY GGGG YGGG GGYGGG GGYG S G Sbjct: 107 GGGGRRDGGGGYGGGGGGY----GGGGGYGGG----GGGYGGGNRGGGYGNSDG 152 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGD--VDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G DG GGGGG YGGG GGYGGG GGYG GGG+ Sbjct: 95 GGYGGGRGGGGYGGGGRRDGGGGYGGGGGGYGGG-----GGYGGG-GGGYGGGNRGGGY 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/53 (58%), Positives = 31/53 (58%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GR GGGGY G GGGG GGGRR GGYGGG GGYG GG GG Sbjct: 89 GRGGGGGGYGGG-------RGGGGYGGGGRRDGGGGYGGG-GGGYGGGGGYGG 133 [101][TOP] >UniRef100_B2YKT9 Glycine-rich RNA-binding protein n=1 Tax=Nicotiana tabacum RepID=B2YKT9_TOBAC Length = 157 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/60 (58%), Positives = 36/60 (60%), Gaps = 4/60 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG----ESGGGGG 143 GG G GGGGY G GGGGG YGGGRR +GGYGGG GGYG E G GGG Sbjct: 95 GGGGGYGGGGGYGGGGRREGGYGGGGGGYGGGRR--DGGYGGG--GGYGGGRREGGYGGG 150 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/63 (53%), Positives = 36/63 (57%), Gaps = 6/63 (9%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGES------GGG 149 GG GR GGGGY GGGG YGGG R+ EGGYGGG GGYG GGG Sbjct: 89 GGGGRGGGGGGY-----------GGGGGYGGGGRR-EGGYGGG-GGGYGGGRRDGGYGGG 135 Query: 148 GGW 140 GG+ Sbjct: 136 GGY 138 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/51 (60%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = -1 Query: 310 GGDGRREGG-GGYSGDVDGYSSRGG--GGGSYGGGRRKVEGGYGGGEAGGY 167 GG GRREGG GG G G GG GGG YGGGRR EGGYGGG G + Sbjct: 107 GGGGRREGGYGGGGGGYGGGRRDGGYGGGGGYGGGRR--EGGYGGGSEGSW 155 [102][TOP] >UniRef100_A8IZS5 Glycine-rich RNA-binding protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8IZS5_CHLRE Length = 165 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/60 (55%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESG----GGGGW 140 G G R GG Y G GY G GGG YGGGR GGYGGG +GGYG G GGGG+ Sbjct: 96 GGGGRGRGGDYGGGRGGYGGGGYGGGGYGGGRG--GGGYGGGGSGGYGGGGYGGNGGGGY 153 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G G GGG G YGG GGYGG GGYG GGG G Sbjct: 114 GGGGY--GGGGYGGGRGGGGYGGGGSGGYGG------GGYGGNGGGGYGAGGGGYG 161 [103][TOP] >UniRef100_B4MNL3 GK19601 n=1 Tax=Drosophila willistoni RepID=B4MNL3_DROWI Length = 338 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G R GGGG G G+ RGGGGG GGG + GG GGG GG G GGGG Sbjct: 33 GGFGGRGGGGGRGGGGGGFGGRGGGGGRGGGGGGRGFGGRGGGGRGGGGGRGGGG 87 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/62 (51%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG-----GSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G R GGGG G G RGGGG G GGG R GG GGG GG G GG G Sbjct: 39 GGGGGRGGGGGGFGGRGGGGGRGGGGGGRGFGGRGGGGRGGGGGRGGGGRGGGGRGGGAG 98 Query: 145 GW 140 G+ Sbjct: 99 GF 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G R GGGG G G+ RGGGGG GG + GG GG GG+G GGGGG Sbjct: 5 GFSPRGGGGGGGGGGGGFRGRGGGGGGGGGFGGRGGGGGRGGGGGGFGGRGGGGG 59 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG+ G G GG GG GGG R GG GG GG G GGGGG Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGGGGFGGRGGGGGRGGGGGGFGGRGGGGGRGGGGGG 66 [104][TOP] >UniRef100_B4IC29 GM10360 n=1 Tax=Drosophila sechellia RepID=B4IC29_DROSE Length = 281 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/59 (55%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYS-GDVDGYSSRGGGGGSYGGGRRKVEGG--YGGGEAGGYGESGGGGG 143 GG G GGGG+S G G+SS GGGGG +GGG GG GGG GG+G GGGGG Sbjct: 55 GGFGGSSGGGGFSSGGGGGFSSGGGGGGGFGGGFGGGSGGGFGGGGSIGGFGGGGGGGG 113 [105][TOP] >UniRef100_P51968 Heterogeneous nuclear ribonucleoprotein A3 homolog 1 n=1 Tax=Xenopus laevis RepID=RO31_XENLA Length = 373 Score = 62.4 bits (150), Expect = 2e-08 Identities = 34/62 (54%), Positives = 38/62 (61%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG-----GGEAGGYGESGGGG 146 GG GR GGGGY G DGY+ GG GG+YGGG GYG G + GGYG GGGG Sbjct: 246 GGGGR--GGGGYGGGGDGYNGFGGDGGNYGGGPGYGGRGYGGSPGYGNQGGGYG--GGGG 301 Query: 145 GW 140 G+ Sbjct: 302 GY 303 [106][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/53 (52%), Positives = 28/53 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P PPPP LP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALP 973 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/56 (51%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP---PLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPP P P+ P PPPP LP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPALP 984 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/62 (46%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Frame = +3 Query: 135 NYHPPP----PPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 NY P P P +P PP PPP PP PPP PPPPP P P PPPP P Sbjct: 840 NYEPAPMVCEEPTTPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Query: 303 SP 308 P Sbjct: 896 PP 897 [107][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/64 (48%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P P PPP SP PP+ PPP PP PPP PPPPP P SP P PP Sbjct: 118 PSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPP 177 Query: 297 LPSP 308 P P Sbjct: 178 SPPP 181 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/66 (50%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPP 290 P P + PPPPP SP PP+ PPP PP P PP PPPP PS P PPPP Sbjct: 252 PSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 311 Query: 291 SRLPSP 308 S P P Sbjct: 312 SPPPPP 317 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/55 (58%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PPP PPPPP PS P PPPPS PSP Sbjct: 388 PSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPPSPPPPSPPPPSPPPPSP-PSP 439 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/53 (56%), Positives = 31/53 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP PPPPP PS P PPPPS P Sbjct: 286 PSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPPPSPPPSPPPPSPPPPSPPP 336 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/53 (56%), Positives = 31/53 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP PPPPP PS P PPPPS P Sbjct: 342 PSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPPPSPPPSPPPPSPPPPSPPP 392 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP--PPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PP PPP PS P PPPPS PSP Sbjct: 467 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSP 523 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPP-P*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PP P PPPPP PS P PPPPS P Sbjct: 232 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPP 285 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP-PPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP P PPPP PS P PPPPS P Sbjct: 237 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 290 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP-PPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP PPP PP P SP PPPPS P Sbjct: 393 PSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPP 446 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP-PPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP PPP PP PS P PPPPS P Sbjct: 398 PSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPP 451 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PPS PP PPPP PS P PPPPS P Sbjct: 419 PSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 471 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP--PPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP P PPPP PS P PPPPS P Sbjct: 132 PSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 186 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 157 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 211 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP---PPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP P PPPP PS P PPPPS P Sbjct: 291 PSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 346 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP---PPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP PPP P PPPP PS P PPPPS P Sbjct: 347 PSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 402 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/65 (47%), Positives = 34/65 (52%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P P + P PPP SP PP+ PPP PP PP PPPP PS P PPPPS Sbjct: 312 SPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPS 368 Query: 294 RLPSP 308 P P Sbjct: 369 PPPPP 373 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/64 (51%), Positives = 33/64 (51%), Gaps = 9/64 (14%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP---------PPPPLEE*PSTSPLYPPPPSR 296 P PPP SP PP SPPP PPS PPP P PPPP PS P PPPPS Sbjct: 357 PSPPPPSP-PPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 415 Query: 297 LPSP 308 P P Sbjct: 416 PPPP 419 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPP--PPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PP PPP PS P PPPPS P P Sbjct: 207 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 263 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP P PP PPPP PS P PPPP PSP Sbjct: 212 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSP 268 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PP PP P SP PPPP P P Sbjct: 217 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPP 271 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PP PP P SP PPPPS PSP Sbjct: 271 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP-PPPPSPPPSP 324 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/57 (56%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP----PPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP SPPP PPS PPP P PPPP PS P PPPPS P Sbjct: 301 PSPPPPSP-PPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 356 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PP PP P SP PPPPS PSP Sbjct: 327 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP-PPPPPSPPPSP 380 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/52 (53%), Positives = 29/52 (55%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPP SP PP+ PPP PP PP PPPP PS P PPPPS P Sbjct: 415 PPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 466 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/62 (48%), Positives = 31/62 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPPP P PP P P PPS PP PPPP PS P PPPPS Sbjct: 140 PPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 199 Query: 297 LP 302 P Sbjct: 200 PP 201 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/54 (55%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LP-PPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP SPPP P PPP P PPPP PS P PPPPS P Sbjct: 408 PSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPP 461 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/54 (53%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP-PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP + P PP PPPP PS P PPPPS P Sbjct: 247 PSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 300 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PP SP PP+ PPP PP PP PPPP PS P PPPP P P Sbjct: 373 PPSPPPSPPPPSPPPPSPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPPSPPPP 424 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 162 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 216 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 167 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 221 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 172 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 226 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 177 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 231 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 182 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 236 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 187 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 241 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 192 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 246 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 197 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 251 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/54 (53%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPP P PP SPPP PP P PP PPPP PS P PPPPS P Sbjct: 308 PPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 361 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPP-PPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP P PPP PPP PP PS P PPPPS P Sbjct: 403 PSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPP 456 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/53 (52%), Positives = 29/53 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ P P PPS PP PPPP PS P PPPPS P Sbjct: 424 PSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 476 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPP P SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 432 PPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 486 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 437 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 491 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 442 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 496 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 447 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 501 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 P PPP SP PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 452 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 506 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP SPPP P PPP PPP P PS P PPP PSP Sbjct: 281 PSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSP 334 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP SPPP P PPP PPP P PS P PPP PSP Sbjct: 337 PSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSP 390 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/55 (50%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PP PP P PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 152 PPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 206 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/55 (50%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLP--PP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPP P P PP+ PPP PP P PP PPPP PS P PPPPS P Sbjct: 427 PPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 481 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/54 (51%), Positives = 29/54 (53%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPS 305 P PPP SP PP+ PPP PP PP PP PP P SP PPPS PS Sbjct: 482 PSPPPPSPPPPSPPPPSPP-----PPSPPPPSPPPPSPPPPSPPPSPPPSHPPS 530 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PP S PP+ PPP PP PPP PPPP PS P PPP PSP Sbjct: 117 PPSPPPSQPPPSPPPPSPPPP--SPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSP 169 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/55 (49%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP--PPSRLP 302 P PPP SP PP+ PPP PP PP PP PP PS P +PP PP P Sbjct: 487 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSHPPSHPPMHPPMHPP 541 [108][TOP] >UniRef100_Q013M1 Chromosome 08 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri RepID=Q013M1_OSTTA Length = 442 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/54 (55%), Positives = 32/54 (59%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPLSP PP+ PP PP+ PPP PP PP PS SP PPPPS P P Sbjct: 157 PSPPLSPPPPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPP 210 [109][TOP] >UniRef100_UPI00016C5334 RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C5334 Length = 137 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/57 (64%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGG-YSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GRR GGGG Y G GY GGGGG YGGG GGYGGG GGYG GGGGG Sbjct: 88 GGGGRRGGGGGGYGGGGGGY---GGGGGGYGGG----GGGYGGG-GGGYG--GGGGG 134 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/51 (58%), Positives = 31/51 (60%) Frame = -1 Query: 295 REGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 +EGGGG G RGGGGG YGGG GGYGGG GGYG GGG G Sbjct: 82 KEGGGGGGG-----GRRGGGGGGYGGG----GGGYGGG-GGGYGGGGGGYG 122 [110][TOP] >UniRef100_Q7UA83 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 8102 RepID=Q7UA83_SYNPX Length = 214 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/63 (52%), Positives = 36/63 (57%), Gaps = 6/63 (9%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAG--GYGESG----GG 149 GG G R+GGGGY G GY GGG G GGG R GGYGGG G G G++G G Sbjct: 105 GGGGGRDGGGGYGGGGGGYRGGGGGYGGGGGGGRDGGGGYGGGGGGYRGGGDAGDRPSGA 164 Query: 148 GGW 140 GW Sbjct: 165 RGW 167 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -1 Query: 310 GGDGRREGGGGYSGDV--------DGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESG 155 GG G R GGGGY G DG GGGGG Y GG GG GGG GG G G Sbjct: 87 GGGGYRGGGGGYGGGGGYGGGGGRDGGGGYGGGGGGYRGGGGGYGGGGGGGRDGGGGYGG 146 Query: 154 GGGGW 140 GGGG+ Sbjct: 147 GGGGY 151 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG----EAGGYGESGGGGG 143 G R GGGGY G GY GGGGG GGG R GGYGGG GG G GGGGG Sbjct: 81 GSAPRGGGGGYRGGGGGY---GGGGGYGGGGGRDGGGGYGGGGGGYRGGGGGYGGGGGG 136 [111][TOP] >UniRef100_Q9SWA8 Glycine-rich RNA-binding protein n=1 Tax=Glycine max RepID=Q9SWA8_SOYBN Length = 160 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGGY+ GY R GGGG GGG R +GGYGGG GG G GGG Sbjct: 89 GGGGGGGGGGGYNRGGGGYGGRSGGGGG-GGGYRSRDGGYGGGYGGGGGGGYGGG 142 Score = 58.5 bits (140), Expect = 2e-07 Identities = 35/66 (53%), Positives = 35/66 (53%), Gaps = 9/66 (13%) Frame = -1 Query: 310 GGDGRREGGGGY------SGDVDGYSSRGGG-GGSYGGGRRKVEGGYGGGEAGGY--GES 158 GG G GGGGY G GY SR GG GG YGGG GGYGGG GY G Sbjct: 96 GGGGYNRGGGGYGGRSGGGGGGGGYRSRDGGYGGGYGGGG---GGGYGGGRDRGYSRGGD 152 Query: 157 GGGGGW 140 GG GGW Sbjct: 153 GGDGGW 158 [112][TOP] >UniRef100_Q9FIQ2 Genomic DNA, chromosome 5, P1 clone:MZA15 n=1 Tax=Arabidopsis thaliana RepID=Q9FIQ2_ARATH Length = 268 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/69 (49%), Positives = 36/69 (52%), Gaps = 13/69 (18%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG----GSYGGGRRK---------VEGGYGGGEAGG 170 GG+G GGGG G GY GGGG G+YGGG GGYGGG AGG Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGG 250 Query: 169 YGESGGGGG 143 YG GGGG Sbjct: 251 YGGGHGGGG 259 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/54 (55%), Positives = 31/54 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG G GGG + G GY S GG GG YGGG GGYGGG GG G GGG Sbjct: 218 GGGGAYGGGGAHGG---GYGSGGGEGGGYGGG---AAGGYGGGHGGGGGHGGGG 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/57 (49%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY--GGGEAGGYGESGGGGG 143 G G EG GG G +GY+S GG G GGG GGY G GE GG G G GG Sbjct: 62 GGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGG 118 [113][TOP] >UniRef100_Q75QN9 Cold shock domain protein 2 n=1 Tax=Triticum aestivum RepID=Q75QN9_WHEAT Length = 205 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/56 (60%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGG-YGESGGGG 146 GG G GGGGY G GY GGGGGSYGGG GGYGGG GG YG GGG Sbjct: 98 GGGGYGGGGGGYGGGGGGY---GGGGGSYGGG-----GGYGGGGGGGRYGGGSGGG 145 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/60 (56%), Positives = 34/60 (56%), Gaps = 5/60 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGG-----GEAGGYGESGGGG 146 GGD GGGGY G GY GGGGG YGGG GGYGG G GGYG GGGG Sbjct: 86 GGDRGGRGGGGYGG--GGY---GGGGGGYGGG----GGGYGGGGGSYGGGGGYGGGGGGG 136 [114][TOP] >UniRef100_Q41453 Putative glycine rich RNA binding protein n=1 Tax=Solanum tuberosum RepID=Q41453_SOLTU Length = 175 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/56 (58%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG-EAGGYGESGGGGG 143 G GRREGGGG G G GGGGG Y GG GGYGGG GGYG GGG G Sbjct: 100 GGGRREGGGGGYGGYGGGRREGGGGGGYSGG----GGGYGGGRREGGYGGGGGGYG 151 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/64 (57%), Positives = 37/64 (57%), Gaps = 9/64 (14%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG---------ESG 155 G GRREGGGG GYS GGG YGGGRR EGGYGGG GGYG G Sbjct: 115 GGGRREGGGG-----GGYSGGGGG---YGGGRR--EGGYGGG-GGGYGGGDRYSDRSSRG 163 Query: 154 GGGG 143 GGGG Sbjct: 164 GGGG 167 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/54 (61%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGG-GSYGGGRRKVEGGYGGGEAGGYGESGGG 149 G GR GGGGY G G GGGG G YGGGRR EGG GGG +GG G GGG Sbjct: 91 GGGR--GGGGYGG---GRREGGGGGYGGYGGGRR--EGGGGGGYSGGGGGYGGG 137 [115][TOP] >UniRef100_Q40426 RNA-binding glycine-rich protein-1a n=1 Tax=Nicotiana sylvestris RepID=Q40426_NICSY Length = 156 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/66 (56%), Positives = 37/66 (56%), Gaps = 11/66 (16%) Frame = -1 Query: 307 GDGRREGGGGY-SGDVDGYSSRG------GGGGSYGGGRRKVEGGYGGGEAGGYG----E 161 G G GGGGY G GY G GGGG YGGGRR EGGYGGG GGYG E Sbjct: 86 GSGGGGGGGGYRGGSGGGYGGGGRREGGYGGGGGYGGGRR--EGGYGGGGGGGYGGGRRE 143 Query: 160 SGGGGG 143 G GGG Sbjct: 144 GGYGGG 149 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/52 (59%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = -1 Query: 310 GGDGRRE----GGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGY 167 GG GRRE GGGGY G GGGGG YGGGRR EGGYGGG G + Sbjct: 105 GGGGRREGGYGGGGGYGGGRREGGYGGGGGGGYGGGRR--EGGYGGGSEGNW 154 [116][TOP] >UniRef100_O24106 RNA-binding protein n=1 Tax=Nicotiana glutinosa RepID=O24106_NICGU Length = 156 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/57 (61%), Positives = 35/57 (61%), Gaps = 4/57 (7%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG----ESGGGGG 143 GR GGGGY G GGGGG YGGGRR EGGYGGG GGYG E G GGG Sbjct: 97 GRGGGGGGYGGGGRREGGYGGGGGGYGGGRR--EGGYGGG--GGYGGGRREGGYGGG 149 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/60 (56%), Positives = 36/60 (60%), Gaps = 6/60 (10%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGES------GGGGGW 140 G GGGGY G RGGGGG YGGG R+ EGGYGGG GGYG GGGGG+ Sbjct: 86 GSGGGGGGYRG------GRGGGGGGYGGGGRR-EGGYGGG-GGGYGGGRREGGYGGGGGY 137 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/51 (60%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = -1 Query: 310 GGDGRREGG-GGYSGDVDGYSSRGG--GGGSYGGGRRKVEGGYGGGEAGGY 167 GG GRREGG GG G G GG GGG YGGGRR EGGYGGG G + Sbjct: 106 GGGGRREGGYGGGGGGYGGGRREGGYGGGGGYGGGRR--EGGYGGGSEGNW 154 [117][TOP] >UniRef100_O22385 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22385_ORYSA Length = 161 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/57 (61%), Positives = 37/57 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G+R GGGGY G GY GGGGG YG R EGGYGGG GGYG GGGG+ Sbjct: 95 GGYGQRGGGGGYGG--GGYGG-GGGGGGYGQRR---EGGYGGG--GGYGGGRGGGGY 143 [118][TOP] >UniRef100_B7SDF0 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=B7SDF0_ORYSJ Length = 161 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/57 (61%), Positives = 37/57 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G+R GGGGY G GY GGGGG YG R EGGYGGG GGYG GGGG+ Sbjct: 95 GGYGQRGGGGGYGG--GGYGG-GGGGGGYGQRR---EGGYGGG--GGYGGGRGGGGY 143 [119][TOP] >UniRef100_A5BQ96 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BQ96_VITVI Length = 219 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/62 (53%), Positives = 34/62 (54%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG------GSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG G GGGGY G GY GGGG G GGG + GGYGGG GG G GGG Sbjct: 91 GGYGGGGGGGGYGGGGGGYGYNGGGGRGGGRGGRGGGGGGRSSGGYGGGGYGGGGGYGGG 150 Query: 148 GG 143 GG Sbjct: 151 GG 152 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/57 (54%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY----GGGEAGGYGESGGGGG 143 G R GGGG G G GGGGG YGGG GGY GGG GG G GGGGG Sbjct: 77 GSRGGGGGRGGRGGGGYGGGGGGGGYGGG----GGGYGYNGGGGRGGGRGGRGGGGG 129 Score = 54.3 bits (129), Expect = 4e-06 Identities = 34/73 (46%), Positives = 34/73 (46%), Gaps = 17/73 (23%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG----------- 164 GG GR G GG G G SS G GGG YGGG GGYGGG GG G Sbjct: 113 GGGGRGGGRGGRGGGGGGRSSGGYGGGGYGGG-----GGYGGGGGGGGGACYNCGEEGHL 167 Query: 163 ------ESGGGGG 143 SGGGGG Sbjct: 168 ARDCSQSSGGGGG 180 [120][TOP] >UniRef100_A2YGT9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YGT9_ORYSI Length = 122 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/56 (55%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G + GGGG G G +GGGGGS GGGR GG GGG+ GG G SG GG Sbjct: 8 GGGGGKGGGGGGGGGKGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKQGG 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/56 (50%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G +GGGGG GGG G GGG GG G+ GG GG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGGKGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGG 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/59 (47%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGG---YGGGEAGGYGESGGGGG 143 GG G+ GGG G G R GGGG GGG+ EGG GGG +GG+ GGG G Sbjct: 19 GGGGKGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKQGGGYSGGHAGGGGGAG 77 [121][TOP] >UniRef100_B4IZJ4 GH14508 n=1 Tax=Drosophila grimshawi RepID=B4IZJ4_DROGR Length = 272 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG---ESGGGGG 143 GG G GGGGY G G GGGGG YGGG + GYGGG GGYG SGG GG Sbjct: 65 GGGGGYGGGGGYGGGGGGGGYGGGGGGGYGGGG---DSGYGGGGGGGYGGGDSSGGHGG 120 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG GGGGY G GY GGGGG GGG GGYGGG GYG GGGG Sbjct: 59 GGWAAGGGGGGYGGG-GGYGGGGGGGGYGGGG----GGGYGGGGDSGYGGGGGGG 108 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = -1 Query: 283 GGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GGY G G++S GGGGG YGGG GGYGGG GGYG GG GW Sbjct: 139 GGYGGG--GWASGGGGGGGYGGGGG--GGGYGGG--GGYGGGGGSAGW 180 [122][TOP] >UniRef100_C5MJJ9 Predicted protein n=1 Tax=Candida tropicalis MYA-3404 RepID=C5MJJ9_CANTT Length = 747 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/58 (58%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYS--SRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG SG DGY S GG GG YGGG GGYGGG GGYG GGGG Sbjct: 373 GGYGGGYGGGSGSGYCDGYGGGSGGGSGGGYGGG---YGGGYGGGYGGGYGGGYGGGG 427 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/48 (60%), Positives = 29/48 (60%) Frame = -1 Query: 289 GGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GGGG SG G S GG GG YGGG GGYGGG GGYG GGG Sbjct: 338 GGGGGSGGGSGGGSGGGSGGGYGGG---YGGGYGGGYGGGYGGGYGGG 382 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G G GG SG G S GG GG YGGG GGYGGG GGYG G G Sbjct: 335 GGTGGGGGSGGGSGGGSGGGSGGGYGGGYGGG---YGGGYGGGYGGGYGGGSGSG 386 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/58 (55%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = -1 Query: 310 GGDGRREGGG---GYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G G G GY G G S GG GG YGGG GGYGGG GGYG GGGG Sbjct: 377 GGYGGGSGSGYCDGYGGG-SGGGSGGGYGGGYGGG---YGGGYGGGYGGGYGGGGGGG 430 [123][TOP] >UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum bicolor RepID=C5XPK9_SORBI Length = 613 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/64 (50%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP SP PP+ PPP PP PPP PPPP PS P PPPPS Sbjct: 410 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPP-PSPPPPSPPPPSPPPPSPPPPSP 468 Query: 297 LPSP 308 P P Sbjct: 469 SPPP 472 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/70 (47%), Positives = 35/70 (50%), Gaps = 6/70 (8%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP------PLEE*PSTSPLY 278 P P+ P PPP SP PP+ PPP PP PPP PPPP P PS P Sbjct: 437 PPPSPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPS 496 Query: 279 PPPPSRLPSP 308 PPPPS P P Sbjct: 497 PPPPSPSPPP 506 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/64 (50%), Positives = 34/64 (53%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPP SP PP+ PPP PP PPP PPP P PS P PPPPS Sbjct: 427 PPPSPPPPSPPPPSPSPPPPSPPPPSPPPP-SPPPPSPPPPSPSPPPPSPPPPSPPPPSP 485 Query: 297 LPSP 308 P P Sbjct: 486 SPPP 489 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/54 (53%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPSRLP 302 PP PP SP PP+ PPP P PPP PPPP P PS P PPPPS P Sbjct: 407 PPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPPP 460 [124][TOP] >UniRef100_C5XMP4 Putative uncharacterized protein Sb03g003730 n=1 Tax=Sorghum bicolor RepID=C5XMP4_SORBI Length = 557 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/67 (53%), Positives = 37/67 (55%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPP--LEE*PSTSPL-YPPP 287 P P PPPPPL P PP+ PPP PPS PP PPPP L P SPL PPP Sbjct: 398 PSPPPPMLPPPPPPLPP-PPSPPPPLPPSPPPPSPPLPSPPPPPLLPSPPPPSPLPSPPP 456 Query: 288 PSRLPSP 308 P LPSP Sbjct: 457 PPLLPSP 463 Score = 59.3 bits (142), Expect = 1e-07 Identities = 37/67 (55%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPL-SP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPL-YPPP 287 P P R PPPP L SP PP PPP PP LPPP PPPP P P + PL PPP Sbjct: 383 PMPPPRLPSPPPPMLPSPPPPMLPPPPPP----LPPPPSPPPPLPPSPPPPSPPLPSPPP 438 Query: 288 PSRLPSP 308 P LPSP Sbjct: 439 PPLLPSP 445 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/63 (52%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPA-SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 P P+ PPPPPL P PP SP P PP PPP LP PPP PS P PPPPS Sbjct: 427 PPPSPPLPSPPPPPLLPSPPPPSPLPSPP-----PPPLLPSPPP----PSPRPRSPPPPS 477 Query: 294 RLP 302 P Sbjct: 478 SPP 480 [125][TOP] >UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8JFD4_CHLRE Length = 898 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP+ PPP PP PP PPPPP S SP PPP R PSP Sbjct: 269 PSPPPPSPPPPSPPPPSPPPPSPSPPTPSPPPPPSTVLTSPSPPPSPPPPRPPSP 323 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/69 (50%), Positives = 39/69 (56%), Gaps = 5/69 (7%) Frame = +3 Query: 117 PKPN*RNYHPP-PPPLSP*PPASPPPYPPSTLRLPPP*LP-PPPPLEE*PSTSPLYPPPP 290 P P + PP PPP SP PP+ PPP PP PPP P PPPP P+ SP PPPP Sbjct: 249 PSPRPPSPRPPSPPPPSPPPPSPPPPSPPPPS--PPP--PSPPPPSPSPPTPSP--PPPP 302 Query: 291 SRL---PSP 308 S + PSP Sbjct: 303 STVLTSPSP 311 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP SP PP PP PPST+ L P PP PP PS P PPPP R P P Sbjct: 284 PSPPPPSPSPPTPSPPPPPSTV-LTSPSPPPSPPPPRPPSPPPPRPPPP-RPPLP 336 [126][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/52 (55%), Positives = 29/52 (55%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRL 299 PPPPP P PP PPP PP PPP PPPPP P P PPPP RL Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRL 100 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/54 (51%), Positives = 29/54 (53%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPS 305 PPPPP P PP PPP PP PPP PPPPP P P PPPP + S Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103 [127][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/57 (54%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR--LPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP R LP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVP 114 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 [128][TOP] >UniRef100_UPI00017C2E1B PREDICTED: similar to heterogeneous nuclear ribonucleoprotein A3 n=1 Tax=Bos taurus RepID=UPI00017C2E1B Length = 380 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/62 (53%), Positives = 35/62 (56%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREGGGG-----YSGDVDGYSSRGGGGGSYGGGRR-KVEGGYGGGEAGGYGESGGG 149 GG G GGGG Y G GY+ GG GG+YGGG GGYGGG GGYG GGG Sbjct: 244 GGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGGYGNQGGG 303 Query: 148 GG 143 G Sbjct: 304 YG 305 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDG---YSSRGGGGGSYGGGRRKVEGGYGGGEAG--GYGESGGGG 146 GGDG G GG G+ G YSSRGG GG GG GGYGGG G GY E G G Sbjct: 262 GGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGGYGNQGGGYGGGGGGYDGYNEGGNFG 321 Query: 145 G 143 G Sbjct: 322 G 322 [129][TOP] >UniRef100_UPI0000E127A2 Os06g0317400 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E127A2 Length = 160 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/56 (57%), Positives = 33/56 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GDG GGG G GY GG GG YGGG GGYGGG GGYG GGGGG+ Sbjct: 64 GDGYGHGGGYGGGYGSGYG--GGNGGGYGGG----YGGYGGGYGGGYGGGGGGGGY 113 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGGG--GYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG+G GGG GY G G GGGGG YGG GGYGGG GYG GGGG Sbjct: 83 GGNGGGYGGGYGGYGGGYGGGYGGGGGGGGYGG-----YGGYGGGGYEGYGRGYGGGG 135 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/64 (51%), Positives = 33/64 (51%), Gaps = 7/64 (10%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG-----GSYGGGRRKVEGGYGGG--EAGGYGESGG 152 GG G GGGG G GY GGGG YGGG GGYGGG GGY GG Sbjct: 98 GGYGGGYGGGGGGGGYGGYGGYGGGGYEGYGRGYGGGGGG--GGYGGGGYPGGGYYGGGG 155 Query: 151 GGGW 140 GGGW Sbjct: 156 GGGW 159 [130][TOP] >UniRef100_UPI0000DA1BD4 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1BD4 Length = 250 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/57 (56%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGS-YGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGG GD G GGGGG GGG V GG GGG+ GG G GGGGG Sbjct: 168 GGGGGGDGGGGGGGDGGGGGGGGGGGGDGSGGGDGGVGGGSGGGDGGGGGGGGGGGG 224 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/56 (57%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG +GGGG G V G GGGGG GGG GG GGG GG G GGGGG Sbjct: 74 GGDGGGDGGGGGGGGVGG----GGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGG 125 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG GGG GG GGG+ GG G GGGGG Sbjct: 106 GGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGG----GGGGGGGDGGGGGGGGGGGG 157 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GG GG GGG V GG GGG+ GG G GGGGG Sbjct: 56 GGDGGGRGGGGGDGGGGGGGDGGGDGGGGGGG--GVGGGGGGGDGGGGGGGGGGGG 109 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 78 GGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGG-----GGGGGGGGGGDGGGGGGGG 128 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG G G V GG GGG+ GG G GGGG Sbjct: 131 GGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGG 186 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G +GGGG GD G GGGGG GGG GG GGG GG G GGGGG Sbjct: 63 GGGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGG 117 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GGGGG GGG GG GGG+ GG G GGGGG Sbjct: 118 GGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGG-GVGGGGGG 172 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG GGG G GGG GG G GGGGG Sbjct: 83 GGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGG 138 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GGG G GGG GG GGG GG G GGGGG Sbjct: 95 GGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGG 150 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G DG GGGGG GGG +GG G G GG G+ GGGGG Sbjct: 129 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG----DGGGGVGGGGGGGDGGGGGG 180 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 85 GGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGG 140 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G+ GGGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGG-----GGGGGGGGGGGGDGGGGGG 151 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGG G G GGGG GGG GG GGG+ GG G GGGGG Sbjct: 139 GGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGG 194 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G DG GGG G GGG GG GGG GG G GGGGG Sbjct: 64 GGGGDGGGGGGGDGGGDGGGGGGGGVGGGGGGGDGGGGGGGGGGGGGGGGGGGGGG 119 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG +GG GGG GG G G GGG Sbjct: 109 GGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGG 164 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGG G G GGGGG GGG GG GGG GG G GGGG Sbjct: 127 GGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGG 181 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/56 (50%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGG G G GGG G GGG +GG GGG GG G GGG G Sbjct: 176 GGGGGGDGGGGGGGGGGGGDGSGGGDGGVGGGSGGGDGGGGGGGGGGGGGVGGGDG 231 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 92 GGGGGDGGGGGGGGGGGGGGGGGGGGGGDGGG-----GGGGGGGGGGGGGGGGGGG 142 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 93 GGGGDGGGGGGGGGGGGGGGGGGGGGGDGGGG-----GGGGGGGGGGGGGGGGGGG 143 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG GGG GG GGG GG SGGG G Sbjct: 147 GGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGGDGSGGGDG 202 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGG G G GGGGG GGG +GG GGG GG G+ GGG Sbjct: 146 GGGGGGGGGGGGGGGDGGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGGDGSGGG 200 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGG---GRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GG G +GG GGG GG G GGGGG Sbjct: 162 GGGGVGGGGGGGDGGGGGGGDGGGGGGGGGGGGDGSGGGDGGVGGGSGGGDGGGGGGGG 220 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G +GGGG G G GGGGG GGG GG GGG GG G GGGG Sbjct: 114 GGGGGGDGGGGGGG---GGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGDGGGG 165 [131][TOP] >UniRef100_UPI0000EBC230 PREDICTED: Bos taurus hypothetical protein LOC781499 (LOC781499), mRNA. n=1 Tax=Bos taurus RepID=UPI0000EBC230 Length = 379 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/62 (53%), Positives = 35/62 (56%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREGGGG-----YSGDVDGYSSRGGGGGSYGGGRR-KVEGGYGGGEAGGYGESGGG 149 GG G GGGG Y G GY+ GG GG+YGGG GGYGGG GGYG GGG Sbjct: 244 GGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGGYGNQGGG 303 Query: 148 GG 143 G Sbjct: 304 YG 305 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDG---YSSRGGGGGSYGGGRRKVEGGYGGGEAG--GYGESGGGG 146 GGDG G GG G+ G YSSRGG GG GG GGYGGG G GY E G G Sbjct: 262 GGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGGYGNQGGGYGGGGGGYDGYNEGGNFG 321 Query: 145 G 143 G Sbjct: 322 G 322 [132][TOP] >UniRef100_A5XS09 Single-stranded DNA-binding protein n=3 Tax=Burkholderia mallei RepID=A5XS09_BURMA Length = 212 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/59 (57%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG---ESGGGGG 143 GG G GGGG GD GY GGGGG YGGGR GG GG +GG G SGGGGG Sbjct: 128 GGGGGGGGGGGGGGDDGGY---GGGGGGYGGGRDMERGGGGGRASGGGGAGARSGGGGG 183 [133][TOP] >UniRef100_Q5Z4P5 Os06g0317400 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z4P5_ORYSJ Length = 153 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/56 (57%), Positives = 33/56 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GDG GGG G GY GG GG YGGG GGYGGG GGYG GGGGG+ Sbjct: 57 GDGYGHGGGYGGGYGSGYG--GGNGGGYGGG----YGGYGGGYGGGYGGGGGGGGY 106 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGGG--GYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG+G GGG GY G G GGGGG YGG GGYGGG GYG GGGG Sbjct: 76 GGNGGGYGGGYGGYGGGYGGGYGGGGGGGGYGG-----YGGYGGGGYEGYGRGYGGGG 128 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/64 (51%), Positives = 33/64 (51%), Gaps = 7/64 (10%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG-----GSYGGGRRKVEGGYGGG--EAGGYGESGG 152 GG G GGGG G GY GGGG YGGG GGYGGG GGY GG Sbjct: 91 GGYGGGYGGGGGGGGYGGYGGYGGGGYEGYGRGYGGGGGG--GGYGGGGYPGGGYYGGGG 148 Query: 151 GGGW 140 GGGW Sbjct: 149 GGGW 152 [134][TOP] >UniRef100_Q0KIW2 Glycine-rich RNA-binding protein n=1 Tax=Triticum aestivum RepID=Q0KIW2_WHEAT Length = 163 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/58 (53%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSG---DVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGGY G + G GGGGG Y GGR GGYG + GGYG GGGG Sbjct: 91 GGGGFGGGGGGYGGQRREGGGGGGYGGGGGGYRGGRSGGGGGYGSRDGGGYGGGGGGG 148 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/58 (56%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = -1 Query: 307 GDGRREGGGG--YSGDVDGY-SSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G RREGGGG Y G GY R GGGG YG + GGYGGG GGYG S GG G Sbjct: 103 GGQRREGGGGGGYGGGGGGYRGGRSGGGGGYGS---RDGGGYGGGGGGGYGGSRGGSG 157 [135][TOP] >UniRef100_B6TY06 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6TY06_MAIZE Length = 142 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG-EAGGYGESGGGGGW 140 GG GRR+GG G G G R GGGG YGGG GGYGG E GG G GGGGGW Sbjct: 90 GGGGRRDGGYGGGGGYGG--RREGGGGGYGGG-----GGYGGRREGGGGGYGGGGGGW 140 [136][TOP] >UniRef100_B4JLJ8 GH12877 n=1 Tax=Drosophila grimshawi RepID=B4JLJ8_DROGR Length = 96 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/57 (56%), Positives = 32/57 (56%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G GY G GGG YGGG GG GG GG G GGGGGW Sbjct: 23 GGGG---GGGGYGGG-GGYGGGGHGGGGYGGGHGGGHGGGHGGGGGGGGGGGGGGGW 75 [137][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/53 (52%), Positives = 28/53 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P P PPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [138][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP PSP Sbjct: 488 PPPPPPPPPPPPPPPPSPPP----PPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/53 (49%), Positives = 28/53 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P SP+ P +P Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIP 548 [139][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/55 (60%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP SPPP PPS PPP PPPPP PS P PPPP P P Sbjct: 208 PPPPPPSPSPPPSPPP-PPS----PPPPPPPPPP----PSPPPPPPPPPPPSPPP 253 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP P PP+ PPP PP PPP PPPPP P SP PPP LP P Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSP--PPPSPPLPPP 267 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP PP PPP PPPPP PS P PP +PSP Sbjct: 227 PPPPPPPPPPPSPPPPPPP-----PPPPSPPPPPSPPPPSP----PLPPPSIPSP 272 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/60 (51%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = +3 Query: 144 PPPPPL-----SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP SPPP PP PPP PPPPP P P PPPP P P Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPP----PPPPSPPPPP----PPPPPPSPPPPPSPPPP 260 [140][TOP] >UniRef100_C5YLB8 Putative uncharacterized protein Sb07g000099 n=1 Tax=Sorghum bicolor RepID=C5YLB8_SORBI Length = 1399 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/64 (48%), Positives = 33/64 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPPPL P PP + PP PP L P PPPPPL P P PPPP Sbjct: 1105 PPPLPSDSPPPPPPLPPSPPPATPPPPPPPLSPASPPPPPPPPLPSGPPPQPA-PPPPQP 1163 Query: 297 LPSP 308 P P Sbjct: 1164 APPP 1167 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/64 (46%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P PPPPPLSP ASPPP PP L PP P PPP + P P PP Sbjct: 1121 PSPPPATPPPPPPPLSP---ASPPPPPPPPLPSGPPPQPAPPPPQPAPPPLPTQAPPLPS 1177 Query: 297 LPSP 308 +P P Sbjct: 1178 IPPP 1181 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/63 (49%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = +3 Query: 132 RNYHPP----PPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRL 299 +N PP PPPL P PPP PPS PPP PPPPP P SP PPPP Sbjct: 1095 QNELPPLPDGPPPLPSDSPPPPPPLPPS----PPPATPPPPP----PPLSPASPPPPPPP 1146 Query: 300 PSP 308 P P Sbjct: 1147 PLP 1149 [141][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/52 (53%), Positives = 29/52 (55%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRL 299 PPPPP P PP PPP PP PPP PPPPP P P PPPP +L Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQL 84 [142][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/50 (54%), Positives = 27/50 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 PPPPP P PP PPP PP PPP PPPPP P P PPP S Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57 [143][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [144][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/52 (51%), Positives = 28/52 (53%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRL 299 PPPPP P PP PPP PP PPP PPPPP P P PPPP + Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHI 59 [145][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/55 (54%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ P P PPS PPP PP PP P SP PPPP+ P P Sbjct: 154 PPPPPPSPPPPSPPSPPPPS----PPPPPPPSPPPPSPPPPSPSPPPPPASPPPP 204 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP P SP PP+ PPP PPS PPP PPP P P SP PPPP LP P Sbjct: 162 PPPSPPSPPPPSPPPPPPPSP---PPPSPPPPSPSPPPPPASP--PPPPPALPYP 211 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP PP+ PPP PPS PPP PPPPP PS P PPPPS P P Sbjct: 153 PPPPP----PPSPPPPSPPSP---PPPSPPPPPP----PSPPPPSPPPPSPSPPP 196 [146][TOP] >UniRef100_UPI000150401A hypothetical protein MGG_07033 n=1 Tax=Magnaporthe grisea 70-15 RepID=UPI000150401A Length = 645 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/57 (54%), Positives = 31/57 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGY G GY GGGGG YGGG GYGGG G YG GGG W Sbjct: 597 GGGGGGFSGGGYGGGGGGY---GGGGGGYGGG------GYGGGGGGSYGNPGGGQSW 644 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/62 (51%), Positives = 34/62 (54%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREGGGG------YSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG GR GGGG + G G + GGGGG GGG GGYGGG GGYG G G Sbjct: 570 GGGGRGRGGGGNRDFRKFGGGGGGGFNGGGGGGFSGGGYGGGGGGYGGG-GGGYGGGGYG 628 Query: 148 GG 143 GG Sbjct: 629 GG 630 [147][TOP] >UniRef100_UPI0000E491FD PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E491FD Length = 116 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY---GGGEAGGYGESGGGGG 143 GG G GGG G GYSS GGGGG GG GGY GGG GG G+SGGGGG Sbjct: 27 GGGGSGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGG 85 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG G GYSS GGGGG GG GGY G GG G GGGGG Sbjct: 48 GGGGGGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGGGGGGGGGGG 103 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG G G S GGGG S GGG GG GGG GG G+SGGGGG Sbjct: 61 GGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGG---GGGGGGGGGGGGGDSGGGGG 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG G G S GGGG S GGG GG GG GGY GGGGG Sbjct: 40 GGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGGG 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/56 (55%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG G GYSS GGGGG GGG GG GGG++GG GGGGG Sbjct: 69 GGGGGGGGGGDSGGGGGGYSSGGGGGGGGGGG-----GGGGGGDSGG----GGGGG 115 [148][TOP] >UniRef100_UPI0000E48A7F PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E48A7F Length = 944 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/58 (56%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDV--DGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G G++ GGGGG YGGGR GG GG +GGYG SGG GG Sbjct: 687 GGYGGGGGGGGYRGGYREGGWNRGGGGGGGYGGGR----GGGGGYNSGGYGGSGGYGG 740 Score = 53.1 bits (126), Expect = 9e-06 Identities = 35/70 (50%), Positives = 37/70 (52%), Gaps = 14/70 (20%) Frame = -1 Query: 310 GGDGRRE-------GGGGYS-----GDVDGYSSRGGGGGSYGGGRRKVEGGY--GGGEAG 173 GG GR + GGGGY GD G GGGGG Y GG R EGG+ GGG G Sbjct: 658 GGYGRYDDRRGGYGGGGGYRSGSDYGDRRGGYGGGGGGGGYRGGYR--EGGWNRGGGGGG 715 Query: 172 GYGESGGGGG 143 GYG GGGG Sbjct: 716 GYGGGRGGGG 725 [149][TOP] >UniRef100_A5GHM5 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. WH 7803 RepID=A5GHM5_SYNPW Length = 207 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/62 (51%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKV------EGGYGGGEAGGYGESGGG 149 GG G R GGGGY+ G RGGGGG GGG R+ + YGGG +GG G GGG Sbjct: 96 GGGGYRGGGGGYNDGGGGGGYRGGGGGYGGGGERRSGARGWEDRSYGGGASGGGGGYGGG 155 Query: 148 GG 143 GG Sbjct: 156 GG 157 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/56 (53%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYS-SRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G R GGGGY G + S +RG SYGGG GGYGGG G Y + GGGG Sbjct: 112 GGGGYRGGGGGYGGGGERRSGARGWEDRSYGGGASGGGGGYGGG-GGSYSDGGGGG 166 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/72 (45%), Positives = 35/72 (48%), Gaps = 16/72 (22%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGG----SYGGGRRKVEGGYGGG------------EA 176 G R GGGGY G G RGGGGG GGG R GGYGGG + Sbjct: 81 GSAPRRGGGGYGGGGGGGGYRGGGGGYNDGGGGGGYRGGGGGYGGGGERRSGARGWEDRS 140 Query: 175 GGYGESGGGGGW 140 G G SGGGGG+ Sbjct: 141 YGGGASGGGGGY 152 [150][TOP] >UniRef100_A1TWH4 RNP-1-like RNA-binding protein n=1 Tax=Acidovorax citrulli AAC00-1 RepID=A1TWH4_ACIAC Length = 176 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/59 (54%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG----EAGGYGESGGGG 146 GG GGGGY G G GGGGG YGGGR GGYGGG GGYG G GG Sbjct: 90 GGGFGGGGGGGYGGGRSGGGYGGGGGGGYGGGRGDGGGGYGGGRGGDSGGGYGGRGDGG 148 [151][TOP] >UniRef100_Q8RW11 Putative glycine rich protein n=1 Tax=Rumex obtusifolius RepID=Q8RW11_RUMOB Length = 168 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/57 (54%), Positives = 31/57 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G GY GGGGG YGGGRR EGGYGGG Y W Sbjct: 115 GGGGYGGGGGGYGGGGGGY---GGGGGGYGGGRR--EGGYGGGGGDRYARGNSDSDW 166 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/56 (58%), Positives = 35/56 (62%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG R GGGGY G +G +RGGGGG GGG GGYGGG GGYG GGG G Sbjct: 92 GGGYRGGGGGGYGGRREGGYNRGGGGGYGGGG-----GGYGGG-GGGYGGGGGGYG 141 Score = 56.6 bits (135), Expect = 8e-07 Identities = 36/62 (58%), Positives = 36/62 (58%), Gaps = 7/62 (11%) Frame = -1 Query: 310 GGDGRREGG------GGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG-EAGGYGESGG 152 G GRREGG GGY G GY GGGGG YGGG GGYGGG GGYG GG Sbjct: 102 GYGGRREGGYNRGGGGGYGGGGGGY---GGGGGGYGGGG----GGYGGGRREGGYG--GG 152 Query: 151 GG 146 GG Sbjct: 153 GG 154 [152][TOP] >UniRef100_Q6ASX7 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ASX7_ORYSJ Length = 162 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/57 (54%), Positives = 33/57 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G G GGGGG YG + EGGYGGG G G GGGGG+ Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYG----RREGGYGGGGGYGGGRGGGGGGY 144 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/58 (53%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG----GGGGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG G GGGGY G G R GGGG YGGGR GGYGG GGYG GG Sbjct: 101 GGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGG 158 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/57 (57%), Positives = 34/57 (59%), Gaps = 4/57 (7%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGES----GGGGGW 140 RR GGGG GY GGGGG YGGGR GGYGGG GGYG GGGGG+ Sbjct: 87 RRSGGGG-----GGY---GGGGGGYGGGRGG--GGYGGGGGGGYGRREGGYGGGGGY 133 [153][TOP] >UniRef100_Q40427 RNA-binding glycine-rich protein-1b n=1 Tax=Nicotiana sylvestris RepID=Q40427_NICSY Length = 148 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/60 (60%), Positives = 37/60 (61%), Gaps = 5/60 (8%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRK-VEGGYGGGE----AGGYGESGGGGG 143 G GRREGGGG GY GGGGG YGGGRR+ GGYGGG GGYG G GGG Sbjct: 95 GGGRREGGGG------GY---GGGGGGYGGGRREGGGGGYGGGRREGGGGGYGGGGYGGG 145 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/54 (59%), Positives = 32/54 (59%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG G GGGGY G R GGGG YGGGRR EGG GG GGYG GGG Sbjct: 102 GGGGYGGGGGGYGG-----GRREGGGGGYGGGRR--EGGGGGYGGGGYG--GGG 146 [154][TOP] >UniRef100_O48567 Glycine-rich RNA-binding protein n=1 Tax=Euphorbia esula RepID=O48567_EUPES Length = 164 Score = 61.2 bits (147), Expect = 3e-08 Identities = 35/58 (60%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG--ESGGGGGW 140 G G GGGGYS RGGGGG YGGG R+ EGGYGGG GGY SGGGGG+ Sbjct: 87 GSGGGGGGGGYS--------RGGGGGGYGGGGRR-EGGYGGG-GGGYNSRSSGGGGGY 134 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/61 (55%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG-GGGGSYGGGRRKVEGGYGGGEAGGYGESGGG---GG 143 GG GRREGG Y G GY+SR GGGG YGGGR + GYGGG G GGG G Sbjct: 107 GGGGRREGG--YGGGGGGYNSRSSGGGGGYGGGR---DQGYGGGGGGSRYSRGGGESDGN 161 Query: 142 W 140 W Sbjct: 162 W 162 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG R GGGGY G GGGGG Y GGYGGG GYG GGGGG Sbjct: 95 GGYSRGGGGGGYGGGGRREGGYGGGGGGYNSRSSGGGGGYGGGRDQGYG--GGGGG 148 [155][TOP] >UniRef100_O22384 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22384_ORYSA Length = 162 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/57 (54%), Positives = 33/57 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G G GGGGG YG + EGGYGGG G G GGGGG+ Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYG----RREGGYGGGGGYGGGRGGGGGGY 144 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/58 (53%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG----GGGGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG G GGGGY G G R GGGG YGGGR GGYGG GGYG GG Sbjct: 101 GGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSGG 158 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/57 (57%), Positives = 34/57 (59%), Gaps = 4/57 (7%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGES----GGGGGW 140 RR GGGG GY GGGGG YGGGR GGYGGG GGYG GGGGG+ Sbjct: 87 RRSGGGG-----GGY---GGGGGGYGGGRGG--GGYGGGGGGGYGRREGGYGGGGGY 133 [156][TOP] >UniRef100_C5YSY6 Putative uncharacterized protein Sb08g022740 n=1 Tax=Sorghum bicolor RepID=C5YSY6_SORBI Length = 165 Score = 61.2 bits (147), Expect = 3e-08 Identities = 35/56 (62%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GRR+GGGG GY GGGGG YGGGR GGYGGG GGYG GGG G Sbjct: 106 GGYGRRDGGGG------GY---GGGGGGYGGGR----GGYGGG-GGGYGGGGGGYG 147 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/57 (54%), Positives = 31/57 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGGY G GY GGGGG YGGG GGYGGG GG G G W Sbjct: 114 GGGGYGGGGGGYGGGRGGY---GGGGGGYGGG----GGGYGGGSRGGGGYGNSDGNW 163 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/53 (54%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = -1 Query: 289 GGGGYSGDVDG---YSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GGGGY G G Y R GGGG YGGG GG GG GG G GGGGG+ Sbjct: 94 GGGGYGGGRGGGGGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGGGYGGGGGGY 146 [157][TOP] >UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO Length = 510 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/55 (58%), Positives = 32/55 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGGY G GY G GGG YGGG GGYGGG GGYG G GGG Sbjct: 300 GGGGYGGGGGYGGG-GGYGGGGYGGGGYGGGN----GGYGGGGNGGYGGGGYGGG 349 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GGY G GY GGG G YGGG GGYGGG GG+G G GGG Sbjct: 342 GGGGYGGGNGGYGGGGGGYGGGGGGYGGYGGG-----GGYGGG--GGFGSGGYGGG 390 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/57 (56%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY-GGGEAGGYGESGGGGG 143 GG G GGGGY G G GGG G YGGG GGY GGG GG G GGGGG Sbjct: 305 GGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGG---NGGYGGGGYGGGNGGYGGGGG 358 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/62 (53%), Positives = 34/62 (54%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGG---GGGSYGGGRRKVEGGYG--GGEAGGYGESGGGG 146 GG G GGGGY G GY G GGG YGGG GG G GG GGYG GGGG Sbjct: 317 GGGGY--GGGGYGGGNGGYGGGGNGGYGGGGYGGGNGGYGGGGGGYGGGGGGYGGYGGGG 374 Query: 145 GW 140 G+ Sbjct: 375 GY 376 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/62 (51%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKV-----EGGYGGGEAGGYGESGGGG 146 GG GGGGY G GY GGGGG YGGG GGYGGG G G GGGG Sbjct: 335 GGGNGGYGGGGYGGGNGGY---GGGGGGYGGGGGGYGGYGGGGGYGGGGGFGSGGYGGGG 391 Query: 145 GW 140 G+ Sbjct: 392 GY 393 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/52 (55%), Positives = 30/52 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESG 155 G G GGGGY G GY GGGGG YGGG GGYGGG GGY +G Sbjct: 349 GNGGYGGGGGGYGGGGGGYGGYGGGGG-YGGGGGFGSGGYGGG--GGYSPAG 397 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGY G Y G GGG YGGG GGYGGG GGYG G GGG Sbjct: 280 GGMGR----GGYGGHGSPYGGGGYGGGGYGGG-----GGYGGG--GGYGGGGYGGG 324 [158][TOP] >UniRef100_B9PW07 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii GT1 RepID=B9PW07_TOXGO Length = 508 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/55 (58%), Positives = 32/55 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGGY G GY G GGG YGGG GGYGGG GGYG G GGG Sbjct: 298 GGGGYGGGGGYGGG-GGYGGGGYGGGGYGGGN----GGYGGGGNGGYGGGGYGGG 347 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GGY G GY GGG G YGGG GGYGGG GG+G G GGG Sbjct: 340 GGGGYGGGNGGYGGGGGGYGGGGGGYGGYGGG-----GGYGGG--GGFGSGGYGGG 388 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/57 (56%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGY-GGGEAGGYGESGGGGG 143 GG G GGGGY G G GGG G YGGG GGY GGG GG G GGGGG Sbjct: 303 GGGGGYGGGGGYGGGGYGGGGYGGGNGGYGGGG---NGGYGGGGYGGGNGGYGGGGG 356 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/62 (53%), Positives = 34/62 (54%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGG---GGGSYGGGRRKVEGGYG--GGEAGGYGESGGGG 146 GG G GGGGY G GY G GGG YGGG GG G GG GGYG GGGG Sbjct: 315 GGGGY--GGGGYGGGNGGYGGGGNGGYGGGGYGGGNGGYGGGGGGYGGGGGGYGGYGGGG 372 Query: 145 GW 140 G+ Sbjct: 373 GY 374 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/62 (51%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKV-----EGGYGGGEAGGYGESGGGG 146 GG GGGGY G GY GGGGG YGGG GGYGGG G G GGGG Sbjct: 333 GGGNGGYGGGGYGGGNGGY---GGGGGGYGGGGGGYGGYGGGGGYGGGGGFGSGGYGGGG 389 Query: 145 GW 140 G+ Sbjct: 390 GY 391 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/52 (55%), Positives = 30/52 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESG 155 G G GGGGY G GY GGGGG YGGG GGYGGG GGY +G Sbjct: 347 GNGGYGGGGGGYGGGGGGYGGYGGGGG-YGGGGGFGSGGYGGG--GGYSPAG 395 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG-GGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GR GGY G Y G GGGG YGGG GGYGGG GG G GG GG+ Sbjct: 283 GGMGR----GGYGGHGSPYGGGGYGGGGGYGGG-----GGYGGGGYGGGGYGGGNGGY 331 [159][TOP] >UniRef100_P27484 Glycine-rich protein 2 n=1 Tax=Nicotiana sylvestris RepID=GRP2_NICSY Length = 214 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/70 (47%), Positives = 33/70 (47%), Gaps = 14/70 (20%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG--------------GGGGSYGGGRRKVEGGYGGGEAG 173 GG G GGGGY G GY G GGGG YGGG R GG G G G Sbjct: 87 GGGGGGRGGGGYGGGSGGYGGGGRGGSRGYGGGDGGYGGGGGYGGGSRYGGGGGGYGGGG 146 Query: 172 GYGESGGGGG 143 GYG G GGG Sbjct: 147 GYGGGGSGGG 156 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/53 (56%), Positives = 31/53 (58%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G R GGGG G G GGG G YGGG R GYGGG+ GGYG GG GG Sbjct: 82 GGRGGGGGGGG--RGGGGYGGGSGGYGGGGRGGSRGYGGGD-GGYGGGGGYGG 131 Score = 54.7 bits (130), Expect = 3e-06 Identities = 35/72 (48%), Positives = 36/72 (50%), Gaps = 16/72 (22%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGG-GEAGGYG---------- 164 GGDG GGGGY G S GGGGG YGGG GGYGG G GG G Sbjct: 118 GGDGGYGGGGGYGGG----SRYGGGGGGYGGG-----GGYGGGGSGGGSGCFKCGESGHF 168 Query: 163 -----ESGGGGG 143 +SGGGGG Sbjct: 169 ARDCSQSGGGGG 180 [160][TOP] >UniRef100_A4RHF1 ATP-dependent RNA helicase DED1 n=1 Tax=Magnaporthe grisea RepID=DED1_MAGGR Length = 671 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/57 (54%), Positives = 31/57 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGY G GY GGGGG YGGG GYGGG G YG GGG W Sbjct: 623 GGGGGGFSGGGYGGGGGGY---GGGGGGYGGG------GYGGGGGGSYGNPGGGQSW 670 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/62 (51%), Positives = 34/62 (54%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREGGGG------YSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG GR GGGG + G G + GGGGG GGG GGYGGG GGYG G G Sbjct: 596 GGGGRGRGGGGNRDFRKFGGGGGGGFNGGGGGGFSGGGYGGGGGGYGGG-GGGYGGGGYG 654 Query: 148 GG 143 GG Sbjct: 655 GG 656 [161][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPS 305 PPPPP P PP PPP PP + PPP PPPPP P P PPPP P+ Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPA 412 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PPS PPP PPPPP P P PPPP P P Sbjct: 360 PPPPPPPPPPPPPPPPPPPSP---PPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP----PPPPPPPPPPPPPPPPP 408 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/64 (46%), Positives = 31/64 (48%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ P PPP P PP PPP PP PPP PPPPP P P PPPP Sbjct: 347 PPPSANPCQPCPPPPPPPPPPPPPPPPPP----PPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Query: 297 LPSP 308 P P Sbjct: 403 PPPP 406 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/55 (47%), Positives = 27/55 (49%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP +P P PPP PP PPP PPPP P P PPPP P P Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 [162][TOP] >UniRef100_UPI0001868875 hypothetical protein BRAFLDRAFT_103538 n=1 Tax=Branchiostoma floridae RepID=UPI0001868875 Length = 211 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPY-PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP++P PP +PPP PP + PPP PPPPP+ P P+ PPPP P P Sbjct: 11 PPPPIAPPPPIAPPPMDPPPPMDPPPPVAPPPPPIAPPP---PIAPPPPIAPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PP-ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP++P PP A PPP P PPP PPPPP+ P P P PP P P Sbjct: 40 PPPPPIAPPPPIAPPPPIAPPPPMDPPPMAPPPPPMAPPPPPPPAAPAPPVPAPDP 95 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYP--PSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP+ P PP +PPP P P PPP + PPPP++ P+ PPPP P P Sbjct: 28 PPPPMDPPPPVAPPPPPIAPPPPIAPPPPIAPPPPMD----PPPMAPPPPPMAPPP 79 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/64 (43%), Positives = 32/64 (50%), Gaps = 10/64 (15%) Frame = +3 Query: 147 PPPPLSP*PPASPPPY-PPSTLRLPPP*LPP---------PPPLEE*PSTSPLYPPPPSR 296 PPPP++P PP PPP PP PPP PP P P PS +P+ PPPP Sbjct: 53 PPPPIAPPPPMDPPPMAPPPPPMAPPPPPPPAAPAPPVPAPDPTPAPPSITPVPPPPPPA 112 Query: 297 LPSP 308 P P Sbjct: 113 APPP 116 [163][TOP] >UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S5R2_RICCO Length = 210 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/53 (56%), Positives = 32/53 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP+ PPP PP PPP PPPP P +S L PPPPS P Sbjct: 44 PPPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTS--PPSSLLSPPPPSPPP 94 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/62 (48%), Positives = 32/62 (51%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPPP P P PP PPS+L PPP PPPP P P PPPPS Sbjct: 54 PSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSSPPPPP--PPPPSS 111 Query: 297 LP 302 P Sbjct: 112 PP 113 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/61 (50%), Positives = 33/61 (54%), Gaps = 7/61 (11%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-------PLEE*PSTSPLYPPPPSRLP 302 PPPPP SP PP PP PPS+L PPP PPPP P P +SP PPP P Sbjct: 65 PPPPPPSPSPP--PPTSPPSSLLSPPPPSPPPPASSSSPPPPPPPPPSSPPPSPPPPPTP 122 Query: 303 S 305 S Sbjct: 123 S 123 [164][TOP] >UniRef100_B7QDE3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QDE3_IXOSC Length = 908 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/53 (52%), Positives = 30/53 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PS +PPP PPPPP P +P PPPP P Sbjct: 739 PPPPPPPPPPPPPPPPPCPSVGSIPPPPPPPPPPPTGVPCVAPPAPPPPPVAP 791 [165][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/60 (53%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPP-PPPLEE*PSTSPLYPPPPS 293 P P+ PPPPP P PP SPPP PP PPP PP P P + PS SP PPPPS Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPS 315 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/65 (46%), Positives = 34/65 (52%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P+P + PP PP SP PP+ PPP P PPP PPPPP P P PPPP Sbjct: 232 SPQPT-ASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Query: 294 RLPSP 308 P P Sbjct: 291 PPPPP 295 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/69 (46%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = +3 Query: 114 NPKPN*RNYHPPPP----PLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP 281 +P P+ R PPPP P P PP PPP PP + PPP PPPPP PS SP Sbjct: 243 SPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRK 302 Query: 282 PPPSRLPSP 308 PP P P Sbjct: 303 PPSPSPPVP 311 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/64 (50%), Positives = 32/64 (50%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P P PPP SP PP PPP PP PPP PPPPP P P PPPP Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPPPPPPP--PPPPPSPPPPP----PPPPPPPPPPPPP 295 Query: 297 LPSP 308 PSP Sbjct: 296 SPSP 299 [166][TOP] >UniRef100_UPI000180C465 PREDICTED: similar to cold-inducible RNA-binding protein n=1 Tax=Ciona intestinalis RepID=UPI000180C465 Length = 167 Score = 60.8 bits (146), Expect = 4e-08 Identities = 34/56 (60%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R GGG Y G GY GGGGG YGGG GGYGGG GGYG GG GG Sbjct: 91 GGYGGRGGGGRYGGGGGGY---GGGGGGYGGG----GGGYGGG-GGGYGGGGGYGG 138 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/57 (63%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRR-EGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGGY G GY GGGGG YGGG GGYGGG GGYG GGGGG Sbjct: 97 GGGGRYGGGGGGYGGGGGGY---GGGGGGYGGG----GGGYGGG--GGYG--GGGGG 142 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/65 (50%), Positives = 33/65 (50%), Gaps = 9/65 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAG---------GYGES 158 GG G GGGGY G GY GGGGG YGGG GGYGGG G G Sbjct: 105 GGGGYGGGGGGYGGGGGGY---GGGGGGYGGG-----GGYGGGGGGRRYNDDNYSGGDYR 156 Query: 157 GGGGG 143 GGGGG Sbjct: 157 GGGGG 161 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/49 (61%), Positives = 30/49 (61%) Frame = -1 Query: 289 GGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGGGY G G GGGGG YGGG GGYGGG GGYG GGG G Sbjct: 89 GGGGYGGRGGG-GRYGGGGGGYGGG----GGGYGGG-GGGYGGGGGGYG 131 [167][TOP] >UniRef100_UPI0000E48095 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E48095 Length = 971 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGG G DG GG GG GGG GG GGG GG G +GGGGG Sbjct: 80 GGDGGGNGGGDGDGGGDGGGDGGGDGGGDGGGDGGGNGGRGGGNGGGGGRNGGGGG 135 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG +GGG GD G RGGG G GGGR GG GGG GG G GGG G Sbjct: 98 GGDGGGDGGGDGGGDGGGNGGRGGGNGG-GGGR---NGGGGGGNGGGGGNGGGGDG 149 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/62 (50%), Positives = 35/62 (56%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGR-REGGGGYSGDVDGYSSRGGG-----GGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GGDG R+GGGG G DG GGG GG GGG +GG GG+ G G+ GGG Sbjct: 146 GGDGGGRDGGGGDGGGGDGGGGDGGGDGGGDGGGDGGGDGGGDGGGDGGDGGDGGDGGGG 205 Query: 148 GG 143 GG Sbjct: 206 GG 207 [168][TOP] >UniRef100_UPI0000DA1CBA PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1CBA Length = 200 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/56 (53%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGG G DG GGGGG GGG +GG GGG+ GG G+ GG GG Sbjct: 80 GGGGGCDGGGGGGGGGDGGGGGGGGGGGGGGG----DGGRGGGDGGGGGDGGGDGG 131 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/56 (55%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGG G DG GGGGG GGG GG GGG+ GG G GGGGG Sbjct: 58 GGGGGCDGGGGGGGGGDGGGGGGGGGGCDGGG-----GGGGGGDGGGGGGGGGGGG 108 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/56 (55%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG R GG G GD G GG GG GGG +GG GGG+ GG G GGGGG Sbjct: 137 GGDGGRGGGDGGGGD--GGGGDGGRGGGDGGGGGGGDGGRGGGDGGGGGGDGGGGG 190 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G DG GGGGG GGG GG GGG+ G G GGGGG Sbjct: 70 GGGGDGGGGGGGGGGCDG-GGGGGGGGDGGGGGGGGGGGGGGGDGGRGGGDGGGGG 124 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GG GG GGR +GG GGG GG G GGGG Sbjct: 127 GGDGGGGGGGGGDGGRGGGDGGGGDGGGGDGGRGGGDGGGGGGGDGGRGGGDGGGG 182 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGD GGGG GD DG GGGGG GGG +GG GGG G G GGGGG Sbjct: 33 GGDDGGGGGGGGGGD-DG----GGGGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGG 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG R GG G G G GGGGG GGR GG GGG GG G+ G GGG Sbjct: 110 GGDGGRGGGDGGGGGDGGGDGGGGGGGGGDGGR---GGGDGGGGDGGGGDGGRGGG 162 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/56 (50%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG D G GG GG GGG +GG GGG G G GGGGG Sbjct: 50 GGGGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGGGCDGGGGGGGGGDGGGGGGGGG 105 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G RGGG G GG GG GGG GG G+ G GGG Sbjct: 94 GGDGGGGGGGGGGGGGGGDGGRGGGDGGGGGD----GGGDGGGGGGGGGDGGRGGG 145 [169][TOP] >UniRef100_UPI0000222152 Hypothetical protein CBG17212 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000222152 Length = 161 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/58 (56%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVD---GYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GGD GGGGY G D GY G GG YGGG + GGYGGG GGYG GGGG Sbjct: 29 GGDMGGYGGGGYGGGGDMGGGYGGGGDMGGGYGGGG-DMGGGYGGGGDGGYGGYGGGG 85 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/63 (49%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDG-YSSRGGGGGSYGGGRRKVEGGYGGG-------EAGGYGESG 155 GG G GG G GD+ G Y G GG YGGG GGYGGG GGYG G Sbjct: 41 GGGGDMGGGYGGGGDMGGGYGGGGDMGGGYGGGGDGGYGGYGGGGYGAGGDMGGGYGMGG 100 Query: 154 GGG 146 GGG Sbjct: 101 GGG 103 Score = 53.1 bits (126), Expect = 9e-06 Identities = 32/60 (53%), Positives = 37/60 (61%), Gaps = 3/60 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG-GSYGGGRRK--VEGGYGGGEAGGYGESGGGGGW 140 GGDG GGGGY G++ G + GGGG GSY GG + +GGYGG GG GG GGW Sbjct: 102 GGDGGY-GGGGYGGNMGGGNMGGGGGYGSYQGGPQPGGGQGGYGGQPYGG----GGQGGW 156 [170][TOP] >UniRef100_C0H8U7 Cold-inducible RNA-binding protein n=1 Tax=Salmo salar RepID=C0H8U7_SALSA Length = 193 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGG---SYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 G GR GGGGY G GY R GGG SYGGG R GG G GG G S GGGG+ Sbjct: 112 GGGRGRGGGGYGGGDRGYGERSYGGGGDRSYGGGDRSYGGGGGYRSGGGGGYSSGGGGY 170 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG-GGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G R GGGG G G GGGG YGGGR + GGYGGG+ GYGE GGG Sbjct: 82 GKGGGRSGGGGGGGFRGSRGGGGYGGGGGYGGGRGRGGGGYGGGDR-GYGERSYGGG 137 [171][TOP] >UniRef100_A9B9L1 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9211 RepID=A9B9L1_PROM4 Length = 245 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/57 (54%), Positives = 33/57 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G G GGY G G GGG G YGGG +GGYGGG GGYG G GGG+ Sbjct: 119 GGYGGGGGQGGYGGGGQGGYGGGGGQGGYGGGG---QGGYGGGGQGGYGGGGYGGGY 172 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G GGGG G GY GGG G YGGG +GGYGGG GGYG GG GG+ Sbjct: 94 GGYGGGYGGGGQGGYGGGYGG-GGGQGGYGGGGG--QGGYGGGGQGGYGGGGGQGGY 147 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/61 (50%), Positives = 33/61 (54%), Gaps = 4/61 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESG----GGGG 143 GG G G GGY G GGG G YGGG +GGYGGG GGYG G GGGG Sbjct: 110 GGYGGGGGQGGYGGGGGQGGYGGGGQGGYGGGGG--QGGYGGGGQGGYGGGGQGGYGGGG 167 Query: 142 W 140 + Sbjct: 168 Y 168 [172][TOP] >UniRef100_Q41518 Single-stranded nucleic acid binding protein n=1 Tax=Triticum aestivum RepID=Q41518_WHEAT Length = 167 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/57 (57%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDG-YSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G G Y + GGGG YGGG GGYGGG GGYG GGGG Sbjct: 109 GGGGYGGGGGGYGGQGGGGYGGQRGGGGGYGGG-----GGYGGG--GGYGGQRGGGG 158 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/51 (60%), Positives = 32/51 (62%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 RR GGGG G GY + GGGG YGGG GGYGGG GGYG GGGG Sbjct: 85 RRSGGGGGGGG--GYGGQRGGGGGYGGG-----GGYGGG-GGGYGGQGGGG 127 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/63 (55%), Positives = 37/63 (58%), Gaps = 7/63 (11%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYG-------GGRRKVEGGYGGGEAGGYGESGG 152 G G+R GGGGY G GY GGGGG YG GG+R GGYGGG GGYG GG Sbjct: 96 GYGGQRGGGGGYGGG-GGY---GGGGGGYGGQGGGGYGGQRGGGGGYGGG--GGYGGGGG 149 Query: 151 GGG 143 GG Sbjct: 150 YGG 152 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/58 (55%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGY-GESGGGGGW 140 GG G GGGGY G G GGGGG GGG GGYGG GGY G+ GGGGG+ Sbjct: 89 GGGG---GGGGYGGQRGGGGGYGGGGGYGGGG-----GGYGGQGGGGYGGQRGGGGGY 138 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/53 (54%), Positives = 31/53 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGG 152 GG +GGGGY G G GGGGG YGGG GGYGG GG G+SGG Sbjct: 117 GGGYGGQGGGGYGGQRGGGGGYGGGGG-YGGG-----GGYGGQRGGGGGDSGG 163 [173][TOP] >UniRef100_Q40052 Glycine rich protein, RNA binding protein n=1 Tax=Hordeum vulgare RepID=Q40052_HORVU Length = 173 Score = 60.8 bits (146), Expect = 4e-08 Identities = 34/62 (54%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG------GSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG G GGGGY G GY +GGGG G YGG +R GGYGGG GGYG GGG Sbjct: 100 GGGGGYGGGGGYGGQGGGYGGQGGGGYGGQGGGGYGG-QRGGGGGYGGG-GGGYGGGGGG 157 Query: 148 GG 143 G Sbjct: 158 YG 159 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVE--GGYGGGEAGGYGESGGGGGW 140 G G+R GGGGY G GY +GGG G GGG + GGYGG GG G GGGGG+ Sbjct: 94 GYGGQRGGGGGYGGG-GGYGGQGGGYGGQGGGGYGGQGGGGYGGQRGGGGGYGGGGGGY 151 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/56 (55%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGD-VDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG +GGGGY G GY + GGGG YGGG GGYGGG GGYG GGG Sbjct: 115 GGGYGGQGGGGYGGQGGGGYGGQRGGGGGYGGG----GGGYGGG-GGGYGGQRGGG 165 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -1 Query: 289 GGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GGGGY G G GGGGG G G GGYGG GGYG GGGG Sbjct: 91 GGGGYGGQRGGGGGYGGGGGYGGQG-----GGYGGQGGGGYGGQGGGG 133 [174][TOP] >UniRef100_Q38M49 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum tuberosum RepID=Q38M49_SOLTU Length = 176 Score = 60.8 bits (146), Expect = 4e-08 Identities = 38/64 (59%), Positives = 38/64 (59%), Gaps = 9/64 (14%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG---------ESG 155 G GRREGGGG GYS GGGG YGGGRR EGGYGGG GGYG G Sbjct: 116 GGGRREGGGG-----GGYS---GGGGGYGGGRR--EGGYGGG-GGGYGGGDRYSDRSSRG 164 Query: 154 GGGG 143 GGGG Sbjct: 165 GGGG 168 Score = 57.0 bits (136), Expect = 6e-07 Identities = 35/64 (54%), Positives = 35/64 (54%), Gaps = 8/64 (12%) Frame = -1 Query: 310 GGDG----RREGGGGYSGDVDGYSS---RGGGGGSYGGGRRKVEGGYGGGEA-GGYGESG 155 GG G RREGGGG G GY GGGGG Y GG GGYGGG GGYG G Sbjct: 93 GGGGYVRWRREGGGGGYGGGGGYGGGRREGGGGGGYSGGG----GGYGGGRREGGYGGGG 148 Query: 154 GGGG 143 GG G Sbjct: 149 GGYG 152 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Frame = -1 Query: 310 GGDGRREGGGGY-----SGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 GG G GGGGY G GY GGGG YGGGRR EGG GGG +GG G GGG Sbjct: 86 GGGGGGRGGGGYVRWRREGGGGGY----GGGGGYGGGRR--EGGGGGGYSGGGGGYGGG 138 [175][TOP] >UniRef100_Q2VCI6 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum tuberosum RepID=Q2VCI6_SOLTU Length = 178 Score = 60.8 bits (146), Expect = 4e-08 Identities = 38/64 (59%), Positives = 38/64 (59%), Gaps = 9/64 (14%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYG---------ESG 155 G GRREGGGG GYS GGGG YGGGRR EGGYGGG GGYG G Sbjct: 118 GGGRREGGGG-----GGYS---GGGGGYGGGRR--EGGYGGG-GGGYGGGDRYSDRSSRG 166 Query: 154 GGGG 143 GGGG Sbjct: 167 GGGG 170 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/60 (55%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGE---AGGYGESGGGGGW 140 GG G GGGGY G R GGGG YGGG GGYGGG GG G SGGGGG+ Sbjct: 88 GGGGGGRGGGGYGG-----GRREGGGGGYGGG-----GGYGGGRREGGGGGGYSGGGGGY 137 [176][TOP] >UniRef100_Q2QLR2 Os12g0632000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QLR2_ORYSJ Length = 162 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/56 (62%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G+R GGGGY G GY GGGGG YG R EGGYGGG GGYG GGGG Sbjct: 95 GGYGQRGGGGGYGGG-GGYG--GGGGGGYGQRR---EGGYGGG--GGYGGGRGGGG 142 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/58 (56%), Positives = 35/58 (60%), Gaps = 5/58 (8%) Frame = -1 Query: 298 RREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGES-----GGGGGW 140 RR GGGG G Y RGGGGG YGGG GGYGGG GGYG+ GGGGG+ Sbjct: 87 RRSGGGGGGG----YGQRGGGGG-YGGG-----GGYGGGGGGGYGQRREGGYGGGGGY 134 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/64 (50%), Positives = 32/64 (50%), Gaps = 7/64 (10%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG----GGGGSYGGGRRKVEGGYGGGEAGGYGESGGG-- 149 GG G GGG G GY R GGGG YGGGR G GGG GGYG GGG Sbjct: 102 GGGGYGGGGGYGGGGGGGYGQRREGGYGGGGGYGGGR-----GGGGGYGGGYGSRGGGNS 156 Query: 148 -GGW 140 G W Sbjct: 157 DGNW 160 [177][TOP] >UniRef100_Q04130 Glycine-rich protein (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q04130_SOLLC Length = 82 Score = 60.8 bits (146), Expect = 4e-08 Identities = 38/71 (53%), Positives = 38/71 (53%), Gaps = 16/71 (22%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSR-------GGGGGSYGGGRRKVEGGYGGGEAGGYG----- 164 G GRREGGGG G GY G GGG YGGGRR EGGYGGG GGYG Sbjct: 7 GGGRREGGGGGYGGGGGYGGGRREGGGGGYGGGGYGGGRR--EGGYGGG-GGGYGGGDRY 63 Query: 163 ----ESGGGGG 143 GGGGG Sbjct: 64 NVRSSRGGGGG 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 8/57 (14%) Frame = -1 Query: 289 GGGGYSGD-VDGYSSRGGGGGSYGGGRRK-VEGGYGGG------EAGGYGESGGGGG 143 GGGGY G +G GGGG YGGGRR+ GGYGGG GGYG GGG G Sbjct: 2 GGGGYGGGRREGGGGGYGGGGGYGGGRREGGGGGYGGGGYGGGRREGGYGGGGGGYG 58 [178][TOP] >UniRef100_B7QJ08 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJ08_IXOSC Length = 129 Score = 60.8 bits (146), Expect = 4e-08 Identities = 37/78 (47%), Positives = 38/78 (48%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW*FL 131 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG L Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVL 62 Query: 130 *LGLGLPMNVLSLACYAS 77 L LG + AC S Sbjct: 63 HLVLGATACTVDPACRKS 80 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 [179][TOP] >UniRef100_A7SMB3 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SMB3_NEMVE Length = 218 Score = 60.8 bits (146), Expect = 4e-08 Identities = 34/61 (55%), Positives = 34/61 (55%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGG-----GYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G R GGG GY G GY RG GGG YGGG GGYGGG GG G GGG Sbjct: 107 GGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYG-GGGYGGGGHGGGGYGGGGY 165 Query: 145 G 143 G Sbjct: 166 G 166 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/63 (55%), Positives = 35/63 (55%), Gaps = 7/63 (11%) Frame = -1 Query: 310 GGDGRREGGGGYSG---DVDGYSSRGGGGGSYGGGRRKVEGGYG----GGEAGGYGESGG 152 GG G R GGGGY G GY G GGG YGGG GGYG GG GGYG SG Sbjct: 119 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHG-GGGYGGGGYGGGGGGYGGSGY 177 Query: 151 GGG 143 GGG Sbjct: 178 GGG 180 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGG+ G G GGGGG YGG GGYGGG GG G SGGGG Sbjct: 146 GGGGY--GGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG-GRSGGGG 197 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/65 (53%), Positives = 36/65 (55%), Gaps = 9/65 (13%) Frame = -1 Query: 310 GGDGRREGG-GGYSGDVDGYSS----RGGGGGSYGG----GRRKVEGGYGGGEAGGYGES 158 GG GRR GG GG G GY S RGGGG GG GR + GGYGGG GG G Sbjct: 92 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 151 Query: 157 GGGGG 143 GGG G Sbjct: 152 GGGHG 156 [180][TOP] >UniRef100_Q99070 Glycine-rich RNA-binding protein 2 n=1 Tax=Sorghum bicolor RepID=GRP2_SORBI Length = 168 Score = 60.8 bits (146), Expect = 4e-08 Identities = 36/66 (54%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSR-----GGGGGSYGGGRRKVEGGYGGGE----AGGYGES 158 GG G GGGGY G GY R GGGGG YGG RR+ GGYGGG GGYG Sbjct: 88 GGGG---GGGGYGGGGGGYGGREGGGYGGGGGGYGG-RREGGGGYGGGGYGGGGGGYGGR 143 Query: 157 GGGGGW 140 GGGG+ Sbjct: 144 EGGGGY 149 Score = 60.1 bits (144), Expect = 7e-08 Identities = 36/59 (61%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGG--GGGW 140 G GRREGGGGY G GY GGGGG YGG R+ GGYGGG GGYG + G GG W Sbjct: 117 GYGGRREGGGGYGGG--GY---GGGGGGYGG--REGGGGYGGG--GGYGGNRGDSGGNW 166 [181][TOP] >UniRef100_UPI000198409E PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198409E Length = 478 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/64 (48%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ P PPP SP PP+ PPP PP PPP +P PPP PS PPPP+ Sbjct: 195 PTPSPPVVVPSPPPPSPPPPSPPPPSPPPPSPPPPPLIPSPPP----PSPLSPSPPPPAF 250 Query: 297 LPSP 308 LP P Sbjct: 251 LPPP 254 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/54 (50%), Positives = 30/54 (55%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP + P PP P P PP + PPP PPPP PS P PPPP +PSP Sbjct: 184 PPPTVVP-PPVLPTPSPPVVVPSPPPPSPPPPSPPP-PSPPPPSPPPPPLIPSP 235 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/68 (45%), Positives = 35/68 (51%), Gaps = 4/68 (5%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPP--PYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP--P 284 P P+ PPPPPL P PP P P PP LPPP PPPPPL P ++P Sbjct: 217 PPPSPPPPSPPPPPLIPSPPPPSPLSPSPPPPAFLPPP-SPPPPPLVPSPPPPAIFPWLS 275 Query: 285 PPSRLPSP 308 PP+ P P Sbjct: 276 PPADNPPP 283 [182][TOP] >UniRef100_UPI00017601ED PREDICTED: similar to Uncharacterized protein KIAA1522 homolog n=1 Tax=Danio rerio RepID=UPI00017601ED Length = 1501 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/73 (43%), Positives = 39/73 (53%), Gaps = 11/73 (15%) Frame = +3 Query: 123 PN*RNYHPPPPPLSP--------*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSP-- 272 PN +++ PPPPP SP PP PPP PP + PPP PPPPL+ P P Sbjct: 830 PNDKDFPPPPPPFSPKTLQSLPQLPPGIPPP-PPQAVPPPPPQAVPPPPLQAVPPPPPPQ 888 Query: 273 -LYPPPPSRLPSP 308 + PPPP +P P Sbjct: 889 AVPPPPPQAVPPP 901 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/67 (44%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +3 Query: 111 GNPKPN*RNYHPPPPPLSP*PP--ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP 284 G P P + PPPP P PP A PPP PP + PPP PPPP + P P Sbjct: 856 GIPPPPPQAVPPPPPQAVPPPPLQAVPPPPPPQAVPPPPPQAVPPPPPQAVPPPPAQAAP 915 Query: 285 PPSRLPS 305 PP LPS Sbjct: 916 PPLTLPS 922 [183][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/53 (52%), Positives = 28/53 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP P P P PPPPPL T P PPPP LP Sbjct: 437 PPPPPPPPPPPPPPPPLPGMRAAFPSPPPPPPPPLPNSAITIPAPPPPPPPLP 489 [184][TOP] >UniRef100_Q1EPA3 Protein kinase family protein n=1 Tax=Musa acuminata RepID=Q1EPA3_MUSAC Length = 648 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/64 (51%), Positives = 35/64 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P + PPPP LSP PPAS PP PPS PP PPPPP P + PPPPS Sbjct: 74 PAPPPPSVSPPPPALSP-PPASTPPRPPSA-SPPPAAAPPPPPPSATPPPTNSPPPPPSA 131 Query: 297 LPSP 308 P P Sbjct: 132 TPPP 135 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/70 (47%), Positives = 36/70 (51%), Gaps = 6/70 (8%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*L--PPPPPLEE*PSTSP----LY 278 P PN PPP P SP P + PPP PP +PPP + PPPP PS SP L Sbjct: 34 PAPN----APPPTPPSPPPASPPPPTPPPPADVPPPPVVTSPPPPAPPPPSVSPPPPALS 89 Query: 279 PPPPSRLPSP 308 PPP S P P Sbjct: 90 PPPASTPPRP 99 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/59 (49%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = +3 Query: 147 PPPPL--SP*PPASPPPY---PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP+ SP PPA PPP PP L PP PP PP P + PPPPS P P Sbjct: 63 PPPPVVTSPPPPAPPPPSVSPPPPALSPPPASTPPRPPSASPPPAAAPPPPPPSATPPP 121 [185][TOP] >UniRef100_Q00TR5 Homology to unknown gene n=1 Tax=Ostreococcus tauri RepID=Q00TR5_OSTTA Length = 1931 Score = 60.8 bits (146), Expect = 4e-08 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPP-STLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP SPPP PP S PPP PPP P P + P PPPPS PSP Sbjct: 1808 PPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPPSP 1863 [186][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/61 (49%), Positives = 33/61 (54%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 P P+ PPPPPL P PP PPP PP PPP PPPPP P P PPPP+ Sbjct: 17 PPPHCPPPPPPPPPLPPPPPPPPPPPPP-----PPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Query: 297 L 299 + Sbjct: 72 I 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 16 PPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/54 (51%), Positives = 29/54 (53%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPS 305 PPPPP P PP PPP PP PPP PPPPP P P PPPP P+ Sbjct: 23 PPPPPPPPLPPPPPPPPPPP----PPP--PPPPPPPPPPPPPPPPPPPPPPPPN 70 [187][TOP] >UniRef100_UPI0001982DB4 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982DB4 Length = 214 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 6/61 (9%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGG------GSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 G G GGGGY G GY GGGG G GGG + GGYGGG GG G GGGG Sbjct: 89 GGGGYGGGGGYGGGGGGYGYNGGGGRGGGRGGRGGGGGGRSSGGYGGGGYGGGGGYGGGG 148 Query: 145 G 143 G Sbjct: 149 G 149 Score = 53.1 bits (126), Expect = 9e-06 Identities = 35/71 (49%), Positives = 35/71 (49%), Gaps = 15/71 (21%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGG----YGE------ 161 GG GR G GG G G SS G GGG YGGG GGYGGG GG GE Sbjct: 110 GGGGRGGGRGGRGGGGGGRSSGGYGGGGYGGG-----GGYGGGGGGGACYNCGEEGHLAR 164 Query: 160 -----SGGGGG 143 SGGGGG Sbjct: 165 DCSQSSGGGGG 175 [188][TOP] >UniRef100_UPI00016C3DAE RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C3DAE Length = 144 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/55 (58%), Positives = 32/55 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGGY G G GGG G GGGRR GGYGGG GGYG GG G Sbjct: 88 GGGGYGGGGGGYGGGGGGGYGGGGGYGGGGGGRRGGGGGYGGG-GGGYGGGGGRG 141 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/56 (57%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = -1 Query: 295 REGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG----EAGGYGESGGGGGW 140 R GGGGY G GY GGGGG YGGG GGYGGG GG G GGGGG+ Sbjct: 86 RGGGGGYGGGGGGYG--GGGGGGYGGG-----GGYGGGGGGRRGGGGGYGGGGGGY 134 [189][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 223 GGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 278 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG GGG GG GGG GG G GGGGG Sbjct: 211 GGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGG 266 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG V GG GGG GG G GGGGG Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGG 185 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G V G GGGGG GGG GG GGG GG G GGGGG Sbjct: 150 GGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG GD G GGGGG GGG GG GGG GG G GGGGG Sbjct: 230 GGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 285 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 242 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 297 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G V G GGGGG GGG GG GGG GG G GGGGG Sbjct: 104 GGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG+ GG G GGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGG 237 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 238 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 293 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G SGGGGG Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGG 352 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGGS GGG GG GGG GG G GGGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 375 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G S GGGGG GGG GG GGG GG G GGGGG Sbjct: 327 GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 382 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G S GGGGG GGG GG GGG GG G GGGGG Sbjct: 328 GGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 383 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG SG G GGGGG GGG GG GGG GG G GGGGG Sbjct: 335 GGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 390 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 76 GGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGG 131 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 86 GGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGG 141 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGG 146 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGG 181 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 192 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 147 GGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 154 GGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 209 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 222 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G RGGGGG GGG GG GGG GG G GGGGG Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG---GGGDGGGRGGGGGGGGGGGG 241 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGG 353 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGG 359 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 366 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 313 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 368 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 341 GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 396 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 161 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 216 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG G G + GG GGG GG G+ GGGGG Sbjct: 195 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGG 250 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GR GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 226 GGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 280 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGG 355 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG +GG G GGGGG Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGG 358 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGG 363 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGG 367 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 314 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGG 369 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGG 370 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 374 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 381 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 329 GGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 384 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 386 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 387 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 333 GGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 388 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 336 GGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 391 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 342 GGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 397 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 343 GGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 398 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 345 GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 69 GGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG 124 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 75 GGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGG 130 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG V GG G G GG G GGGGG Sbjct: 84 GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGG 139 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 107 GGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGG 184 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGG 186 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG + GG GGG GG G+ GG GG Sbjct: 176 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGG 231 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 232 GGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 233 GGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 288 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 239 GGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 294 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 240 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 295 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 245 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 300 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 246 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 301 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 302 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 248 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 303 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 251 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 306 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 252 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 253 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 308 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 254 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 309 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 255 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 311 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 312 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 258 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 313 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 314 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 260 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 280 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 281 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 283 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 338 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 284 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 339 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 285 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 340 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 341 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 342 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 343 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 289 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 344 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 290 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 345 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 291 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 346 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 403 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 404 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 405 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 406 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 407 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 408 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 409 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 410 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 411 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 412 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 358 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 413 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 359 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 414 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 415 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 361 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 416 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 417 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 363 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 418 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 364 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 419 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 365 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 420 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 366 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 421 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 367 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 422 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 368 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 423 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 424 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 425 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 371 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 426 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 427 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 373 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 428 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 429 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 375 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 430 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 376 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 431 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 377 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 432 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 433 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 379 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 434 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 380 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 435 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 381 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 436 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 382 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 437 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 383 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 438 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 384 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 439 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 440 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 121 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGG 176 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGG 187 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 163 GGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 218 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 221 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGGR GG GGG GG G GGGG Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGG 233 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R GGGG G GGGGG GGGR GG GGG GG G GGGGG Sbjct: 205 GGGGGRGGGGGGGG--------GGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGG 252 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/59 (54%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDV---DGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GR GGGG G DG GGGGG GGG GG GGG GG G GGGGG Sbjct: 206 GGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGGG 264 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G R GG G G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 42 GGGGRGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGG 96 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG G G GGGGG GGG GG GGG +GG G GGGGG Sbjct: 47 GGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGG 101 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGG-----GGGGGGSGGGGGGGGGGGG 102 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGGS GGG G GGG GG G GGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGG 108 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G S GGGGG G G GG GGG GG G GGGGG Sbjct: 60 GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G S GGGGG GG GG GGG GG G GGGGG Sbjct: 61 GGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G GGGGGS GGG GG GGG GG G GGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG SG G GGGGG GGG GG G G GG G GGGGG Sbjct: 78 GGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGG 133 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 145 GGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 146 GGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 151 GGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 153 GGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 160 GGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 215 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGG 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGG 153 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GG GG G GGGGG Sbjct: 48 GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGG 103 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGG GGG GG GGG GG G GGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GG GG GGG GG GGG GG G GGGGG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 111 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 105 GGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 114 GGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGG-----GGGGGGGGGGGGGGGGGGG 164 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG G G GGGGG GGG GG GGG GG G SGGGGG Sbjct: 36 GCGGGSGGGGRGGGSGGGGGGGGGGGGGGGG-----GGGGGGGGGGGGGSGGGGG 85 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGG G GGG GG GGG GG G GGGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGG 110 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG G GGG GG G GGGGG Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGG 365 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G GGGGG GGG GG GGG GG G GGGGG Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 385 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 337 GGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 392 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GG G G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 393 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 339 GGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 394 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 340 GGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 395 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 344 GGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 399 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 346 GSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 401 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGG GGG GG GGG GG G GGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 152 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 113 GGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGG-----GGGGGGGGGGGGGGGGGGG 163 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 120 GGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGVGGGGGG 171 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GG GG G GGGGG Sbjct: 85 GGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGGGGGGGGGGGGGGG 140 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGG G Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRG 230 [190][TOP] >UniRef100_B5X0T7 Heterogeneous nuclear ribonucleoprotein A0 n=1 Tax=Salmo salar RepID=B5X0T7_SALSA Length = 300 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSS-RGGGGGSYGGGRRKVEGGYGG--GEAGGYGESGGGGG 143 GG G R GG G G +GY RGGG GSYGGG +GGYGG G GGYG GG GG Sbjct: 182 GGRGGR-GGRGMRGSQNGYDGGRGGGYGSYGGGYGGNDGGYGGGYGNGGGYGNQGGYGG 239 [191][TOP] >UniRef100_A6GBL5 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6GBL5_9DELT Length = 189 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/56 (57%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R GGGG RGGGGG GGGR GG GGG GGYG GGGGG Sbjct: 82 GGRGPRPGGGGGG-------PRGGGGGGGGGGRGGYGGGGGGGGRGGYGGGGGGGG 130 [192][TOP] >UniRef100_A0NYD4 Cold shock protein n=1 Tax=Labrenzia aggregata IAM 12614 RepID=A0NYD4_9RHOB Length = 286 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/64 (53%), Positives = 36/64 (56%), Gaps = 7/64 (10%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG-------EAGGYGESGG 152 GG G REGGGGY G GGG G YGGG R+ GGYGGG E GGYG G Sbjct: 87 GGGGDREGGGGYGG--------GGGRGGYGGGGRE-GGGYGGGGREGGGREGGGYGGGGS 137 Query: 151 GGGW 140 GG+ Sbjct: 138 RGGY 141 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/56 (55%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -1 Query: 310 GGDGRREGG-GGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG GR + GGY G GY GG GG GGG R+ GGYGGG GG G GGGG Sbjct: 58 GGYGRDDNKEGGYGGGRGGYGGGGGRGGYGGGGDREGGGGYGGG--GGRGGYGGGG 111 [193][TOP] >UniRef100_Q9FUD5 Glycine-rich RNA-binding protein n=1 Tax=Sorghum bicolor RepID=Q9FUD5_SORBI Length = 170 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/70 (50%), Positives = 37/70 (52%), Gaps = 13/70 (18%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYG-----------GGRRKVEGGYGGGEAGGYG 164 GG G R GGGY G GY R GGG YG GGRR+ GGYGGG GGYG Sbjct: 101 GGYGGRREGGGYGGGGGGYGGRREGGGGYGGGGYGGGGGGYGGRREGGGGYGGG--GGYG 158 Query: 163 ESGG--GGGW 140 + G GG W Sbjct: 159 GNRGDSGGNW 168 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/56 (58%), Positives = 35/56 (62%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G +G GGGGG Y GGRR+ GGYGG GGYG GGG G Sbjct: 92 GGGGYGGGGGGYGGRREG-GGYGGGGGGY-GGRREGGGGYGG---GGYGGGGGGYG 142 [194][TOP] >UniRef100_Q9FGH5 Genomic DNA, chromosome 5, P1 clone:MQJ2 n=1 Tax=Arabidopsis thaliana RepID=Q9FGH5_ARATH Length = 363 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/57 (61%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG-GGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGGY G GY RG GGGSYGG GGYGGG GG G GGGGG Sbjct: 19 GGDGYG-GGGGYGGGDAGYGGRGASGGGSYGG-----RGGYGGG--GGRGNRGGGGG 67 [195][TOP] >UniRef100_Q94KD0 AT5G58470 protein n=1 Tax=Arabidopsis thaliana RepID=Q94KD0_ARATH Length = 422 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/57 (61%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG-GGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGGY G GY RG GGGSYGG GGYGGG GG G GGGGG Sbjct: 19 GGDGYG-GGGGYGGGDAGYGGRGASGGGSYGG-----RGGYGGG--GGRGNRGGGGG 67 [196][TOP] >UniRef100_Q6S7B1 TAF15b (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q6S7B1_ARATH Length = 387 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/57 (61%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRG-GGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGGY G GY RG GGGSYGG GGYGGG GG G GGGGG Sbjct: 19 GGDGYG-GGGGYGGGDAGYGGRGASGGGSYGG-----RGGYGGG--GGRGNRGGGGG 67 [197][TOP] >UniRef100_B8B879 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B879_ORYSI Length = 639 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/57 (56%), Positives = 33/57 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG RR GGG G D RG GGG YGGG GGYGG GGYG GGGGG+ Sbjct: 572 GGRNRRSGGGARFGGRDFRRDRGSGGGGYGGG----GGGYGG---GGYGGGGGGGGY 621 [198][TOP] >UniRef100_A9S278 Predicted protein n=2 Tax=Physcomitrella patens RepID=A9S278_PHYPA Length = 162 Score = 60.5 bits (145), Expect = 6e-08 Identities = 37/63 (58%), Positives = 37/63 (58%), Gaps = 6/63 (9%) Frame = -1 Query: 310 GGDGRRE-GGGGYSGDVDGYSSRGGG---GGSYGGGRRKVEGGYGGGEAGGYGESGG--G 149 GG GRRE GGGGY G G SRGGG G YGG R GGYGGG GGYG GG Sbjct: 97 GGYGRREQGGGGYGGGYGG--SRGGGDREGSGYGGSR---GGGYGGGGGGGYGGRGGPSS 151 Query: 148 GGW 140 G W Sbjct: 152 GNW 154 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGG-GGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGGY G GGG GGS GGG R+ GYGG GGYG GGGG Sbjct: 88 GGGGGGGGGGGYGRREQGGGGYGGGYGGSRGGGDRE-GSGYGGSRGGGYGGGGGGG 142 [199][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/56 (58%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G G GGGGG YGGG GGYGGG GGYG GGG G Sbjct: 100 GGGGGYGGGGGYGGG--GGGGYGGGGGGYGGGG----GGYGGG-GGGYGGGGGGSG 148 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/56 (55%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG+ G GY GG GG GGG GGYGGG GGYG GGG G Sbjct: 87 GGGGFGGGGGGFGGGGGGYGGGGGYGGGGGGGYGGGGGGYGGG-GGGYGGGGGGYG 141 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/53 (56%), Positives = 32/53 (60%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GGGG+ G G+ GGGGG YGGG GGYGGG GGYG GGG G Sbjct: 83 GAGGGGGGFGGGGGGF---GGGGGGYGGG-----GGYGGGGGGGYGGGGGGYG 127 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/56 (57%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GGGGY G GY GGGGG YGGG GGYGG GG G GGGGG Sbjct: 108 GGGYGGGGGGGYGGGGGGY---GGGGGGYGGGG----GGYGG---GGGGSGGGGGG 153 [200][TOP] >UniRef100_A3BDN5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BDN5_ORYSJ Length = 321 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG R GG GGG GG G GGGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGG 143 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG + GG GGG GG G GGGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGG 142 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGG 140 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG + GG GGG GG G GGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGG 141 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGGE GG G GGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-----GGGGGGERGGGGGGGGGGG 132 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG E G GGG GG G GGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGG 139 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GG R GG GGG GG G GGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGERGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G RGGGGG GGG GG GGG GG G GG GG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGERGGGGGGGGGG-----GGGGGGGGGGGGGGGGNGG 150 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/55 (54%), Positives = 30/55 (54%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG G G GGGGG GGG GG GGG GG GE GGGGG Sbjct: 76 GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGERGGGGG 126 [201][TOP] >UniRef100_O02049 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans RepID=O02049_CAEEL Length = 259 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/56 (58%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGG G + GY G GGG YGGG GGYGGG GGYG SGG GG Sbjct: 178 GGDGGYGGGGFGGGGMGGYGG-GMGGGGYGGGGMG-GGGYGGGGDGGYGPSGGYGG 231 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG GD GY G GGG YGGG +GGYGGG GG G G GGG Sbjct: 148 GMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGG---DGGYGGGGFGGGGMGGYGGG 199 Score = 57.0 bits (136), Expect = 6e-07 Identities = 34/70 (48%), Positives = 36/70 (51%), Gaps = 14/70 (20%) Frame = -1 Query: 310 GGDGRRE----GGGGYSG--------DVDGYSSRGGGGGSYGG--GRRKVEGGYGGGEAG 173 GGDG GGGGY G + GY GGGGG +GG G GGYGGG G Sbjct: 122 GGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDG 181 Query: 172 GYGESGGGGG 143 GYG G GGG Sbjct: 182 GYGGGGFGGG 191 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/61 (54%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGD-GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAG----GYGESGGGG 146 GGD G GGGGY G GY G GGG YGG GG GGG G GYG GGGG Sbjct: 102 GGDFGGGMGGGGYGGG--GYGGGGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGG 159 Query: 145 G 143 G Sbjct: 160 G 160 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/59 (54%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG-GSYGGGRRKVEGGYGG--GEAGGYGESGGGGG 143 GG G GGGGY G G GGGG G YG GGYGG G GGYG GGGGG Sbjct: 194 GGYGGGMGGGGYGGGGMGGGGYGGGGDGGYG-----PSGGYGGGYGPGGGYGMGGGGGG 247 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSG-DVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G +GGGGY G GY GGG G YG G GG GGG+ GGYG G GGG Sbjct: 120 GGGG--DGGGGYGGYGGGGYGGMGGGPGGYGMGGYG-GGGGGGGDFGGYGGGGMGGG 173 [202][TOP] >UniRef100_Q6Z4K6 DEAD-box ATP-dependent RNA helicase 52B n=2 Tax=Oryza sativa Japonica Group RepID=RH52B_ORYSJ Length = 638 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/57 (56%), Positives = 33/57 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG RR GGG G D RG GGG YGGG GGYGG GGYG GGGGG+ Sbjct: 571 GGRNRRSGGGARFGGRDFRRDRGSGGGGYGGG----GGGYGG---GGYGGGGGGGGY 620 [203][TOP] >UniRef100_Q2H720 ATP-dependent RNA helicase DBP2 n=1 Tax=Chaetomium globosum RepID=DBP2_CHAGB Length = 562 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/63 (55%), Positives = 35/63 (55%), Gaps = 7/63 (11%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSY-------GGGRRKVEGGYGGGEAGGYGESGG 152 GG R GGGGYSG GY GGGGG Y GGG GGYGGG GGYG GG Sbjct: 7 GGYSSRGGGGGYSG---GYDRNGGGGGGYSGSNGYSGGGGGYGGGGYGGG-GGGYGGGGG 62 Query: 151 GGG 143 G G Sbjct: 63 GYG 65 Score = 60.5 bits (145), Expect = 6e-08 Identities = 38/68 (55%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGG--GGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW* 137 G D GGGGYSG +GYS GG GGG YGGG GGYGGG G G GGGGG Sbjct: 21 GYDRNGGGGGGYSGS-NGYSGGGGGYGGGGYGGG----GGGYGGGGGGYGGGYGGGGGDR 75 Query: 136 FL*LGLGL 113 LG GL Sbjct: 76 MSNLGAGL 83 [204][TOP] >UniRef100_Q4A373 Putative lectin protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A373_EHV86 Length = 1994 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/50 (60%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Frame = +3 Query: 144 PPPPPLSP*PPASPP-PYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 PPPPP SP PP+ PP P PP LPPP LPPPP P+ SP PPPP Sbjct: 204 PPPPPPSPFPPSPPPSPAPPPPSPLPPPPLPPPPS----PAPSPPPPPPP 249 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/54 (50%), Positives = 31/54 (57%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P P PPP PP + LPPP LPPPPP P ++P P PP +P Sbjct: 490 PPPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPPIPLPPGYWQTP 543 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP SP PP+ PPP PP T PPP L PPP L PS+ P P PP P P Sbjct: 1227 PPPPPPSP-PPSPPPPSPPPT---PPPPLSPPPSLPP-PSSPPPSPNPPPAPPPP 1276 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +3 Query: 144 PPPPPLSP--*PPASPPPYPPSTLRLPPP*LPPP--PPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP SPPP PP L PPP LPPP PP P +P P PP LP P Sbjct: 1228 PPPPPSPPPSPPPPSPPPTPPPPLS-PPPSLPPPSSPPPSPNPPPAPPPPSPPPPLPFP 1285 [205][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/53 (54%), Positives = 31/53 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP+ PPP PP PPP PPPPP PS P PPPP+ P Sbjct: 92 PPPPPPPPPPPSPPPPSPPPPSPPPPP--PPPPP----PSPPPPSPPPPTTTP 138 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSP---LYPPPPSRLPS 305 P PPP SP PP+ PPP PP PPP PPPP +T+P ++P P++LPS Sbjct: 102 PSPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPPTTTPPTTTTPTPSMHPIQPTQLPS 158 [206][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/65 (52%), Positives = 37/65 (56%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPS 293 +P+P + PPPP SP PP SPPP PPS PPP PPPPP P P PPPPS Sbjct: 514 SPRPPRPSPPSPPPPPSPPPPPSPPP-PPSP---PPPPSPPPPPS---PPPPPSPPPPPS 566 Query: 294 RLPSP 308 P P Sbjct: 567 PPPPP 571 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPA-SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP PP PPP PPPPP P P PPPPS P P Sbjct: 525 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS---PPPPPSPPPPPSPPPPP 577 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPA-SPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP PP PPP PPPPP P P PPPPS P P Sbjct: 531 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS---PPPPPSPPPPPSPPPPP 583 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP P PPP PPPP P SP PP P PSP Sbjct: 537 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSP 591 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP+ PPP P PPP PPPP P SP +PP P P P Sbjct: 543 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRP 597 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYP-PPPSRLPSP 308 PPPP SP PP SPPP PPS PPP PPPPP P + P P PP + PSP Sbjct: 555 PPPPPSPPPPPSPPP-PPSP---PPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSP 605 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/62 (48%), Positives = 30/62 (48%), Gaps = 7/62 (11%) Frame = +3 Query: 144 PPPPPL-------SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPP PL SP PP PP PP PPP PPPPP P P PPPPS P Sbjct: 501 PPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPS---PPPPPSPPPPPSPPP 557 Query: 303 SP 308 P Sbjct: 558 PP 559 [207][TOP] >UniRef100_Q1EP18 Protein kinase family protein n=1 Tax=Musa balbisiana RepID=Q1EP18_MUSBA Length = 637 Score = 60.5 bits (145), Expect = 6e-08 Identities = 36/65 (55%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PST-SPLYPPPPS 293 P P + PPPP LSP PPAS PP PPS PP PPPPP P T SP PPPPS Sbjct: 75 PDPPPPSVSPPPPALSP-PPASTPPPPPSA-SPPPAAAPPPPPFATPPPTNSP--PPPPS 130 Query: 294 RLPSP 308 P P Sbjct: 131 ATPPP 135 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/70 (47%), Positives = 37/70 (52%), Gaps = 5/70 (7%) Frame = +3 Query: 114 NPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*L--PPPPPLEE*PSTSPLYP-- 281 N P N PPP P SP P +SPPP PP +PPP + PPPP PS SP P Sbjct: 30 NSPPPAPNAPPPPTPPSPPPASSPPPTPPPPADVPPPPVVTSPPPPDPPPPSVSPPPPAL 89 Query: 282 -PPPSRLPSP 308 PPP+ P P Sbjct: 90 SPPPASTPPP 99 [208][TOP] >UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RZI2_RICCO Length = 829 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/67 (46%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPY--PPSTLRLPPP*L-PPPPPLEE*PSTSPLYPPP 287 P P + PPPP SP PP+ PPP PP + PPP + PPPP+ P SP PPP Sbjct: 673 PSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPPP 732 Query: 288 PSRLPSP 308 P P P Sbjct: 733 PMHSPPP 739 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/56 (46%), Positives = 27/56 (48%) Frame = +3 Query: 141 HPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 H PPPP+ PP SPP PP PPP PPPP P PPPP P P Sbjct: 713 HSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPVHSPPP 768 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/68 (44%), Positives = 34/68 (50%), Gaps = 13/68 (19%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPY--PPSTLRLPPP*LP------PPPPLEE*P-----STSPLYPP 284 PPPP SP PP+ PPP PP + PPP P PPPP+ P P+Y P Sbjct: 663 PPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSP 722 Query: 285 PPSRLPSP 308 PP PSP Sbjct: 723 PPPSPPSP 730 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP SP PP PP PP PPP PPPP+ P P+Y PPP R P Sbjct: 730 PPPPMHSPPPPVYSPP-PPPVRSPPPPVHSPPPPVHSPP--PPIYSPPPPRFSPP 781 [209][TOP] >UniRef100_A8HYC3 Hydroxyproline-rich glycoprotein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HYC3_CHLRE Length = 612 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/55 (56%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +3 Query: 144 PPPPPL--SP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPPL SP PP+ PPP PP PP PPPP PS P PPPP RLP Sbjct: 507 PPPPPLPPSPPPPSPPPPSPPPPSPPPPS---PPPPAPPPPSPPPPRPPPPPRLP 558 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/57 (50%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PS--TSPLYPPPPSRLPSP 308 P PPP SP PPA PPP PP PPP LPP PP P P P PSR P Sbjct: 529 PSPPPPSPPPPAPPPPSPPPPRPPPPPRLPPKPPSPMPPDWPADPQAPNAPSRRKRP 585 [210][TOP] >UniRef100_C3Z6S3 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3Z6S3_BRAFL Length = 192 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/54 (48%), Positives = 31/54 (57%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP+ P PP +PPP PP P P +P P P PS +P+ PPPP P P Sbjct: 53 PPPPMDPPPPMAPPPPPPPPPAAPAPPVPAPVPTPAPPSITPVPPPPPPVAPPP 106 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +3 Query: 147 PPPPLSP*PPASPPPY-PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP++P PP +PPP PP + PPP + PPPP+ P P+ PPPP P P Sbjct: 11 PPPPIAPPPPIAPPPMDPPPPIAPPPPPIAPPPPIAPPP---PIAPPPPMDPPPP 62 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PPASPPP--YPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP++P PP +PPP PP + PPP PPPPP P +P PP P+ +P+P Sbjct: 34 PPPPPIAPPPPIAPPPPIAPPPPMDPPPPMAPPPPPPP--PPAAPA-PPVPAPVPTP 87 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/60 (46%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Frame = +3 Query: 144 PP--PPPLSP*PPASPPP---YPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PP PPP+ P PP +PPP PP + PPP PPPP P P PPPP P+P Sbjct: 19 PPIAPPPMDPPPPIAPPPPPIAPPPPIAPPPPIAPPPPMDPPPPMAPPPPPPPPPAAPAP 78 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +3 Query: 147 PPPPLSP*PPASPPP--YPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP++P PP PPP PP PPP + PPPP+ P P+ PPPP P P Sbjct: 17 PPPPIAP-PPMDPPPPIAPPPPPIAPPPPIAPPPPIAPPP---PMDPPPPMAPPPP 68 [211][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/68 (47%), Positives = 34/68 (50%) Frame = +3 Query: 105 FIGNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPP 284 F+ P + R PPPPP P PP PPP PP PPP PPPPP P P PP Sbjct: 5 FLDTPVASTRETPPPPPPPPPPPPPPPPPPPP-----PPPPPPPPPP----PPPPPPPPP 55 Query: 285 PPSRLPSP 308 PP P P Sbjct: 56 PPPPPPPP 63 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 PPPPP P PP PPP PP PPP PPPPP P P PPP S+ Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQ 67 [212][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/51 (52%), Positives = 30/51 (58%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 PPPPP P PP PPP PP PPP PPPPP + P T+ +PP P R Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPAPLR 59 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/53 (52%), Positives = 29/53 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P P PPPP + P Sbjct: 4 PPPPPPPPPPPPPPPPPPP-----PPPPPPPPPP----PPPPPPPPPPPPKTP 47 [213][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/55 (49%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP + +PPP PPPPP + PPPP P P Sbjct: 1022 PPPPPPPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPPPPPP 1076 [214][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/51 (54%), Positives = 28/51 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 PPPPP P PP PPP PP PPP PPPPP P P PPPP R Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/51 (54%), Positives = 28/51 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSR 296 PPPPP P PP PPP PP PPP PPPPP P P PPPP R Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/53 (52%), Positives = 28/53 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLP 302 PPPPP P PP PPP PP PPP PPPPP P P PPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPP-----PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPP-----PPP--PPPPPPPPPPPPPPPPPPPPPPPPPP 55 [215][TOP] >UniRef100_UPI0000220B01 Hypothetical protein CBG11408 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000220B01 Length = 565 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GGGGY G GY GG GG YGGGR GGYGGG G G GG Sbjct: 20 GGSRSGGGGGGYGGGSGGYGGGGGYGGGYGGGR----GGYGGGRGGSSSRGGSSGG 71 [216][TOP] >UniRef100_UPI0000025476 DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Mus musculus RepID=UPI0000025476 Length = 1383 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/56 (53%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG+ G G+S GGGGG +GGGR GG+GG +GG+G GGG G Sbjct: 1222 GGGGFGSGGGGFGGGGGGFS--GGGGGGFGGGRGGGGGGFGG--SGGFGSGGGGYG 1273 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/59 (55%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGG----GGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GR GGGG+ G G+ S GGG GG YGGG GGYGGG +GGYG GGG G Sbjct: 1249 GGGRGGGGGGFGGS-GGFGSGGGGYGVGGGGYGGGGG---GGYGGG-SGGYGGGGGGYG 1302 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/66 (50%), Positives = 34/66 (51%), Gaps = 9/66 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEA---------GGYGES 158 GG G GGGGY G G GGG G YGGG GGYGGGE G YG Sbjct: 1268 GGGGYGVGGGGYGG--GGGGGYGGGSGGYGGG----GGGYGGGEGYSISPNSYRGNYG-- 1319 Query: 157 GGGGGW 140 GGGGG+ Sbjct: 1320 GGGGGY 1325 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREG-GGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GGG++ G+ S GGG GS GGG GG+ GG GG+G GGGG Sbjct: 1200 GGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 1256 [217][TOP] >UniRef100_UPI00015DF065 UPI00015DF065 related cluster n=1 Tax=Mus musculus RepID=UPI00015DF065 Length = 222 Score = 60.1 bits (144), Expect = 7e-08 Identities = 35/66 (53%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -1 Query: 310 GGDGRREGG--GGYSGDVDGYSSRGGGGGSYGGG-RRKVEGGYGGG------EAGGYGES 158 GG G R GG G Y G GY+ GGGGG+YGGG GGYGGG + GGYG Sbjct: 90 GGYGGRGGGSRGSYGGGDGGYNGFGGGGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYG-- 147 Query: 157 GGGGGW 140 GGGGG+ Sbjct: 148 GGGGGY 153 [218][TOP] >UniRef100_UPI00001EDBAC DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Mus musculus RepID=UPI00001EDBAC Length = 1384 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/56 (53%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG+ G G+S GGGGG +GGGR GG+GG +GG+G GGG G Sbjct: 1223 GGGGFGSGGGGFGGGGGGFS--GGGGGGFGGGRGGGGGGFGG--SGGFGSGGGGYG 1274 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/59 (55%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGG----GGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GR GGGG+ G G+ S GGG GG YGGG GGYGGG +GGYG GGG G Sbjct: 1250 GGGRGGGGGGFGGS-GGFGSGGGGYGVGGGGYGGGGG---GGYGGG-SGGYGGGGGGYG 1303 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/66 (50%), Positives = 34/66 (51%), Gaps = 9/66 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEA---------GGYGES 158 GG G GGGGY G G GGG G YGGG GGYGGGE G YG Sbjct: 1269 GGGGYGVGGGGYGG--GGGGGYGGGSGGYGGG----GGGYGGGEGYSISPNSYRGNYG-- 1320 Query: 157 GGGGGW 140 GGGGG+ Sbjct: 1321 GGGGGY 1326 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREG-GGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GGG++ G+ S GGG GS GGG GG+ GG GG+G GGGG Sbjct: 1201 GGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 1257 [219][TOP] >UniRef100_Q4TB22 Chromosome 15 SCAF7210, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4TB22_TETNG Length = 1021 Score = 60.1 bits (144), Expect = 7e-08 Identities = 35/59 (59%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGG--GGGSYGGGRRKVEGG-YGGGEAGGYGESGGGGG 143 GG G GGGGY G GY GG GGG YGGGR GG YGGG GGYG GG GG Sbjct: 962 GGGGGYRGGGGYGGR-RGYRGSGGYRGGGGYGGGRGNGGGGGYGGG--GGYGGGGGNGG 1017 Score = 54.3 bits (129), Expect = 4e-06 Identities = 34/67 (50%), Positives = 36/67 (53%), Gaps = 10/67 (14%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGG--GGGSYGG-------GRRKVEGGYGGGEA-GGYGE 161 GG G GGGGY G GY GG GGG YGG G + GGYGGG GG G Sbjct: 944 GGGGGYGGGGGYRGG-GGYGGGGGYRGGGGYGGRRGYRGSGGYRGGGGYGGGRGNGGGGG 1002 Query: 160 SGGGGGW 140 GGGGG+ Sbjct: 1003 YGGGGGY 1009 [220][TOP] >UniRef100_C1BM74 Heterogeneous nuclear ribonucleoprotein A0 n=1 Tax=Osmerus mordax RepID=C1BM74_OSMMO Length = 308 Score = 60.1 bits (144), Expect = 7e-08 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 10/66 (15%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGG-----GGSYGGGRRKVEGGYGGGEA-----GGYGE 161 GG GR GG G G+ +GY S GG GG YGGG +GGYGGG A GGYG Sbjct: 183 GGGGRSRGGRGMRGNQNGYGSARGGYNTGYGGGYGGG---YDGGYGGGYASGGYGGGYGA 239 Query: 160 SGGGGG 143 +GG GG Sbjct: 240 AGGYGG 245 [221][TOP] >UniRef100_A8HG17 Hnrpa01 protein (Fragment) n=1 Tax=Epinephelus coioides RepID=A8HG17_EPICO Length = 329 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GR GG G +GY GG SYGGG +GGYGGG GGYG GG GG Sbjct: 188 GRGGRGRGGRGMGRPQNGYGGGRGGYNSYGGGYGGNDGGYGGGYGGGYGSQGGYGG 243 [222][TOP] >UniRef100_B6ID90 DEAH (Asp-Glu-Ala-His) box polypeptide 9 (Fragment) n=2 Tax=root RepID=B6ID90_9ZZZZ Length = 448 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/56 (53%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG+ G G+S GGGGG +GGGR GG+GG +GG+G GGG G Sbjct: 287 GGGGFGSGGGGFGGGGGGFS--GGGGGGFGGGRGGGGGGFGG--SGGFGSGGGGYG 338 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/59 (55%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGG----GGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GR GGGG+ G G+ S GGG GG YGGG GGYGGG +GGYG GGG G Sbjct: 314 GGGRGGGGGGFGGS-GGFGSGGGGYGVGGGGYGGGGG---GGYGGG-SGGYGGGGGGYG 367 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/66 (50%), Positives = 34/66 (51%), Gaps = 9/66 (13%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEA---------GGYGES 158 GG G GGGGY G G GGG G YGGG GGYGGGE G YG Sbjct: 333 GGGGYGVGGGGYGG--GGGGGYGGGSGGYGGG----GGGYGGGEGYSISPNSYRGNYG-- 384 Query: 157 GGGGGW 140 GGGGG+ Sbjct: 385 GGGGGY 390 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREG-GGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GGG++ G+ S GGG GS GGG GG+ GG GG+G GGGG Sbjct: 265 GGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 321 [223][TOP] >UniRef100_C3MDJ7 Putative uncharacterized protein n=1 Tax=Rhizobium sp. NGR234 RepID=C3MDJ7_RHISN Length = 209 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/56 (53%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G + GGGGG GGG GG GGG+ GG G GGGGG Sbjct: 105 GGSGGGGGGGGGGGGGGGGNGGGGGGGGGGGGGGGGGGGGGGGDGGGGGNDGGGGG 160 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/56 (51%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG +G G GGGGG GGG +GG GG + GG G GGGGG Sbjct: 112 GGGGGGGGGGGGNGGGGGGGGGGGGGGGGGGGGGGGDGGGGGNDGGGGGNDGGGGG 167 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/56 (53%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 103 GGGGSGGGGGGGGGGGGGGGGNGGGGGGGGGG-----GGGGGGGGGGGGGDGGGGG 153 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = -1 Query: 304 DGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 DG G G G G S GGGGG GGG GG GGG GG G GGGGG Sbjct: 90 DGNPTGSNGGGGSGGGGSGGGGGGGGGGGGGGGGNGGGGGGGGGGGGGGGGGGG 143 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/49 (55%), Positives = 27/49 (55%) Frame = -1 Query: 289 GGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGGG G G GGGGG GGG GG GGG GG G GGGGG Sbjct: 98 GGGGSGGGGSGGGGGGGGGGGGGGGGNGGGGGGGGGGGGGGGGGGGGGG 146 [224][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 60.1 bits (144), Expect = 7e-08 Identities = 34/59 (57%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYS-SRGGGGGSYGGGRRKVEGG--YGGGEAGGYGESGGGGG 143 GG G R GGGGY G G GGGGG YGGG GG YGGG +GG G GGGGG Sbjct: 114 GGGGGRGGGGGYDGGGGGGGYGGGGGGGGYGGG-----GGSSYGGGGSGGGGYGGGGGG 167 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/53 (54%), Positives = 29/53 (54%) Frame = -1 Query: 301 GRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GR GGGG G GY GGGGG GGG GGYGGG YG G GGG Sbjct: 110 GRDGGGGGGRGGGGGYDGGGGGGGYGGGGG---GGGYGGGGGSSYGGGGSGGG 159 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/57 (57%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -1 Query: 310 GGDGRR--EGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G GGGGY G G GGGG SYGGG GGYGGG GG G SGGGG Sbjct: 121 GGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGG-GSGGGGYGGG--GGGGNSGGGG 174 [225][TOP] >UniRef100_Q5Z8T9 Os06g0706700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z8T9_ORYSJ Length = 116 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/56 (55%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G +GGGGGS GGGR GG GGG+ GG G SG GG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGG 57 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/60 (50%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRR---KVEGGYGGGEAGGYGESGGGGGW 140 GG G +GGGG SG GGGGG GGG K GGY GG AGG G +G GG+ Sbjct: 17 GGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGAGKSGGY 76 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/61 (49%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGGG--YSGDVDGYSSRGGGGGSYGGGRRKVEGG---YGGGEAGGYGESGGGG 146 GG G GGGG G G R GGGG GGG+ EGG YGGG +GG+ GGG Sbjct: 11 GGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGA 70 Query: 145 G 143 G Sbjct: 71 G 71 [226][TOP] >UniRef100_Q2QV64 Transposon protein, putative, CACTA, En/Spm sub-class, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q2QV64_ORYSJ Length = 126 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/61 (52%), Positives = 35/61 (57%), Gaps = 5/61 (8%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGY-----SSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 GG G EGGGG SG +GY +S GG G YG G G GG AGGYG+ GGGG Sbjct: 40 GGGGGGEGGGGGSGYGEGYGQGGGASGGGNGSGYGSGYGSGYGQGGGVHAGGYGQGGGGG 99 Query: 145 G 143 G Sbjct: 100 G 100 [227][TOP] >UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KME4_TOXGO Length = 513 Score = 60.1 bits (144), Expect = 7e-08 Identities = 33/56 (58%), Positives = 33/56 (58%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G GY G GGG YGGG GGYGGG GGYG G GGG Sbjct: 303 GGGGY--GGGGYGGG-GGYGGGGYGGGGYGGGN----GGYGGGGNGGYGGGGYGGG 351 Score = 60.1 bits (144), Expect = 7e-08 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG---GSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGGY G GY G GG G YGGG GGYGGG GGYG GGG G Sbjct: 319 GGGGY--GGGGYGGGNGGYGGGGNGGYGGGGYGGGN----GGYGGGGGGGYGGGGGGYG 371 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGG--------GSYGGGRRKVEGGYGGGEAGGYGESG 155 GG GGGGY G GY GGGG G YGGG GGYGGG G G G Sbjct: 337 GGGNGGYGGGGYGGGNGGYGGGGGGGYGGGGGGYGGYGGG-----GGYGGGGGFGSGGYG 391 Query: 154 GGGGW 140 GGGG+ Sbjct: 392 GGGGY 396 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/57 (52%), Positives = 31/57 (54%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GR GGY G Y G GGG YGGG GGYGGG GG G GG GG+ Sbjct: 283 GGMGR----GGYGGHGSPYGGGGYGGGGYGGGGYGGGGGYGGGGYGGGGYGGGNGGY 335 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/60 (53%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGY---SSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG G G GGY G +G GGG G YGGG GGYGGG GGYG GGGGG+ Sbjct: 324 GGGGYGGGNGGYGGGGNGGYGGGGYGGGNGGYGGGG---GGGYGGG-GGGYGGYGGGGGY 379 [228][TOP] >UniRef100_B5KFE3 KRMP-5 n=1 Tax=Pinctada margaritifera RepID=B5KFE3_PINMG Length = 144 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 5/59 (8%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRK-----VEGGYGGGEAGGYGESGGGG 146 GDG GGGGY G GY G GGG YGGG +GGYGGG GGYG GGG Sbjct: 72 GDGGGYGGGGYGGG--GYGGGGYGGGGYGGGYDGGYDGGYDGGYGGGYGGGYGGGYGGG 128 [229][TOP] >UniRef100_B1X5L4 RNA-binding protein RbpD n=1 Tax=Paulinella chromatophora RepID=B1X5L4_PAUCH Length = 132 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/56 (57%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G R GGGG GGGGG YGGGR GGYGGG GGYG GGG G Sbjct: 82 GGGGNRGGGGG----------GGGGGGGYGGGRGG-GGGYGGGGGGGYGSGGGGYG 126 [230][TOP] >UniRef100_A8XD35 Putative uncharacterized protein n=1 Tax=Caenorhabditis briggsae RepID=A8XD35_CAEBR Length = 559 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG GGGGY G GY GG GG YGGGR GGYGGG G G GG Sbjct: 20 GGSRSGGGGGGYGGGSGGYGGGGGYGGGYGGGR----GGYGGGRGGSSSRGGSSGG 71 [231][TOP] >UniRef100_Q99069 Glycine-rich RNA-binding protein 1 (Fragment) n=1 Tax=Sorghum bicolor RepID=GRP1_SORBI Length = 142 Score = 60.1 bits (144), Expect = 7e-08 Identities = 34/60 (56%), Positives = 35/60 (58%), Gaps = 3/60 (5%) Frame = -1 Query: 310 GGDGRREGGGG-YSGDVDGYSS-RGG-GGGSYGGGRRKVEGGYGGGEAGGYGESGGGGGW 140 GG GRR+GGGG Y G GY RGG GGG YGGG GGYGGG GG G G W Sbjct: 85 GGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGGG----GGYGGGSRGGGGYGNSDGNW 140 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/52 (59%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = -1 Query: 289 GGGGYSGDVDG---YSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGGGY G G Y R GGGG YGGG GGYGGG GGYG G GGG Sbjct: 73 GGGGYGGGRGGGGGYGRRDGGGGGYGGG----GGGYGGGR-GGYGGGGYGGG 119 [232][TOP] >UniRef100_O70133-2 Isoform 2 of ATP-dependent RNA helicase A n=1 Tax=Mus musculus RepID=O70133-2 Length = 1381 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/56 (53%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG+ G G+S GGGGG +GGGR GG+GG +GG+G GGG G Sbjct: 1222 GGGGFGSGGGGFGGGGGGFS--GGGGGGFGGGRGGGGGGFGG--SGGFGNGGGGYG 1273 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGG----GGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GR GGGG+ G G+ + GGG GG YGGG GGYGGG +GGYG G GGG Sbjct: 1249 GGGRGGGGGGFGGS-GGFGNGGGGYGVGGGGYGGGGG---GGYGGG-SGGYGGGGYGGG 1302 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/67 (47%), Positives = 34/67 (50%), Gaps = 11/67 (16%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDG--YSSRGGGGGSY---------GGGRRKVEGGYGGGEAGGYG 164 GG G GGGG+SG G RGGGGG + GGG GGYGGG GGYG Sbjct: 1229 GGGGFGGGGGGFSGGGGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGGYGGGGGGGYG 1288 Query: 163 ESGGGGG 143 GG G Sbjct: 1289 GGSGGYG 1295 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREG-GGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GGG++ G+ S GGG GS GGG GG+ GG GG+G GGGG Sbjct: 1200 GGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 1256 [233][TOP] >UniRef100_O70133 ATP-dependent RNA helicase A n=2 Tax=Mus musculus RepID=DHX9_MOUSE Length = 1380 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/56 (53%), Positives = 36/56 (64%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG+ G G+S GGGGG +GGGR GG+GG +GG+G GGG G Sbjct: 1221 GGGGFGSGGGGFGGGGGGFS--GGGGGGFGGGRGGGGGGFGG--SGGFGNGGGGYG 1272 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGG----GGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G GR GGGG+ G G+ + GGG GG YGGG GGYGGG +GGYG G GGG Sbjct: 1248 GGGRGGGGGGFGGS-GGFGNGGGGYGVGGGGYGGGGG---GGYGGG-SGGYGGGGYGGG 1301 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/67 (47%), Positives = 34/67 (50%), Gaps = 11/67 (16%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDG--YSSRGGGGGSY---------GGGRRKVEGGYGGGEAGGYG 164 GG G GGGG+SG G RGGGGG + GGG GGYGGG GGYG Sbjct: 1228 GGGGFGGGGGGFSGGGGGGFGGGRGGGGGGFGGSGGFGNGGGGYGVGGGGYGGGGGGGYG 1287 Query: 163 ESGGGGG 143 GG G Sbjct: 1288 GGSGGYG 1294 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREG-GGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GGG++ G+ S GGG GS GGG GG+ GG GG+G GGGG Sbjct: 1199 GGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGG 1255 [234][TOP] >UniRef100_Q9P6U9 ATP-dependent RNA helicase ded-1 n=1 Tax=Neurospora crassa RepID=DED1_NEUCR Length = 688 Score = 60.1 bits (144), Expect = 7e-08 Identities = 33/68 (48%), Positives = 37/68 (54%), Gaps = 11/68 (16%) Frame = -1 Query: 310 GGDGRRE----------GGGGYSGDVDGYSSRGG-GGGSYGGGRRKVEGGYGGGEAGGYG 164 GG GR + GGGG+ G G + GG GGG YGGG GGYGGG GYG Sbjct: 605 GGRGRTQTADYRKFGGSGGGGFGGGFGGAPASGGYGGGGYGGGGPPA-GGYGGGGGAGYG 663 Query: 163 ESGGGGGW 140 GGGGG+ Sbjct: 664 GGGGGGGY 671 [235][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 60.1 bits (144), Expect = 8e-08 Identities = 31/65 (47%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +3 Query: 117 PKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*L-PPPPPLEE*PSTSPLYPPPPS 293 P P + PPPPP P P PPP PP + LPPP PPPPP P P PPPP+ Sbjct: 161 PPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPA 220 Query: 294 RLPSP 308 P P Sbjct: 221 PCPPP 225 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*L--PPPPPLEE*PSTSPLYPPPPSR-LPSP 308 PPPPP P PP PPP PP PPP + PPPPP P+ P PPPP LP P Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPP 196 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P PP PPP P PPP PPPPP+ P P PPPP P P Sbjct: 101 PPPPGCGPPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPP 155 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/57 (50%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLS--P*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP+ P PP PPP PP PPP PPPPP+ P P PPPP+ P P Sbjct: 130 PPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPC-PPPPAPCPPP 185 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/56 (50%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPP-PLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPP P P P+ PPP P P Sbjct: 147 PPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPP 202 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/57 (49%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPPPPLSP*PP--ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP+ P PP +PPP PP PPP PPPPP P PPPP P P Sbjct: 123 PPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPP 179 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/66 (45%), Positives = 31/66 (46%), Gaps = 11/66 (16%) Frame = +3 Query: 144 PPPPPLSP*PP-----------ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 PPPPP P PP PPP PP PPP PPPPP+ P P PPPP Sbjct: 148 PPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPP--PPPPPMCLPPPPPPPPPPPP 205 Query: 291 SRLPSP 308 LP P Sbjct: 206 CPLPPP 211 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/56 (48%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*L--PPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP P P PPP PP + PPP + PPPPP P P PPPP P P Sbjct: 108 PPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPP 163 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP PP PPP PP LPPP P PPP P+ P PPPP P+P Sbjct: 185 PPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPP----PAPCP-PPPPPPACPAP 234 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/58 (48%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPY---PPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP +P PP PPP PP + PPP PPPPP P P PPPP P P Sbjct: 111 PCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPP----PPPPPPPPPPPPPPPPP 164 [236][TOP] >UniRef100_UPI0000D9A917 PREDICTED: similar to Wiskott-Aldrich syndrome gene-like protein n=1 Tax=Macaca mulatta RepID=UPI0000D9A917 Length = 435 Score = 60.1 bits (144), Expect = 8e-08 Identities = 34/72 (47%), Positives = 39/72 (54%) Frame = +3 Query: 90 ARERTFIGNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTS 269 +R + P PN R Y PPPP L P+ PPP PPS L + P PPPPP P Sbjct: 258 SRPSVAVPPPPPN-RMYPPPPPALPSSAPSGPPPPPPSVLGVGPV-APPPPP----PPPP 311 Query: 270 PLYPPPPSRLPS 305 P PPPP+ LPS Sbjct: 312 PPGPPPPTGLPS 323 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/65 (47%), Positives = 35/65 (53%) Frame = +3 Query: 111 GNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPP 290 G P P R PPPP S P A+PPP PPS P +PPPPP + +YPPPP Sbjct: 228 GPPPPPARGRGAPPPPPSRAPTAAPPPPPPSR---PSVAVPPPPP-------NRMYPPPP 277 Query: 291 SRLPS 305 LPS Sbjct: 278 PALPS 282 [237][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/56 (51%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +3 Query: 147 PPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PS--TSPLYPPPPSRLPSP 308 PPP P PP +PPP PP T PP PPPPP+ PS T+P PPPP P P Sbjct: 50 PPPTFPPTPPPTPPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPP 105 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/75 (42%), Positives = 38/75 (50%), Gaps = 7/75 (9%) Frame = +3 Query: 105 FIGNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PS------- 263 FI PK H P PPL P P +PPP PP++ PPP PP PP P+ Sbjct: 19 FILKPK----TIHTPSPPLPP--PPTPPPTPPTSPATPPPTFPPTPPPTPPPTPPPTPPP 72 Query: 264 TSPLYPPPPSRLPSP 308 T P PPPP +P+P Sbjct: 73 TPPPTPPPPPIIPAP 87 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/56 (48%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*P-PASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP+ P P P + PP PP PPP PPPPP P+ P PP P P P Sbjct: 78 PPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPPPTPPPTPPPTPPP 133 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/55 (47%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 P PPP P PP P P PP+ PPP PPPPP P PPPP+ P+P Sbjct: 72 PTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPP-------PPPPPPPPTPPPTP 119 [238][TOP] >UniRef100_Q948Y9 VMP1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y9_VOLCA Length = 573 Score = 60.1 bits (144), Expect = 8e-08 Identities = 33/57 (57%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPP--PPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP PP SP PPA PPP PP+ R PPP PPPL++ P SP PPP R PSP Sbjct: 510 PPPARPPPSPPPPARPPPPPPT--RSPPPLTRSPPPLKKSPPPSPRKPPPSPR-PSP 563 [239][TOP] >UniRef100_Q8S9B4 Matrix metalloproteinase n=1 Tax=Volvox carteri f. nagariensis RepID=Q8S9B4_VOLCA Length = 568 Score = 60.1 bits (144), Expect = 8e-08 Identities = 33/57 (57%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Frame = +3 Query: 144 PPP--PPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPP PP SP PPA PPP PP+ R PPP PPPL++ P SP PPP R PSP Sbjct: 510 PPPARPPPSPPPPARPPPPPPT--RSPPPLTRSPPPLKKSPPPSPRKPPPSPR-PSP 563 [240][TOP] >UniRef100_Q5ZB68 Os01g0594300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5ZB68_ORYSJ Length = 551 Score = 60.1 bits (144), Expect = 8e-08 Identities = 36/88 (40%), Positives = 45/88 (51%), Gaps = 4/88 (4%) Frame = +3 Query: 57 ENTHN-QVEA*QARERTFIGNPKPN*RNYHPPPPPLSP*PPASPPPYPPSTLRLPPP*LP 233 +NTH+ +A + ++ P P+ PPPP SP PP+ PPP PP PPP P Sbjct: 380 QNTHHVNCDAFRCKKFVLPSPPPPSPPPPSPPPPSPSPPPPSPPPPSPPPPSPSPPPPSP 439 Query: 234 PPPPLEE*PSTSPLY---PPPPSRLPSP 308 PPP P SP+Y PPPP SP Sbjct: 440 PPP---SPPPPSPVYYSSPPPPYYEVSP 464 [241][TOP] >UniRef100_C5YLU5 Putative uncharacterized protein Sb07g000890 n=1 Tax=Sorghum bicolor RepID=C5YLU5_SORBI Length = 318 Score = 60.1 bits (144), Expect = 8e-08 Identities = 33/72 (45%), Positives = 35/72 (48%), Gaps = 8/72 (11%) Frame = +3 Query: 117 PKPN*RNYHPPPP-----PLSP*PP---ASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSP 272 P+P R PPPP P+ PP A PPP PP R PPP PPPP P Sbjct: 22 PRPPPRPQAPPPPQRFPPPMRAPPPPQRAPPPPQPPPPRRAPPPPTLPPPPPRRAPPPPA 81 Query: 273 LYPPPPSRLPSP 308 L PPPP R P P Sbjct: 82 LPPPPPRRAPPP 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/55 (52%), Positives = 30/55 (54%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPP +P PP PPP P PPP LPPPPP P P PPPP R SP Sbjct: 56 PPPPRRAPPPPTLPPP--PPRRAPPPPALPPPPPRRAPP--PPTMPPPPPRRVSP 106 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PST-SPLYPPPPSRLPSP 308 PPPP +P PPA PPP P PPP +PPPPP P PL PP PS P P Sbjct: 70 PPPPRRAPPPPALPPP--PPRRAPPPPTMPPPPPRRVSPLVMQPLGPPRPSPRPGP 123 [242][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/54 (53%), Positives = 29/54 (53%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPS 305 PPPPP P PP PPP PP PPP PPPPP P P PPPP L S Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGS 54 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/55 (52%), Positives = 29/55 (52%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP P PP PPP PP PPP PPPPP P P PPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPP-----PPP--PPPPPPPPPPPPPPPPPPPPPPPPPP 49 [243][TOP] >UniRef100_A1DL75 Actin associated protein Wsp1, putative n=1 Tax=Neosartorya fischeri NRRL 181 RepID=A1DL75_NEOFI Length = 638 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = +3 Query: 144 PPPPPLSP*PPASPPPYPPSTLRLPPP*LPPPPPLEE*PSTSPLYPPPPSRLPSP 308 PPPPP S PPA PPP PPS PPP PPPPP + P PPP + P P Sbjct: 487 PPPPPASAGPPAPPPPPPPSIAGPPPP--PPPPPAPGGSAPPPPPPPPGASAPPP 539 Score = 53.1 bits (126), Expect = 9e-06 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 11/75 (14%) Frame = +3 Query: 117 PKPN*RNYHPPP--PPL------SP*PPAS---PPPYPPSTLRLPPP*LPPPPPLEE*PS 263 P P RN PPP PP+ +P PPA+ PPP PP + +PPP PPPPP P Sbjct: 439 PPPPARNPVPPPAPPPVPAASRPTPPPPATSAVPPPPPPPSASVPPP-PPPPPPASAGPP 497 Query: 264 TSPLYPPPPSRLPSP 308 P PPPP + P Sbjct: 498 APP--PPPPPSIAGP 510 [244][TOP] >UniRef100_UPI0001982C16 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982C16 Length = 393 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/58 (56%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGG--EAGGYGESGGGGG 143 GG G GGGGY G V GY S GGGGG G G GGYG G GGYG GG GG Sbjct: 60 GGGGGSGGGGGY-GAVGGYGSGGGGGGGGGSG-----GGYGAGGIHGGGYGSGGGSGG 111 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEG-GYGGGEAGGYGESGGGGG 143 G G G GG SG GY + G GG YGGG G GYGG GGYG GGGG Sbjct: 287 GEHGGGYGSGGGSGGGTGYGAGGEHGGGYGGGGGSGGGTGYGGEHGGGYGGGNGGGG 343 Score = 53.9 bits (128), Expect = 5e-06 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGY-SSRGGGGGSYGGGRRKVEGGYG-GGEAGGYGESGGGGG 143 G G GGGG SG G+ GGGGGS GGG GGYG GG GG G SGGG G Sbjct: 38 GHGIGGGGGGGSGSGGGFPGGYGGGGGSGGGGGYGAVGGYGSGGGGGGGGGSGGGYG 94 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/60 (50%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYG-----GGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG G G S GGGG YG GG GG GGG GGYG GG GG Sbjct: 168 GGGAGYGGGGEHGGGYGGGSGGGGGVGYGAGGEHGGGGGSGGGAGGGHGGGYGSGGGQGG 227 [245][TOP] >UniRef100_UPI000155D044 PREDICTED: similar to heterogeneous nuclear ribonucleoprotein A3 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155D044 Length = 327 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/64 (51%), Positives = 36/64 (56%), Gaps = 7/64 (10%) Frame = -1 Query: 310 GGDGRREGGGG------YSGDVDGYSSRGGGGGSYGGG-RRKVEGGYGGGEAGGYGESGG 152 GG G GGGG Y G GY+ GG GG+YGGG GGYGGG GYG GG Sbjct: 191 GGRGGYSGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGP--GYGNQGG 248 Query: 151 GGGW 140 GGG+ Sbjct: 249 GGGY 252 [246][TOP] >UniRef100_UPI0000E49699 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E49699 Length = 123 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/56 (57%), Positives = 34/56 (60%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GGDG GGGG SGD DG GG GGS GGG +GG GG +GG G SGG G Sbjct: 51 GGDGGSGGGGGGSGDGDG----GGDGGSGGGGGGGSDGGGDGGSSGGDGSSGGSDG 102 [247][TOP] >UniRef100_UPI0000E46229 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E46229 Length = 374 Score = 59.7 bits (143), Expect = 1e-07 Identities = 39/67 (58%), Positives = 40/67 (59%), Gaps = 11/67 (16%) Frame = -1 Query: 310 GGDGRREG------GGGYSGDVDGYSSRG-GGGGSYGGG--RRKVEGGY--GGGEAGGYG 164 GG GR G GGGYSG GYS RG GGGGS GGG R GGY GGG +GGYG Sbjct: 292 GGGGRGFGSSGGGSGGGYSG---GYSGRGRGGGGSSGGGGYRDSQMGGYSGGGGGSGGYG 348 Query: 163 ESGGGGG 143 GGG G Sbjct: 349 GGGGGSG 355 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/56 (51%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -1 Query: 307 GDGRREGGGGY-SGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGGY + GYS GGG G YGGG GGG G YG GGGGG Sbjct: 319 GGGGSSGGGGYRDSQMGGYSGGGGGSGGYGGG--------GGGSGGFYGSGGGGGG 366 [248][TOP] >UniRef100_UPI0000DB6D77 PREDICTED: similar to CG5913-PA n=1 Tax=Apis mellifera RepID=UPI0000DB6D77 Length = 503 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/61 (52%), Positives = 35/61 (57%), Gaps = 7/61 (11%) Frame = -1 Query: 307 GDGRREGGG---GYSGDVDGYSSRGGG----GGSYGGGRRKVEGGYGGGEAGGYGESGGG 149 G G ++GGG GY G GY +GGG GG YGGG GGYGGG GGYG GG Sbjct: 345 GRGGKQGGGYGGGYGGQGGGYGGQGGGYGGQGGGYGGG---YGGGYGGGYGGGYGAGQGG 401 Query: 148 G 146 G Sbjct: 402 G 402 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -1 Query: 307 GDGRREGG---GGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 G GR GG GGY G GY +GGG G GGG GGYGGG GGYG GGG Sbjct: 341 GGGRGRGGKQGGGYGG---GYGGQGGGYGGQGGGYGGQGGGYGGGYGGGYGGGYGGG 394 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 5/59 (8%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGG-----GGSYGGGRRKVEGGYGGGEAGGYGESGGGG 146 G G GGGY G GY +GGG GG YGGG GGYG G+ GGYG GGG Sbjct: 355 GGGYGGQGGGYGGQGGGYGGQGGGYGGGYGGGYGGG---YGGGYGAGQGGGYGGGQGGG 410 [249][TOP] >UniRef100_Q7ZYV6 Hyperosmotic glycine rich protein n=1 Tax=Salmo salar RepID=Q7ZYV6_SALSA Length = 205 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYG----GGEAGGYGESGGGG 146 GG G R GGGGY G G GGGG YGGG R GG G GGE GYG GGGG Sbjct: 84 GGGGGRGGGGGYRGSRGGGGY--GGGGGYGGGERSYGGGGGGRSYGGEDRGYGGGGGGG 140 [250][TOP] >UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia MC0-3 RepID=B1JXE0_BURCC Length = 505 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/56 (53%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG +G+ G GGGGG GGG GG GGG GG G GGGGG Sbjct: 329 GGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGG 384 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG+G GGGG G G GGGGG GGG GG GGG GG+G GGG G Sbjct: 363 GGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGG----NGGNGGGGGGGHGNGGGGHG 414 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/55 (54%), Positives = 32/55 (58%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGGG G G + GGGGG GGG GG GGG AGG G +GGGGG Sbjct: 323 GGGPGNGGGGGGGGGGGGNGNGGGGGGGGGG----GGGGGGGGAGGNGGNGGGGG 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/56 (53%), Positives = 32/56 (57%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG +G G GGGGG GGG GG GGG GG G +GGGGG Sbjct: 350 GGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGG--GGGGGGGGGGNGGNGGGGG 403 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/56 (50%), Positives = 28/56 (50%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GG G G G GGGGG G G GG GGG GG G GGGGG Sbjct: 332 GGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGG 387 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/56 (50%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G G GG G G GGGGG+ G G GG GGG GG G GGGGG Sbjct: 335 GGGGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGG 390 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/56 (50%), Positives = 28/56 (50%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GGG G GG GG GGG GG G GGGGG Sbjct: 337 GGGGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGG 392 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/56 (50%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG +G + GGGGG GGG GG GGG G G GGGGG Sbjct: 349 GGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGGG 404 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/55 (50%), Positives = 34/55 (61%) Frame = -1 Query: 307 GDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G +GGGG+ G+ G+ + GGG G+ GGG GG GGG GG G GGGGG Sbjct: 297 GGGHGDGGGGH-GNGGGHGNGGGGNGN-GGGPGNGGGGGGGGGGGGNGNGGGGGG 349 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 GG G GGGG G G GG GG GGG GG GGG GG G GGGGG Sbjct: 344 GGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGG-----GGGGGGGGGGGGGGGGGGG 394 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/56 (48%), Positives = 30/56 (53%) Frame = -1 Query: 310 GGDGRREGGGGYSGDVDGYSSRGGGGGSYGGGRRKVEGGYGGGEAGGYGESGGGGG 143 G G GGG +G+ G + GGGGG GGG GG GGG GG G GGG G Sbjct: 308 GNGGGHGNGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAG 363