Human ORFeome
Gene/Protein Characteristic Table for ORH13989P
Order ORFeome clone(s) from : Japan || Other countries
Check our QC before Ordering.
Product ID ORH13989P
Clone name on29348
IMAGE Clone ID 649114660
Vector name pDONR223
Stop codon without
Genbank Acc KJ895563
Parent Genbank Acc BC112343.1
Parent gene symbol SREK1
Description splicing regulatory glutamine/lysine-rich protein 1
The cloned ORF sequence

Download
Length: 1524 bp
ATGACAAGTCTGATGCCTGGTGCAGGATTGCTTCCAATACCGACCCCAAATCCTTTGACT
ACTCTTGGTGTTTCACTTAGCAGTTTGGGAGCTATACCAGCAGCAGCACTAGACCCCAAC
ATTGCAACACTTGGAGAGATACCACAGCCACCACTTATGGGAAACGTGGATCCTTCCAAA
ATAGATGAAATTAGGAGAACGGTTTATGTTGGAAATCTGAATTCCCAGACAACGACAGCT
GATCAACTACTTGAATTTTTTAAACAAGTTGGAGAAGTGAAGTTTGTGCGGATGGCAGGT
GATGAGACTCAGCCAACTCGGTTTGCTTTTGTGGAATTTGCAGACCAAAATTCTGTACCA
AGGGCCCTTGCTTTTAATGGAGTTATGTTTGGAGACAGGCCACTGAAAATAAATCACTCC
AACAATGCAATAGTAAAACCCCCTGAGATGACACCTCAGGCTGCAGCTAAGGAGTTAGAA
GAAGTAATGAAGCGAGTACGAGAAGCTCAGTCATTTATCTCAGCAGCTATTGAACCAGAG
TCTGGAAAGAGCAATGAAAGAAAAGGCGGTCGATCTCGTTCCCATACTCGCTCAAAATCC
AGGTCTAGCTCAAAATCCCATTCTAGAAGGAAAAGATCACAATCAAAACACAGGAGTAGA
TCCCATAATAGATCACGTTCAAGACAGAAAGACAGACGTAGATCTAAGAGCCCACATAAA
AAACGCTCTAAATCAAGGGAGAGACGGAAGTCAAGGAGTCGTTCGCATTCACGGGACAAG
AGAAAAGACACTCGAGAAAAGATCAAGGAAAAGGAAAGAGTGAAAGAGAAAGACAGGGAA
AAGGAGAGAGAGAGGGAAAAGGAACGTGAAAAAGAAAAGGAACGGGGTAAAAACAAAGAC
CGGGACAAGGAACGGGAAAAGGACCGGGAAAAAGACAAGGAAAAGGACAGAGAGAGAGAA
CGGGAAAAAGAGCATGAGAAGGATCGAGACAAAGAGAAGGAAAAGGAACAGGACAAAGAA
AAGGAACGAGAAAAAGACAGATCCAAAGAGATAGATGAAAAAAGAAAGAAGGATAAAAAA
TCCAGAACACCACCCAGGAGTTACAATGCATCGCGAAGATCTCGTAGTTCCAGCAGGGAA
AGGCGTAGGAGGAGGAGCAGGAGTTCTTCCAGATCGCCAAGAACATCAAAAACCATAAAA
AGGAAATCTTCTAGATCTCCGTCCCCCAGGAGCAGAAATAAGAAGGATAAAAAGAGAGAA
AAAGAAAGGGACCACATCAGTGAAAGAAGAGAGAGAGAACGTTCAACGTCTATGAGAAAG
AGTTCTAATGATAGAGATGGGAAGGAGAAGTTGGAGAAGAACAGTACTTCACTTAAAGAG
AAAGAGCACAATAAAGAACCAGATTCAAGTGTGAGCAAAGAAGTAGATGACAAGGATGCA
CCAAGGACTGAGGAAAACAAAATACAGCACAATGGGAATTGTCAGCTGAATGAAGAAAAC
CTCTCTACCAAAACAGAAGCAGTA

The protein sequence

Download
Length: 508 aa
MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSK
IDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVP
RALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPE
SGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHK
KRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDREKEREREKEREKEKERGKNKD
RDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKEIDEKRKKDKK
SRTPPRSYNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKRE
KERDHISERRERERSTSMRKSSNDRDGKEKLEKNSTSLKEKEHNKEPDSSVSKEVDDKDA
PRTEENKIQHNGNCQLNEENLSTKTEAV
Order ORFeome clone(s) from Japan || Other countries
Send a message to office AT kazusa.or.jp