[UP]
[1][TOP] >UniRef100_C6THZ9 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=C6THZ9_SOYBN Length = 176 Score = 156 bits (395), Expect = 3e-36 Identities = 87/141 (61%), Positives = 105/141 (74%), Gaps = 9/141 (6%) Frame = -1 Query: 643 MLLRSSSTPVLGSLLSSSSFTDSPIHHNHSLHPESCHALKHLPL----QHHH-----HSN 491 M+LRSSSTPVLGSLLSS FTDSP N+++H E+CHALKH P QH+H + Sbjct: 1 MMLRSSSTPVLGSLLSS--FTDSP---NNNIHSETCHALKHFPPTTVPQHYHKLTFHQTG 55 Query: 490 KISCSSSPISPSISDLERQKKGLVRRVQSEGNLEDLAFATCNNNEDRFNYMDSSSKRYSV 311 +C SSPISPSI +LERQ KGL+RRVQS+GNL+DLAF +C NNE+RF + D SKR+S Sbjct: 56 SSACGSSPISPSIGELERQNKGLIRRVQSDGNLQDLAFFSC-NNEERFEFSD-PSKRFSA 113 Query: 310 RQRCLALETIPSFTLSKHTGL 248 R R L LETIPSF+ +KH GL Sbjct: 114 RHRSLVLETIPSFSTAKHNGL 134 [2][TOP] >UniRef100_B9SKM5 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9SKM5_RICCO Length = 373 Score = 118 bits (295), Expect = 1e-24 Identities = 73/133 (54%), Positives = 93/133 (69%), Gaps = 7/133 (5%) Frame = -1 Query: 643 MLLRSSSTPVLGSLLSSSSFTDSPIHHNHSLHPESCHALKHLPLQHHHHS--NKI---SC 479 MLLRSSSTPVLGSLLSS F+DSP ++N++ H +S L P HHH N+I SC Sbjct: 1 MLLRSSSTPVLGSLLSS--FSDSPNNNNNNHHHQS---LNKSPFHHHHIGCVNQITINSC 55 Query: 478 SSSPISPSISDLE--RQKKGLVRRVQSEGNLEDLAFATCNNNEDRFNYMDSSSKRYSVRQ 305 SSSPISPSI++ ++GL RR SEGNLE+LAF++CN+N + + S K+ S RQ Sbjct: 56 SSSPISPSIAEFSDYNSRRGL-RRAHSEGNLEELAFSSCNSNSNADCPISSQPKKISGRQ 114 Query: 304 RCLALETIPSFTL 266 +CL LETIPSF+L Sbjct: 115 KCLMLETIPSFSL 127 [3][TOP] >UniRef100_B6ECZ5 LacZ alpha n=1 Tax=Cloning vector pMAK28 RepID=B6ECZ5_9ZZZZ Length = 121 Score = 105 bits (262), Expect = 9e-21 Identities = 51/56 (91%), Positives = 51/56 (91%) Frame = +1 Query: 769 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWKL 936 NSLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEWKL Sbjct: 66 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWKL 121 [4][TOP] >UniRef100_B9GRD4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GRD4_POPTR Length = 390 Score = 105 bits (261), Expect = 1e-20 Identities = 68/144 (47%), Positives = 86/144 (59%), Gaps = 13/144 (9%) Frame = -1 Query: 643 MLLRSSSTPVLGSLLSSSSFTDSPIHHNHSLHPESCHALKHLPLQHHHHSNK-------- 488 MLLRSSSTPVLGSLLSS F+DSP + + + H + KH P+ HH NK Sbjct: 1 MLLRSSSTPVLGSLLSS--FSDSPNNSSSNHHHDINPTFKHSPI-HHQSINKLPYHQTGC 57 Query: 487 -----ISCSSSPISPSISDLERQKKGLVRRVQSEGNLEDLAFATCNNNEDRFNYMDSSSK 323 ISC+SSPISPSIS+ + RR QSEGNL+ L + NNN D +Y + ++ Sbjct: 58 FCLSTISCNSSPISPSISEFSGRSHQGFRRAQSEGNLQGLLDYSSNNN-DAQHYNPNQTR 116 Query: 322 RYSVRQRCLALETIPSFTLSKHTG 251 + S R +CL LETIPSF+ S G Sbjct: 117 KVSGRSKCLMLETIPSFSYSTLRG 140 [5][TOP] >UniRef100_Q47522 LacZ protein (Fragment) n=1 Tax=Escherichia coli RepID=Q47522_ECOLX Length = 81 Score = 102 bits (255), Expect = 6e-20 Identities = 49/55 (89%), Positives = 50/55 (90%) Frame = +1 Query: 769 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 NSLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 4 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 58 [6][TOP] >UniRef100_Q8VNN2 Beta-galactosidase n=1 Tax=Escherichia coli RepID=BGAL_ECOLX Length = 1029 Score = 102 bits (255), Expect = 6e-20 Identities = 49/55 (89%), Positives = 50/55 (90%) Frame = +1 Query: 769 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 NSLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 11 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 65 [7][TOP] >UniRef100_C5A125 Tryptophan synthase alpha chain n=1 Tax=Escherichia coli BW2952 RepID=C5A125_ECOBW Length = 1080 Score = 102 bits (254), Expect = 8e-20 Identities = 51/63 (80%), Positives = 55/63 (87%) Frame = +1 Query: 745 SDPRVPSSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNG 924 SDP + ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNG Sbjct: 55 SDP-LAITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 113 Query: 925 EWK 933 EW+ Sbjct: 114 EWR 116 [8][TOP] >UniRef100_UPI0001B5303F beta-D-galactosidase n=1 Tax=Shigella sp. D9 RepID=UPI0001B5303F Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [9][TOP] >UniRef100_UPI0001B525AD beta-D-galactosidase n=1 Tax=Escherichia sp. 4_1_40B RepID=UPI0001B525AD Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [10][TOP] >UniRef100_B7NK11 Beta-D-galactosidase n=1 Tax=Escherichia coli IAI39 RepID=B7NK11_ECO7I Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [11][TOP] >UniRef100_B7MPB1 Beta-D-galactosidase n=1 Tax=Escherichia coli ED1a RepID=B7MPB1_ECO81 Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [12][TOP] >UniRef100_B7L500 Beta-D-galactosidase n=1 Tax=Escherichia coli 55989 RepID=B7L500_ECO55 Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [13][TOP] >UniRef100_B6HZX0 Beta-D-galactosidase LacZ n=1 Tax=Escherichia coli SE11 RepID=B6HZX0_ECOSE Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [14][TOP] >UniRef100_C8UID7 Beta-D-galactosidase LacZ n=1 Tax=Escherichia coli O111:H- str. 11128 RepID=C8UID7_ECO11 Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [15][TOP] >UniRef100_C8TIU3 Beta-D-galactosidase LacZ n=1 Tax=Escherichia coli O26:H11 str. 11368 RepID=C8TIU3_ECOLX Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [16][TOP] >UniRef100_Q47340 LacZ 5'-region (Fragment) n=2 Tax=Escherichia coli RepID=Q47340_ECOLX Length = 147 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [17][TOP] >UniRef100_B2NAF2 Beta-galactosidase n=1 Tax=Escherichia coli 53638 RepID=B2NAF2_ECOLX Length = 1048 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [18][TOP] >UniRef100_Q3Z583 Beta-galactosidase n=1 Tax=Shigella sonnei Ss046 RepID=BGAL_SHISS Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [19][TOP] >UniRef100_Q1RFJ2 Beta-galactosidase n=2 Tax=Escherichia coli RepID=BGAL_ECOUT Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [20][TOP] >UniRef100_B7N8Q1 Beta-galactosidase n=1 Tax=Escherichia coli UMN026 RepID=BGAL_ECOLU Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [21][TOP] >UniRef100_P00722 Beta-galactosidase n=6 Tax=Escherichia coli RepID=BGAL_ECOLI Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [22][TOP] >UniRef100_B1J0T5 Beta-galactosidase n=1 Tax=Escherichia coli ATCC 8739 RepID=BGAL_ECOLC Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [23][TOP] >UniRef100_Q8FKG6 Beta-galactosidase n=2 Tax=Escherichia coli RepID=BGAL_ECOL6 Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [24][TOP] >UniRef100_Q0TKT1 Beta-galactosidase n=1 Tax=Escherichia coli 536 RepID=BGAL_ECOL5 Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [25][TOP] >UniRef100_A1A831 Beta-galactosidase n=1 Tax=Escherichia coli APEC O1 RepID=BGAL_ECOK1 Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [26][TOP] >UniRef100_A7ZWZ1 Beta-galactosidase n=1 Tax=Escherichia coli HS RepID=BGAL_ECOHS Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [27][TOP] >UniRef100_A7ZI91 Beta-galactosidase n=1 Tax=Escherichia coli E24377A RepID=BGAL_ECO24 Length = 1024 Score = 101 bits (251), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [28][TOP] >UniRef100_B7UJI9 Beta-galactosidase n=1 Tax=Escherichia coli O127:H6 str. E2348/69 RepID=BGAL_ECO27 Length = 1024 Score = 100 bits (250), Expect = 2e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 60 [29][TOP] >UniRef100_Q37953 LacZ protein (Fragment) n=1 Tax=Phage M13mp18 RepID=Q37953_BPM13 Length = 102 Score = 100 bits (248), Expect = 4e-19 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +1 Query: 763 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 +S +LAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 22 ASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78 [30][TOP] >UniRef100_O21999 LacZ-alpha n=1 Tax=Cloning vector pAL-Z RepID=O21999_9ZZZZ Length = 154 Score = 100 bits (248), Expect = 4e-19 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +1 Query: 763 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 +S +LAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 37 TSLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 93 [31][TOP] >UniRef100_C8U237 Beta-D-galactosidase LacZ n=1 Tax=Escherichia coli O103:H2 str. 12009 RepID=C8U237_ECOLX Length = 1024 Score = 99.8 bits (247), Expect = 5e-19 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SL VVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLVVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [32][TOP] >UniRef100_C3TMY5 Beta-D-galactosidase n=1 Tax=Escherichia coli RepID=C3TMY5_ECOLX Length = 1024 Score = 99.0 bits (245), Expect = 8e-19 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [33][TOP] >UniRef100_Q32JB6 Beta-galactosidase n=1 Tax=Shigella dysenteriae Sd197 RepID=BGAL_SHIDS Length = 1024 Score = 99.0 bits (245), Expect = 8e-19 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [34][TOP] >UniRef100_B5Z2P7 Beta-galactosidase n=3 Tax=Escherichia coli RepID=BGAL_ECO5E Length = 1024 Score = 99.0 bits (245), Expect = 8e-19 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [35][TOP] >UniRef100_Q8X685 Beta-galactosidase n=3 Tax=Escherichia coli RepID=BGAL_ECO57 Length = 1024 Score = 99.0 bits (245), Expect = 8e-19 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [36][TOP] >UniRef100_B3A811 Beta-galactosidase n=1 Tax=Escherichia coli O157:H7 str. EC4401 RepID=B3A811_ECO57 Length = 1024 Score = 97.8 bits (242), Expect = 2e-18 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEART+RPSQQLRS+NGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSVNGEWQ 60 [37][TOP] >UniRef100_B1LIM9 Beta-galactosidase n=1 Tax=Escherichia coli SMS-3-5 RepID=BGAL_ECOSM Length = 1024 Score = 97.8 bits (242), Expect = 2e-18 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHP FA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPHFASWRNSEEARTDRPSQQLRSLNGEWR 60 [38][TOP] >UniRef100_A7KGA5 Beta-galactosidase n=1 Tax=Klebsiella pneumoniae RepID=BGAL2_KLEPN Length = 1024 Score = 97.8 bits (242), Expect = 2e-18 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQ+ RSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQESRSLNGEWR 60 [39][TOP] >UniRef100_A6TI29 Beta-galactosidase 2 n=1 Tax=Klebsiella pneumoniae subsp. pneumoniae MGH 78578 RepID=BGAL2_KLEP7 Length = 1024 Score = 97.8 bits (242), Expect = 2e-18 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQ+ RSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQESRSLNGEWR 60 [40][TOP] >UniRef100_Q8GEG0 Putative uncharacterized protein n=1 Tax=Erwinia amylovora RepID=Q8GEG0_ERWAM Length = 123 Score = 97.1 bits (240), Expect = 3e-18 Identities = 46/53 (86%), Positives = 47/53 (88%) Frame = +1 Query: 775 LAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 LAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLR LNGEW+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWR 120 [41][TOP] >UniRef100_B9U1H7 Beta-D-galactosidase n=1 Tax=Vaccinia virus GLV-1h68 RepID=B9U1H7_9POXV Length = 1019 Score = 95.9 bits (237), Expect = 7e-18 Identities = 45/51 (88%), Positives = 46/51 (90%) Frame = +1 Query: 781 VVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 VVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 5 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 55 [42][TOP] >UniRef100_C7LLM9 Beta-galactosidase, chain D n=1 Tax=Mycoplasma mycoides subsp. capri str. GM12 RepID=C7LLM9_MYCML Length = 1027 Score = 95.9 bits (237), Expect = 7e-18 Identities = 45/51 (88%), Positives = 46/51 (90%) Frame = +1 Query: 781 VVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 VVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSLNGEW+ Sbjct: 13 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 63 [43][TOP] >UniRef100_B2G3R5 Putative puroindoline b protein n=1 Tax=Triticum aestivum subsp. macha RepID=B2G3R5_WHEAT Length = 228 Score = 95.9 bits (237), Expect = 7e-18 Identities = 46/52 (88%), Positives = 47/52 (90%) Frame = +2 Query: 761 RARIHWPSFYNVVTGXTLALPNLIALQHIPLSPSWRIAKRPAPIALPNSCAA 916 R IHWPSFYNVVTG TLALPNLIALQHIPLSP+ IAKRPAPIALPNSCAA Sbjct: 177 RITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 228 [44][TOP] >UniRef100_B7M2Z2 Beta-D-galactosidase n=1 Tax=Escherichia coli IAI1 RepID=B7M2Z2_ECO8A Length = 1024 Score = 95.1 bits (235), Expect = 1e-17 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEART RPS QLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTVRPSPQLRSLNGEWQ 60 [45][TOP] >UniRef100_Q47336 LacZ-alpha peptide n=1 Tax=Escherichia coli RepID=Q47336_ECOLX Length = 90 Score = 91.3 bits (225), Expect = 2e-16 Identities = 45/50 (90%), Positives = 45/50 (90%) Frame = +1 Query: 769 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSL 918 NSLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSL Sbjct: 20 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 [46][TOP] >UniRef100_B6FNW7 Putative uncharacterized protein n=1 Tax=Clostridium nexile DSM 1787 RepID=B6FNW7_9CLOT Length = 173 Score = 91.3 bits (225), Expect = 2e-16 Identities = 45/50 (90%), Positives = 45/50 (90%) Frame = +1 Query: 769 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSL 918 NSLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRSL Sbjct: 21 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 70 [47][TOP] >UniRef100_B3B2R7 Beta-galactosidase n=1 Tax=Escherichia coli O157:H7 str. EC4501 RepID=B3B2R7_ECO57 Length = 1024 Score = 90.1 bits (222), Expect = 4e-16 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++S AVVLQRRD NPGVTQ+NRLAAHPPFA SEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSSAVVLQRRDRENPGVTQVNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [48][TOP] >UniRef100_C7WM90 LacZ alpha protein (Fragment) n=1 Tax=Enterococcus faecalis AR01/DG RepID=C7WM90_ENTFA Length = 52 Score = 89.7 bits (221), Expect = 5e-16 Identities = 44/49 (89%), Positives = 44/49 (89%) Frame = +1 Query: 769 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRS 915 NSLAVVLQRRDW NPGVTQLNRLAAHPPFA SEEARTDRPSQQLRS Sbjct: 4 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 52 [49][TOP] >UniRef100_UPI0000ECC20B UPI0000ECC20B related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECC20B Length = 89 Score = 89.0 bits (219), Expect = 9e-16 Identities = 49/66 (74%), Positives = 49/66 (74%), Gaps = 9/66 (13%) Frame = +1 Query: 748 DPRVPSSNS---------LAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPS 900 DPRVPSSNS LAVVLQRRDW NPGVTQLNRLAAH FA SEEARTDRPS Sbjct: 3 DPRVPSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHLSFASWRNSEEARTDRPS 62 Query: 901 QQLRSL 918 QQLR L Sbjct: 63 QQLRRL 68 [50][TOP] >UniRef100_B1EKX4 Beta-galactosidase (Lactase) n=1 Tax=Escherichia albertii TW07627 RepID=B1EKX4_9ESCH Length = 1020 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/56 (67%), Positives = 43/56 (76%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 ++SLAVVL RRDW NP VTQLNRL AHPPF+ SEEAR + PS LRSLNG W+ Sbjct: 3 TDSLAVVLARRDWENPDVTQLNRLTAHPPFSSWRNSEEARDNHPSHSLRSLNGNWQ 58 [51][TOP] >UniRef100_UPI0000ECAFAB UPI0000ECAFAB related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECAFAB Length = 81 Score = 65.1 bits (157), Expect(2) = 2e-13 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 770 IHWPSFYNVVTGXTLALPNLIALQHIPLSPS 862 IHWPSFYNVVTG TLALPNLIALQHIPLSP+ Sbjct: 2 IHWPSFYNVVTGKTLALPNLIALQHIPLSPA 32 Score = 36.6 bits (83), Expect(2) = 2e-13 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +1 Query: 844 HPPFAQLAYSEEARTDRPSQQLRSLNGEWKL 936 H P + EEARTDRPSQQLRS EW++ Sbjct: 26 HIPLSPAGVIEEARTDRPSQQLRS---EWRM 53 [52][TOP] >UniRef100_UPI0000ECBAF8 UPI0000ECBAF8 related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECBAF8 Length = 85 Score = 80.1 bits (196), Expect = 4e-13 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 770 IHWPSFYNVVTGXTLALPNLIALQHIPLSPSWRIAKRPAPIA 895 IHWPSFYNVVTG TLALPNLIALQHIPLSP+ IAKRPAPIA Sbjct: 2 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIA 43 [53][TOP] >UniRef100_C1M7F7 Beta-D-galactosidase n=1 Tax=Citrobacter sp. 30_2 RepID=C1M7F7_9ENTR Length = 1029 Score = 79.3 bits (194), Expect = 7e-13 Identities = 35/57 (61%), Positives = 46/57 (80%) Frame = +1 Query: 763 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 +++SL+ VL RRDW NPGVTQLNRL AHPPF +++ART++ S QLRSLNG+W+ Sbjct: 4 NTDSLSAVLARRDWENPGVTQLNRLEAHPPFCSWRSADDARTNQRSSQLRSLNGQWQ 60 [54][TOP] >UniRef100_B3MYN1 GF22178 n=1 Tax=Drosophila ananassae RepID=B3MYN1_DROAN Length = 223 Score = 67.4 bits (163), Expect(2) = 1e-12 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGYH GGGGYNGGGGYH GGGGG + GGGGG Sbjct: 72 GGYHGGGGGYNGGGGYHGGGGGGNYGGGGGG 102 Score = 31.2 bits (69), Expect(2) = 1e-12 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GGG G G G Sbjct: 134 GGGGGGYGGGGGGGYHGGGGGGYPG 158 Score = 58.2 bits (139), Expect(2) = 1e-08 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 6/37 (16%) Frame = +2 Query: 74 GGYHNGGGGYN-GGGGYHNG-----GGGGYHNGGGGG 166 GG++ GGGGYN GGGGYH G GGGGYH GGGGG Sbjct: 58 GGFNGGGGGYNGGGGGYHGGGGGYNGGGGYHGGGGGG 94 Score = 27.3 bits (59), Expect(2) = 1e-08 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGG G GGG G G Sbjct: 89 GGGGGGNYGGGGGGYHGGGGGG 110 Score = 57.4 bits (137), Expect(2) = 1e-08 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 2/34 (5%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHN--GGGGGYHNGGGGGE 169 GG +NGGGGY+GGGG N GGGGGYH GGGGG+ Sbjct: 78 GGGYNGGGGYHGGGGGGNYGGGGGGYHGGGGGGK 111 Score = 27.7 bits (60), Expect(2) = 1e-08 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG G GGG G G G Sbjct: 142 GGGGGGYHGGGGGGYPGGGGGGYHG 166 Score = 54.3 bits (129), Expect(2) = 3e-08 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Frame = +2 Query: 20 IY*SYGFRGRRYR*ARYRGGYHNGGGGYNGGGG--YHNGGGGGYHNGGGGG 166 +Y S G G R+ G GGGGY+GGGG Y GGGGGYH GGGGG Sbjct: 121 VYSSGGGGGHRWGGGGGGGYGGGGGGGYHGGGGGGYPGGGGGGYHGGGGGG 171 Score = 29.6 bits (65), Expect(2) = 3e-08 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGGGGG G S ++ S Sbjct: 177 GGGGGGGGGAGSWASSSANS 196 Score = 55.1 bits (131), Expect(2) = 2e-07 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 89 GGGGYNGGGGYHNGGGGGYHNGGGG 163 GGGG+NGGGG +NGGGGGYH GGGG Sbjct: 56 GGGGFNGGGGGYNGGGGGYHGGGGG 80 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 174 GGGGGGGGGRGGGRS 218 GGGGG GG GGG++ Sbjct: 98 GGGGGYHGGGGGGKT 112 Score = 50.8 bits (120), Expect(2) = 8e-07 Identities = 23/34 (67%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = +2 Query: 74 GGYHNGGGGY---NGGGGYHNGGGGGYHNGGGGG 166 GGYH GGGG GGGGYH GGGGG GGGG Sbjct: 146 GGYHGGGGGGYPGGGGGGYHGGGGGGGPQWGGGG 179 Score = 28.1 bits (61), Expect(2) = 8e-07 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGGGGG G + +S + Sbjct: 176 GGGGGGGGGGAGSWASSSAN 195 [55][TOP] >UniRef100_A5ADY0 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5ADY0_VITVI Length = 383 Score = 78.2 bits (191), Expect = 2e-12 Identities = 56/141 (39%), Positives = 80/141 (56%), Gaps = 5/141 (3%) Frame = -1 Query: 676 LSSNIINHSENMLLRSSSTPVLGSLLSSSSFT-DSPIHHNHSLHPESCHALKHLPLQHHH 500 L++ + MLLRSSSTPVLGSLL S + ++ + + HP S H L H Sbjct: 49 LATKAVVRRREMLLRSSSTPVLGSLLPCHSESPNNNLSDATAKHPPSTIYQAHNKLSLHQ 108 Query: 499 ----HSNKISCSSSPISPSISDLERQKKGLVRRVQSEGNLEDLAFATCNNNEDRFNYMDS 332 + + +S +SSPISPS++ R RR QS+GNL+ LA+A+CNNN++ + Sbjct: 109 TGSLNLSPVSFNSSPISPSVNAGHRG----FRRAQSDGNLKGLAYASCNNNDELST--PN 162 Query: 331 SSKRYSVRQRCLALETIPSFT 269 SK+ S R L+TIPSF+ Sbjct: 163 LSKKSSQRPSRSMLQTIPSFS 183 [56][TOP] >UniRef100_A8AKB8 Beta-galactosidase n=1 Tax=Citrobacter koseri ATCC BAA-895 RepID=BGAL_CITK8 Length = 1025 Score = 77.8 bits (190), Expect = 2e-12 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = +1 Query: 763 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEW 930 +++SLAVVL+ RDW NPGVTQLNRL AHPPF +++AR +R S Q RSLNGEW Sbjct: 4 NADSLAVVLKCRDWENPGVTQLNRLEAHPPFCSWRNADDARVNRDSAQKRSLNGEW 59 [57][TOP] >UniRef100_O22612 Dormancy-associated protein n=1 Tax=Pisum sativum RepID=O22612_PEA Length = 129 Score = 71.6 bits (174), Expect(2) = 3e-12 Identities = 30/35 (85%), Positives = 30/35 (85%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNG-----GGGGYHNGGGG 163 GGYHNGGGGYNGGGGYHNG GGGGYHNGGGG Sbjct: 57 GGYHNGGGGYNGGGGYHNGGGGYNGGGGYHNGGGG 91 Score = 25.8 bits (55), Expect(2) = 3e-12 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGGG--GGGGGRGGGRSRTSGSPGLQG 248 GGGG GGGG GG +G G G Sbjct: 88 GGGGYHNGGGGYNGGGGYHNGGGGYHG 114 Score = 70.9 bits (172), Expect(2) = 3e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGYHNGGGGYNGGGGYHN GGGGYHNGGGG Sbjct: 70 GGYHNGGGGYNGGGGYHN-GGGGYHNGGGG 98 Score = 23.5 bits (49), Expect(2) = 3e-11 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 174 GGGGGGGGGRGG 209 GGG GGGG GG Sbjct: 109 GGGYHGGGGHGG 120 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGYHNGGGGYNGGGGYHN GGGGYH GGG G Sbjct: 90 GGYHNGGGGYNGGGGYHN-GGGGYHGGGGHG 119 Score = 60.8 bits (146), Expect(2) = 3e-08 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = +2 Query: 74 GGYHNGGGGY-NGGGGYHNGGGGGYHNGGGG 163 GGYHNGGGGY NGGGGY+ GGGGYHNGGGG Sbjct: 83 GGYHNGGGGYHNGGGGYN--GGGGYHNGGGG 111 Score = 23.1 bits (48), Expect(2) = 3e-08 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGG GGG GG S + Sbjct: 108 GGGGYHGGGGHGGHGGASNN 127 Score = 54.7 bits (130), Expect(2) = 4e-07 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGGGYHNG-----GGGGYHNGGGG 163 A+Y GGY GGG Y+ GGGYHNG GGGGYHNGGGG Sbjct: 42 AKY-GGYGRGGG-YHNGGGYHNGGGGYNGGGGYHNGGGG 78 Score = 25.4 bits (54), Expect(2) = 4e-07 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGGG--GGGGGRGGGRSRTSGSPGLQG 248 GGGG GGGG GG +G G G Sbjct: 75 GGGGYNGGGGYHNGGGGYHNGGGGYNG 101 [58][TOP] >UniRef100_C2B186 Putative uncharacterized protein n=1 Tax=Citrobacter youngae ATCC 29220 RepID=C2B186_9ENTR Length = 1025 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = +1 Query: 763 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 +++SL+ VL RRDW NPGVTQLNRL AHPPF ++EAR ++PS RSLNG+W+ Sbjct: 4 NTDSLSAVLARRDWENPGVTQLNRLEAHPPFCSWRSADEARQNQPSPHQRSLNGKWR 60 [59][TOP] >UniRef100_UPI0001983B4B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983B4B Length = 370 Score = 76.6 bits (187), Expect = 5e-12 Identities = 55/130 (42%), Positives = 76/130 (58%), Gaps = 5/130 (3%) Frame = -1 Query: 643 MLLRSSSTPVLGSLLSSSSFT-DSPIHHNHSLHPESCHALKHLPLQHHH----HSNKISC 479 MLLRSSSTPVLGSLL S + ++ + + HP S H L H + + +S Sbjct: 1 MLLRSSSTPVLGSLLPCHSESPNNNLSDATAKHPPSTIYQAHNKLSLHQTGSLNLSPVSF 60 Query: 478 SSSPISPSISDLERQKKGLVRRVQSEGNLEDLAFATCNNNEDRFNYMDSSSKRYSVRQRC 299 +SSPISPS++ R RR QS+GNL+ LA+A+CNNN++ + SK+ S R Sbjct: 61 NSSPISPSVNAGHRG----FRRAQSDGNLKGLAYASCNNNDELST--PNLSKKSSQRPSR 114 Query: 298 LALETIPSFT 269 L+TIPSF+ Sbjct: 115 SMLQTIPSFS 124 [60][TOP] >UniRef100_P37703 Glycine-rich protein DC9.1 n=1 Tax=Daucus carota RepID=GRP9_DAUCA Length = 144 Score = 69.3 bits (168), Expect(2) = 1e-10 Identities = 29/35 (82%), Positives = 29/35 (82%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG-----GGGYHNGGGG 163 GGYHNGGGGYN GGGYHNGG GGGYHNGGGG Sbjct: 42 GGYHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGG 76 Score = 23.1 bits (48), Expect(2) = 1e-10 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +3 Query: 174 GGG---GGGGGGRGGGRSRTSGS 233 GGG GGGG GGG GS Sbjct: 93 GGGHHNGGGGYNNGGGHHGGGGS 115 Score = 69.3 bits (168), Expect = 7e-10 Identities = 29/35 (82%), Positives = 29/35 (82%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG-----GGGYHNGGGG 163 GGYHNGGGGYN GGGYHNGG GGGYHNGGGG Sbjct: 55 GGYHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGG 89 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/35 (80%), Positives = 29/35 (82%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG-----GGGYHNGGGG 163 GGYHNGGGGYN GGGYHNGG GGG+HNGGGG Sbjct: 68 GGYHNGGGGYNNGGGYHNGGGGYNNGGGHHNGGGG 102 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 4/34 (11%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGG----GGYHNGGGG 163 GGYHNGGGGYN GGG+HNGGG GG H+GGGG Sbjct: 81 GGYHNGGGGYNNGGGHHNGGGGYNNGGGHHGGGG 114 [61][TOP] >UniRef100_A9MQ82 Beta-galactosidase n=1 Tax=Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- RepID=BGAL_SALAR Length = 1025 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/58 (55%), Positives = 41/58 (70%) Frame = +1 Query: 760 PSSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 P +SLA VL RRDW NP VTQ NRL AHPPF +++A+ ++ + Q+RSLNG WK Sbjct: 3 PERDSLAAVLARRDWENPAVTQFNRLTAHPPFCSWRKADDAQRNQYAAQIRSLNGVWK 60 [62][TOP] >UniRef100_B4H321 GL13352 n=1 Tax=Drosophila persimilis RepID=B4H321_DROPE Length = 191 Score = 60.8 bits (146), Expect(2) = 1e-10 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G NGGGG+NGGGGY +GGGGG+HNGGGGG Sbjct: 102 GSGGNGGGGHNGGGGYPSGGGGGFHNGGGGG 132 Score = 31.2 bits (69), Expect(2) = 1e-10 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGGGGG GG + S S Sbjct: 128 GGGGGGGGGGGGSGAYASSS 147 Score = 55.1 bits (131), Expect(2) = 2e-08 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 2/32 (6%) Frame = +2 Query: 74 GGYHNGGGGY--NGGGGYHNGGGGGYHNGGGG 163 GG HNGGGGY GGGG+HNGGGGG GGGG Sbjct: 108 GGGHNGGGGYPSGGGGGFHNGGGGGGGGGGGG 139 Score = 29.3 bits (64), Expect(2) = 2e-08 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGGGGG G S ++ S Sbjct: 131 GGGGGGGGGSGAYASSSANS 150 [63][TOP] >UniRef100_A2C5L0 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9303 RepID=A2C5L0_PROM3 Length = 202 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG + GGGGGY GGGGG Sbjct: 104 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGGG 134 Score = 34.7 bits (78), Expect(2) = 2e-10 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGG GGGG GGG R SG+ G + + Sbjct: 135 GGGGYGGGGGGGGGDRGSGARGWEDR 160 Score = 54.7 bits (130), Expect(2) = 2e-09 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 90 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 119 Score = 33.1 bits (74), Expect(2) = 2e-09 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 130 GGGGGGGGGYGGGGGGGGGDRG 151 Score = 54.7 bits (130), Expect(2) = 2e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 97 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 126 Score = 29.6 bits (65), Expect(2) = 2e-08 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGG GGGG GGG G G Sbjct: 123 GGGGYGGGGGGGGGGGYGGGGG 144 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = +2 Query: 89 GGGGYNGGGGYHNGGGGGYHNGGGG 163 GGGGY GGGG + GGGGGY GGGG Sbjct: 88 GGGGYGGGGGGYGGGGGGYGGGGGG 112 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GG GGGGGG GGG G G G Sbjct: 104 GGYGGGGGGYGGGGGGYGGGGGGYG 128 Score = 52.4 bits (124), Expect(2) = 7e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG GGGGGY GGGGG Sbjct: 118 GGYGGGGGGYGGGGG--GGGGGGYGGGGGGG 146 Score = 23.5 bits (49), Expect(2) = 7e-06 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGG G R S G Sbjct: 142 GGGGGGGDRGSGARGWEDRSYG 163 [64][TOP] >UniRef100_P11898 Glycine-rich protein HC1 n=1 Tax=Chenopodium rubrum RepID=GRP1_CHERU Length = 144 Score = 69.3 bits (168), Expect(2) = 2e-10 Identities = 29/35 (82%), Positives = 29/35 (82%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG-----GGGYHNGGGG 163 GGYHNGGGGYN GGGYHNGG GGGYHNGGGG Sbjct: 42 GGYHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGG 76 Score = 69.3 bits (168), Expect(2) = 2e-10 Identities = 29/35 (82%), Positives = 29/35 (82%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG-----GGGYHNGGGG 163 GGYHNGGGGYN GGGYHNGG GGGYHNGGGG Sbjct: 55 GGYHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGG 89 Score = 22.3 bits (46), Expect(2) = 2e-10 Identities = 11/22 (50%), Positives = 11/22 (50%), Gaps = 3/22 (13%) Frame = +3 Query: 174 GGG---GGGGGGRGGGRSRTSG 230 GGG GGGG GGG G Sbjct: 80 GGGYHNGGGGYNNGGGHHNGGG 101 Score = 22.3 bits (46), Expect(2) = 2e-10 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +3 Query: 174 GGG---GGGGGGRGGGRSRTSGS 233 GGG GGGG GGG GS Sbjct: 93 GGGHHNGGGGYNNGGGYHGGGGS 115 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/35 (80%), Positives = 29/35 (82%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG-----GGGYHNGGGG 163 GGYHNGGGGYN GGGYHNGG GGG+HNGGGG Sbjct: 68 GGYHNGGGGYNNGGGYHNGGGGYNNGGGHHNGGGG 102 Score = 62.8 bits (151), Expect = 7e-08 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 5/34 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG-----GGGYHNGGG 160 GGYHNGGGGYN GGG+HNGG GGGYH GGG Sbjct: 81 GGYHNGGGGYNNGGGHHNGGGGYNNGGGYHGGGG 114 [65][TOP] >UniRef100_C8Q3J9 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Pantoea sp. At-9b RepID=C8Q3J9_9ENTR Length = 1022 Score = 70.5 bits (171), Expect = 3e-10 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = +1 Query: 766 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEW 930 S SL+ +L RRDW NP +T LNRL AHPPFA + AR DRPS RSLNG+W Sbjct: 5 SVSLSEILARRDWENPVITSLNRLDAHPPFASWRDEQAARDDRPSPSRRSLNGQW 59 [66][TOP] >UniRef100_B3MV25 GF22854 n=1 Tax=Drosophila ananassae RepID=B3MV25_DROAN Length = 587 Score = 53.1 bits (126), Expect(2) = 3e-10 Identities = 30/54 (55%), Positives = 30/54 (55%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRRRRRRR 196 G R RR R GG GGGG GGGG GGGGG GGGGG R RR RR Sbjct: 80 GGRRRRGRGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFGRGRRNRR 133 Score = 37.4 bits (85), Expect(2) = 3e-10 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCLER 269 GGGGGGGGG GGGR R + S +P +R Sbjct: 136 GGGGGGGGGGGGGRGRQNSSWHNNDQPTSPQR 167 [67][TOP] >UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G232_9DELT Length = 136 Score = 56.6 bits (135), Expect(2) = 4e-10 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERR 178 GGY GGGGY GGGG GGGGGY GGGGG R Sbjct: 69 GGYGGGGGGYGGGGGGRGGGGGGYGGGGGGGRGGR 103 Score = 33.9 bits (76), Expect(2) = 4e-10 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGGG GGRGGG G G Sbjct: 103 RGGGGGGGRGGRGGGGGGYGGGGG 126 Score = 47.8 bits (112), Expect(2) = 2e-07 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG GGGG GGGG + GGGGGY GGGG Sbjct: 55 GGRGGGGGGRGGGGGGYGGGGGGYGGGGGG 84 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGG GGG GGGR G G Sbjct: 85 RGGGGGGYGGGGGGGRGGRGGGGG 108 Score = 47.8 bits (112), Expect(2) = 2e-07 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG GGGGY GGGG + GGGGG GGGG Sbjct: 62 GGRGGGGGGYGGGGGGYGGGGGGRGGGGGG 91 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 174 GGGGGGGGGRGGGR 215 GGGGGGGGG GGGR Sbjct: 122 GGGGGGGGGYGGGR 135 Score = 47.0 bits (110), Expect(2) = 7e-07 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +2 Query: 41 RGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 R R A RGG GGGG GGGG GGGGGY GGGG Sbjct: 39 RAIRVNEANERGG--GGGGGRGGGGGGRGGGGGGYGGGGGG 77 Score = 32.3 bits (72), Expect(2) = 7e-07 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGGGRGGG G G Sbjct: 76 GGYGGGGGGRGGGGGGYGGGGG 97 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGG GGGG + GGGGG G GGG Sbjct: 76 GGYGGGGGGRGGGGGGYGGGGGGGRGGRGGG 106 Score = 31.2 bits (69), Expect(2) = 1e-06 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPG 239 RGG GGGGGG GGR G G Sbjct: 100 RGGRGGGGGGGRGGRGGGGGGYG 122 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG + GGGGG Sbjct: 54 GGGRGGGGGGRGGGGGGYGGGGGGYGGGGGG 84 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGG GGRGGG G G Sbjct: 94 GGGGGGRGGRGGGGGGGRGGRG 115 [68][TOP] >UniRef100_B5DKG6 GA22867 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DKG6_DROPS Length = 191 Score = 60.8 bits (146), Expect(2) = 4e-10 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G NGGGG+NGGGGY +GGGGG+HNGGGGG Sbjct: 105 GNGGNGGGGHNGGGGYPSGGGGGFHNGGGGG 135 Score = 29.3 bits (64), Expect(2) = 4e-10 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGGGGG G S ++ S Sbjct: 131 GGGGGGGGGSGAYASSSANS 150 Score = 52.0 bits (123), Expect(2) = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = +2 Query: 74 GGYHNGGGGY--NGGGGYHNGGGGGYHNGGGGG 166 GG HNGGGGY GGGG+HNGGGGG GGG G Sbjct: 111 GGGHNGGGGYPSGGGGGFHNGGGGG--GGGGSG 141 Score = 25.4 bits (54), Expect(2) = 2e-06 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGG G S S S G Sbjct: 133 GGGGGGGSGAYASSSANSYSYG 154 [69][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 54.3 bits (129), Expect(2) = 7e-10 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = +2 Query: 74 GGYHNGGGGY--NGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGGY GGGGGY GGGGG Sbjct: 121 GGYGGGGGGYGGGGGGGYGGGGGGGYGGGGGGG 153 Score = 35.0 bits (79), Expect(2) = 7e-10 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGG GGG GGG R SG+ G + + Sbjct: 157 GGGGGYGGGGGGGGDRPSGARGWEDR 182 Score = 49.3 bits (116), Expect(2) = 6e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG GGGGY GGGG + GGGGG + GGGGG Sbjct: 116 RGG---GGGGYGGGGGGYGGGGGGGYGGGGGG 144 Score = 30.0 bits (66), Expect(2) = 6e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGG G GGG G G G Sbjct: 139 GGGGGGGYGGGGGGGYGGGGGGGYG 163 Score = 52.0 bits (123), Expect(2) = 9e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = +2 Query: 74 GGYHNGGGGY---NGGGGYHNGGGGGYHNGGGGGEER 175 GGY GGGG GGGGY GGGGGY GGGGG +R Sbjct: 136 GGYGGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGGDR 172 Score = 23.5 bits (49), Expect(2) = 9e-06 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGG G R S G Sbjct: 164 GGGGGGGDRPSGARGWEDRSYG 185 [70][TOP] >UniRef100_B0S6Z1 Novel protein similar to vertebrate DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DHX9) n=1 Tax=Danio rerio RepID=B0S6Z1_DANRE Length = 1271 Score = 57.0 bits (136), Expect(2) = 9e-10 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGGY GGGGGY GGGGG Sbjct: 1191 GGYRGGGGGYRGGGGY-QGGGGGYRGGGGGG 1220 Score = 32.0 bits (71), Expect(2) = 9e-10 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGR 215 R GGGGGGGGG GG R Sbjct: 1253 RGGGGGGGGGGWGGNR 1268 Score = 52.0 bits (123), Expect(2) = 5e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEER 175 GGY GGG GGGGY GGGGGY GGGG R Sbjct: 1198 GGYRGGGGYQGGGGGYRGGGGGGYRGYGGGGGYR 1231 Score = 27.7 bits (60), Expect(2) = 5e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 177 GGGGGGGGRGGGRSR 221 GGGGGGGG G G +R Sbjct: 1254 GGGGGGGGGGWGGNR 1268 [71][TOP] >UniRef100_B4FTV4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FTV4_MAIZE Length = 196 Score = 53.1 bits (126), Expect(2) = 1e-09 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = +2 Query: 29 SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 S G +G ++ GG + GGGGY G GG GGGGGY GGGGG Sbjct: 23 SRGLQGDHVAEQKFGGGGYGGGGGYGGYGGGGGGGGGGYGGGGGGG 68 Score = 35.8 bits (81), Expect(2) = 1e-09 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVC 260 GGGGGGGGG GGG T PG G C Sbjct: 63 GGGGGGGGGYGGGGGYT---PGYSGTGTC 88 [72][TOP] >UniRef100_UPI0000E491FD PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E491FD Length = 116 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY +GGGG GGGG GGGGGY +GGGGG Sbjct: 43 GGYSSGGGGGGGGGGDSGGGGGGYSSGGGGG 73 Score = 35.0 bits (79), Expect(2) = 1e-09 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG SG G Sbjct: 91 GGGGGGGGGGGGGGGGDSGGGG 112 Score = 53.5 bits (127), Expect(2) = 2e-09 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY +GGGG GGGG GGGGGY +GGGGG Sbjct: 64 GGYSSGGGGGGGGGGDSGGGGGGYSSGGGGG 94 Score = 34.7 bits (78), Expect(2) = 2e-09 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG S G G Sbjct: 94 GGGGGGGGGGGGGDSGGGGGGG 115 Score = 49.3 bits (116), Expect(2) = 4e-08 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 80 YHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 Y +GGGG GGGG GGGGGY +GGGGG Sbjct: 24 YSSGGGGSGGGGGDSGGGGGGYSSGGGGG 52 Score = 34.3 bits (77), Expect(2) = 4e-08 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG + G G Sbjct: 92 GGGGGGGGGGGGGGGDSGGGGG 113 [73][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 55.5 bits (132), Expect(2) = 2e-09 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG+ GGGGY GGGGY GGGGGY GGGG Sbjct: 96 GGFGGGGGGYGGGGGYGGGGGGGYGGGGGG 125 Score = 32.7 bits (73), Expect(2) = 2e-09 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 174 GGGGGGGGGRGGGRS 218 GGGGGG GG GGGRS Sbjct: 141 GGGGGGSGGGGGGRS 155 Score = 50.1 bits (118), Expect(2) = 2e-07 Identities = 27/51 (52%), Positives = 32/51 (62%) Frame = +2 Query: 14 LRIY*SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 LR+ S+G RG GG+ GGGG+ GGGG + GGGGGY GGGGG Sbjct: 72 LRVEVSHGRRGGA---GGGGGGFGGGGGGFGGGGGGY-GGGGGYGGGGGGG 118 Score = 30.8 bits (68), Expect(2) = 2e-07 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGGG GGG + G G Sbjct: 131 GGYGGGGGGYGGGGGGSGGGGG 152 Score = 50.1 bits (118), Expect(2) = 3e-07 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG + GGGGY GGGG GGGGG + GGGGG Sbjct: 102 GGGYGGGGGYGGGGGGGYGGGGGGYGGGGGG 132 Score = 50.1 bits (118), Expect(2) = 3e-07 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 74 GGYHNGGGG-YNGGGGYHNGGGGGYHNGGGG 163 GGY GGGG Y GGGG + GGGGGY GGGG Sbjct: 109 GGYGGGGGGGYGGGGGGYGGGGGGYGGGGGG 139 Score = 30.4 bits (67), Expect(2) = 3e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GG GGGGGG GGG G G G Sbjct: 124 GGYGGGGGGYGGGGGGYGGGGGGSG 148 Score = 30.4 bits (67), Expect(2) = 3e-07 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKP 254 GGGGGG GG GGG G L P Sbjct: 134 GGGGGGYGGGGGGSGGGGGGRSLGPNP 160 [74][TOP] >UniRef100_B7LML8 Beta-galactosidase (Lactase) n=1 Tax=Escherichia fergusonii ATCC 35469 RepID=B7LML8_ESCF3 Length = 1077 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/57 (52%), Positives = 42/57 (73%) Frame = +1 Query: 763 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 +++SLA VL RRDW NP ++QLNRLAAHP F+ +E+AR + S + +LNGEW+ Sbjct: 59 NTDSLAAVLHRRDWENPAISQLNRLAAHPSFSSWRSAEDARNNLTSGSVLNLNGEWR 115 [75][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 45.4 bits (106), Expect(2) = 3e-09 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP+ PPPP PPPP PP Sbjct: 146 PPPPPPPPPPPPPMAGPPPPPGPPPPHPPPP 176 Score = 42.0 bits (97), Expect(2) = 3e-09 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P PG P+ PPP PPPPPPPPP Sbjct: 130 PVLPGPPVGPPPPPPPPPPPPPPPP 154 Score = 41.6 bits (96), Expect(2) = 4e-07 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP+ PPPPP PPP PPPP PP Sbjct: 154 PPPPPMAGPPPPP---GPPPPHPPPPAGPPP 181 Score = 38.5 bits (88), Expect(2) = 4e-07 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP P P PPP PPPPPPPPP Sbjct: 132 LPGPPVGPPPPPPPPPPPPPPPPPPP 157 Score = 42.7 bits (99), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP+ PP Sbjct: 139 PPPPP---PPPPP---PPPPPPPPPPMAGPP 163 Score = 36.2 bits (82), Expect(2) = 8e-07 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -1 Query: 229 PLVLERPPPRPPPPPPPPP 173 P VL PP PPPPPPPPP Sbjct: 129 PPVLPGPPVGPPPPPPPPP 147 Score = 40.4 bits (93), Expect(2) = 4e-06 Identities = 18/31 (58%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPP P P PPP+ PPPP PPPP PP Sbjct: 201 PPPAPQGPPAPPPVEGPPPPKGPPPPPHSPP 231 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P+ PPP PPPP PPPP Sbjct: 152 PPPPPPPMAGPPPPPGPPPPHPPPP 176 [76][TOP] >UniRef100_A2SMG9 RNA-binding region RNP-1 n=1 Tax=Methylibium petroleiphilum PM1 RepID=A2SMG9_METPP Length = 162 Score = 53.9 bits (128), Expect(2) = 3e-09 Identities = 26/43 (60%), Positives = 27/43 (62%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GFRG Y GG GGGGY GGGG +GGGGGY GGGG Sbjct: 88 GFRGP------YGGGGAGGGGGYGGGGGGRSGGGGGYGGGGGG 124 Score = 33.5 bits (75), Expect(2) = 3e-09 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGG GG GGGRS G G Sbjct: 119 GGGGGGYGGGGGGRSGGGGGYG 140 Score = 51.6 bits (122), Expect(2) = 2e-08 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGG +GGGG + GGGGGY GGGG Sbjct: 102 GGYGGGGGGRSGGGGGYGGGGGGYGGGGGG 131 Score = 33.1 bits (74), Expect(2) = 2e-08 Identities = 16/27 (59%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGGG--GGGGGRGGGRSRTSGSPGLQG 248 GGGG GGGGG GGG R+ G G G Sbjct: 128 GGGGRSGGGGGYGGGGGRSGGGGGYGG 154 Score = 52.4 bits (124), Expect(2) = 4e-08 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG +GGGGGY GGGGG Sbjct: 116 GGYGGGGGGYGGGGGGRSGGGGGY--GGGGG 144 Score = 31.2 bits (69), Expect(2) = 4e-08 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGR GG G G +G Sbjct: 136 GGGYGGGGGRSGGGGGYGGGGGGRG 160 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG GGGGY GGGG + GGGGG GGGG Sbjct: 109 GGRSGGGGGYGGGGGGYGGGGGGRSGGGGG 138 Score = 29.6 bits (65), Expect(2) = 1e-06 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 171 RGGGGGGGGGRGGGR 215 R GGGGG GG GGGR Sbjct: 145 RSGGGGGYGGGGGGR 159 Score = 47.8 bits (112), Expect(2) = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG GGGGY GGGG +GGGGGY GGGG Sbjct: 130 GGRSGGGGGYGGGGG-RSGGGGGYGGGGGG 158 Score = 28.5 bits (62), Expect(2) = 5e-06 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 174 GGGGGGGGGRGG 209 GG GGGGGGRGG Sbjct: 150 GGYGGGGGGRGG 161 [77][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 47.8 bits (112), Expect(2) = 3e-09 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 SPPPPP PPPPP++ PPPP PPPP PP Y Sbjct: 437 SPPPPP---PPPPPVYSPPPPPPPPPP---PPVY 464 Score = 39.3 bits (90), Expect(2) = 3e-09 Identities = 24/70 (34%), Positives = 31/70 (44%) Frame = -1 Query: 358 EDRFNYMDSSSKRYSVRQRCLALETIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPP 179 +DR N + + S Q L P S G SP P+V PPP P PPPP Sbjct: 354 DDRRNCLPGRPAQRSPGQCKAFLSRPPVNCGSFSCGRSVSPRPPVVTPLPPPSLPSPPPP 413 Query: 178 PPLLSSSSTI 149 P+ S+ T+ Sbjct: 414 APIFSTPPTL 423 Score = 45.8 bits (107), Expect(2) = 6e-09 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP++ PPPPP PPPP+ PPP PP Y Sbjct: 489 PPPPPVYSPPPPPPPPPPPPVYSPPP---PPVY 518 Score = 40.4 bits (93), Expect(2) = 6e-09 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLS 164 P P P + PPP PPPPPPPPP+ S Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYS 481 Score = 49.3 bits (116), Expect(2) = 7e-09 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 SPPPPP PPPPP++ PPPP PPPP PP Y Sbjct: 465 SPPPPPPPPPPPPPVYSPPPPSPPPPP---PPVY 495 Score = 36.6 bits (83), Expect(2) = 7e-09 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLS 164 P P P + PPP PPPPPPPPP+ S Sbjct: 439 PPPPPPPPPVYSPPP-PPPPPPPPPVYS 465 Score = 45.8 bits (107), Expect(2) = 5e-08 Identities = 24/64 (37%), Positives = 29/64 (45%), Gaps = 19/64 (29%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW-------------------*PPPPL*PPPPL**PPRYRAYRYRRP 43 PPPPP++ PPPPP++ PPPP PPPP PP Y Y P Sbjct: 504 PPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSP 563 Query: 42 RNPY 31 P+ Sbjct: 564 PPPH 567 Score = 37.4 bits (85), Expect(2) = 5e-08 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLS 164 P P P + PPP PPPPPPPPP+ S Sbjct: 485 PSPPPPPPPVYSPPP-PPPPPPPPPVYS 511 Score = 45.8 bits (107), Expect(2) = 2e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 S PPPPP PPPPP++ PPPP PPPP PP Y Sbjct: 450 SPPPPPPP--PPPPPVYSPPPPPPPPPPP--PPVY 480 Score = 35.0 bits (79), Expect(2) = 2e-07 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -1 Query: 280 PSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPP---PPP 173 P F+ P P P + PPP PPPPPP PPP Sbjct: 415 PIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPP 453 Score = 45.1 bits (105), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP++ PPPPP PPPP PPPP+ PP Sbjct: 458 PPPPPVYSPPPPP---PPPP--PPPPVYSPP 483 Score = 35.0 bits (79), Expect(2) = 4e-07 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 7/32 (21%) Frame = -1 Query: 247 PCSPGDPLVLERPPP-------RPPPPPPPPP 173 P SP P+ PPP PPPPPPPPP Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -2 Query: 162 PPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPP PPPPP++ PPPP PPPP PP Y Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPP---PPVY 510 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 8/33 (24%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPP--------PPPPPPP 173 P P P V PPP PP PPPPPPP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPP 472 Score = 40.0 bits (92), Expect(2) = 6e-06 Identities = 19/31 (61%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPP---L*PPPP 88 S PPPPP PPPPP++ PPPP PPPP Sbjct: 496 SPPPPPPP--PPPPPVYSPPPPPVYSSPPPP 524 Score = 35.8 bits (81), Expect(2) = 6e-06 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPP 179 P P P V PPP PPPPPPP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPP 493 [78][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 45.1 bits (105), Expect(2) = 3e-09 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAY 58 PPPPP PPPPP PPPPL PPPP PP ++ Sbjct: 432 PPPPPPPPPPPPPPPPPPPPLLPPPP---PPSISSF 464 Score = 42.0 bits (97), Expect(2) = 3e-09 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 283 IPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 +P F LP +P + PPP PPPPPPPPP Sbjct: 401 LPQFYSQSQPSLPFAPLPQIQPPLPPPPPPPPPPPPP 437 [79][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 50.1 bits (118), Expect(2) = 3e-09 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 PPPPP + PPPPP + PPPP PPPP PP AY P P Sbjct: 293 PPPPPAYSPPPPPAYGPPPP--PPPPAYAPPPPPAYGPPAPPPP 334 Score = 37.0 bits (84), Expect(2) = 3e-09 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLS 164 P P P PP PPPPPPPPP S Sbjct: 273 PPPPPPPAAYAYGPPPPPPPPPPPPAYS 300 Score = 50.4 bits (119), Expect(2) = 1e-08 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP + PPPP PPPP PP Y Sbjct: 146 PPPPPAYGPPPPPAYGPPPPPPPPPP---PPAY 175 Score = 35.0 bits (79), Expect(2) = 1e-08 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P S G P PP PPPPPPPPP Sbjct: 126 PPSYGPPPPPAYGPPPPPPPPPPPP 150 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP + PPPP PPPP PP Y Sbjct: 169 PPPPPAYGPPPPPAYGPPPPPPPPPP---PPAY 198 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP + PPPP PPPP PP Y Sbjct: 192 PPPPPAYGPPPPPAYGPPPPPPPPPP---PPAY 221 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP + PPPP PPPP PP Y Sbjct: 215 PPPPPAYGPPPPPAYGPPPPPPPPPP---PPAY 244 Score = 33.9 bits (76), Expect(2) = 2e-08 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P + G P PP PPPPPPPPP Sbjct: 149 PPAYGPPPPPAYGPPPPPPPPPPPP 173 Score = 33.9 bits (76), Expect(2) = 2e-08 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P + G P PP PPPPPPPPP Sbjct: 172 PPAYGPPPPPAYGPPPPPPPPPPPP 196 Score = 33.9 bits (76), Expect(2) = 2e-08 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P + G P PP PPPPPPPPP Sbjct: 195 PPAYGPPPPPAYGPPPPPPPPPPPP 219 Score = 50.1 bits (118), Expect(2) = 4e-08 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP + PPPP PPPP PP Y Sbjct: 123 PPPPPSYGPPPPPAYGPPPPPPPPPP---PPAY 152 Score = 33.5 bits (75), Expect(2) = 4e-08 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -1 Query: 238 PGDPLVLERPPPR--PPPPPPPPP 173 P P PPP PPPPPPPPP Sbjct: 101 PPPPAYAPPPPPAYAPPPPPPPPP 124 Score = 46.2 bits (108), Expect(2) = 2e-07 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 PPPP + PPPPP + PPPP PPP PP AY Y P P Sbjct: 253 PPPPAAYGPPPPPAYGPPPP--PPP----PPPPAAYAYGPPPPP 290 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLS 164 P + G P PP PPPPPPPPP S Sbjct: 218 PPAYGPPPPPAYGPPPPPPPPPPPPAYS 245 Score = 47.4 bits (111), Expect(2) = 3e-07 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP + PP P PPPP PP Y Sbjct: 312 PPPPPAYAPPPPPAYGPPAPPPPPPP---PPAY 341 Score = 33.1 bits (74), Expect(2) = 3e-07 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = -1 Query: 247 PCSPGDPLVLERPPPR-----PPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 250 PPPPPPPAAYGPPPPPAYGPPPPPPPPPPP 279 Score = 50.4 bits (119), Expect(2) = 5e-07 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP + PPPP PPPP PP Y Sbjct: 100 PPPPPAYAPPPPPAYAPPPPPPPPPP---PPSY 129 Score = 29.3 bits (64), Expect(2) = 5e-07 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 241 SPGDPLVLERPPPRPPPPPPPPP 173 +P P+ PPP PPPPPP Sbjct: 82 APPPPVYAPPPPPPAYAPPPPPP 104 Score = 44.7 bits (104), Expect(2) = 1e-06 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP PPPP PPP PP Y Sbjct: 131 PPPPPAYGPPPPPPPPPPPPAYGPPP---PPAY 160 Score = 44.7 bits (104), Expect(2) = 1e-06 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP PPPP PPP PP Y Sbjct: 154 PPPPPAYGPPPPPPPPPPPPAYGPPP---PPAY 183 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 211 PPPRPPPPPPPP 176 PPP PPPPPPPP Sbjct: 116 PPPPPPPPPPPP 127 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 208 PPRPPPPPPPPP 173 PP PPPPPPPPP Sbjct: 116 PPPPPPPPPPPP 127 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 21/37 (56%), Positives = 24/37 (64%), Gaps = 4/37 (10%) Frame = -2 Query: 165 PPPPPLW*PPPPP-LW*PPPP---L*PPPPL**PPRY 67 PPPPP + PPPPP + PPPP PPPP PP+Y Sbjct: 335 PPPPPAYAPPPPPPAYAPPPPPPAYAPPPP---PPKY 368 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = -1 Query: 253 GLPCSPGDPLVLERPPPR-----PPPPPPPPP 173 G P P P PPP PPPPPPPPP Sbjct: 308 GPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPP 339 Score = 44.7 bits (104), Expect(2) = 6e-06 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP PPPP PPP PP Y Sbjct: 177 PPPPPAYGPPPPPPPPPPPPAYGPPP---PPAY 206 Score = 44.7 bits (104), Expect(2) = 6e-06 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP PPPP PPP PP Y Sbjct: 200 PPPPPAYGPPPPPPPPPPPPAYGPPP---PPAY 229 Score = 31.2 bits (69), Expect(2) = 6e-06 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPP Sbjct: 144 PPPPPPPAYGPPPPPAYGPPPPPPP 168 Score = 31.2 bits (69), Expect(2) = 6e-06 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPP Sbjct: 167 PPPPPPPAYGPPPPPAYGPPPPPPP 191 Score = 44.3 bits (103), Expect(2) = 8e-06 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPP-L*PPPPL**PPRYRAY 58 PPPPP + PPPPP PPPP PPPP PP AY Sbjct: 223 PPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAY 259 Score = 42.7 bits (99), Expect(2) = 8e-06 Identities = 21/42 (50%), Positives = 23/42 (54%), Gaps = 9/42 (21%) Frame = -2 Query: 165 PPPPPLW*PPPPP---------LW*PPPPL*PPPPL**PPRY 67 PPPPP + PPPPP + PPPP PPPP PP Y Sbjct: 261 PPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPP---PPAY 299 Score = 32.7 bits (73), Expect(2) = 8e-06 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPP 179 P P P PPP PPPPPPP Sbjct: 234 PPPPPPPPPAYSPPPPPPPPPPP 256 Score = 31.2 bits (69), Expect(2) = 8e-06 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPP Sbjct: 190 PPPPPPPAYGPPPPPAYGPPPPPPP 214 [80][TOP] >UniRef100_Q9XUW5 Protein F58E10.3a, confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q9XUW5_CAEEL Length = 561 Score = 48.1 bits (113), Expect(2) = 4e-09 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGGY GG G GGGGY G GGGY GGGGG Sbjct: 21 RGGYGGGGRG-GGGGGYSGGRGGGYGGGGGGG 51 Score = 38.5 bits (88), Expect(2) = 4e-09 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGG GGGGRGGGR ++GS G Sbjct: 53 GGGGYGGGGRGGGRGGSNGSAG 74 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 23/36 (63%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = +2 Query: 74 GGYHNGGGGYNG--GGGYHNGGGGGYHNGGGGGEER 175 GG GGGGY+G GGGY GGGGGY GG GG R Sbjct: 27 GGRGGGGGGYSGGRGGGYGGGGGGGYGGGGYGGGGR 62 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSG 230 GGGG GGGRGG G Sbjct: 58 GGGGRGGGRGGSNGSAGG 75 [81][TOP] >UniRef100_UPI000185F332 hypothetical protein BRAFLDRAFT_199348 n=1 Tax=Branchiostoma floridae RepID=UPI000185F332 Length = 260 Score = 52.4 bits (124), Expect(2) = 5e-09 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ GGGG+ GGGG+ GGGGG+ GGGGG Sbjct: 7 GGFGGGGGGFGGGGGFGAGGGGGFGGGGGGG 37 Score = 34.3 bits (77), Expect(2) = 5e-09 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPGLQG 248 +GGGGGGG RGGG SR G G+ G Sbjct: 40 KGGGGGGGFSRGGGGSR-GGGGGISG 64 [82][TOP] >UniRef100_A5GPV8 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. RCC307 RepID=A5GPV8_SYNR3 Length = 204 Score = 51.2 bits (121), Expect(2) = 5e-09 Identities = 23/34 (67%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = +2 Query: 71 RGGYHNGGGG---YNGGGGYHNGGGGGYHNGGGG 163 RGGY GGGG Y GGGG + GGGGGY GGGG Sbjct: 98 RGGYGGGGGGRGGYGGGGGGYGGGGGGYGGGGGG 131 Score = 35.4 bits (80), Expect(2) = 5e-09 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGG GG GGG R SG+ G + + Sbjct: 133 GGGGGGYGGGGGGGERASGARGWEDR 158 Score = 58.9 bits (141), Expect(2) = 1e-08 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGE 169 GGY GGGGY GGGG + GGGGGY GGGGGE Sbjct: 116 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGGGE 147 Score = 26.6 bits (57), Expect(2) = 1e-08 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 RR GGGGGG GG G+ G Sbjct: 181 RRRGGGGGGESSGGDWGDYGGAEG 204 Score = 57.0 bits (136), Expect(2) = 4e-08 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 6/41 (14%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGY------HNGGGGGEER 175 RGGY GGGGY GGGG + GGGGGY + GGGGG ER Sbjct: 108 RGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGGER 148 Score = 26.6 bits (57), Expect(2) = 4e-08 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +3 Query: 174 GGGGGGG---GGRGGGRSRTSGSPGLQGKP 254 GGGGGGG G G R+ G G G+P Sbjct: 140 GGGGGGGERASGARGWEDRSYGGGGGGGEP 169 [83][TOP] >UniRef100_B6SZ03 Meiosis 5 n=1 Tax=Zea mays RepID=B6SZ03_MAIZE Length = 194 Score = 53.1 bits (126), Expect(2) = 5e-09 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = +2 Query: 29 SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 S G +G ++ GG + GGGGY G GG GGGGGY GGGGG Sbjct: 22 SRGLQGDHVAEQKFGGGGYGGGGGYGGYGGGGGGGGGGYGGGGGGG 67 Score = 33.5 bits (75), Expect(2) = 5e-09 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPGLQGKPVC 260 GGGGGGGG GGG T PG G C Sbjct: 61 GGGGGGGGYGGGGGYT---PGYSGTGTC 85 [84][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 47.8 bits (112), Expect(2) = 5e-09 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 PPPPP PPPPP PPPP PPPPL PPR Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPR 103 Score = 38.9 bits (89), Expect(2) = 5e-09 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP P P PPP PPPPPPPPP Sbjct: 23 LPPRPPPPPPPPPPPPPPPPPPPPPP 48 Score = 43.1 bits (100), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 38.5 bits (88), Expect(2) = 1e-07 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 226 LVLERPPPRPPPPPPPPP 173 L+ RPPP PPPPPPPPP Sbjct: 22 LLPPRPPPPPPPPPPPPP 39 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 43.1 bits (100), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 229 PLVLERPPPRPPPPPPPPP 173 P +L PP PPPPPPPPP Sbjct: 20 PHLLPPRPPPPPPPPPPPP 38 [85][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 45.4 bits (106), Expect(2) = 6e-09 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPPL PPPPP PPPPL PPPP PP Sbjct: 1219 PPPPPL--PPPPP---PPPPLPPPPPPPPPP 1244 Score = 40.8 bits (94), Expect(2) = 6e-09 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPPL 170 +P P PL PPP PPPPPPPPPL Sbjct: 1199 VPAGPPPPLT-PPPPPLPPPPPPPPPL 1224 [86][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 50.4 bits (119), Expect(2) = 6e-09 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 S PPPPP PPPPP++ PPPP PPPP PP Y Sbjct: 299 SPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVY 333 Score = 35.8 bits (81), Expect(2) = 6e-09 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPP---PPPPPPLLS 164 P P P + PPP PPP PPPPPP+ S Sbjct: 269 PPPPSPPPPVYSPPPPPPPVYSPPPPPPVYS 299 Score = 43.1 bits (100), Expect(2) = 2e-07 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP++ PPPPP PPPP PPP PP Sbjct: 309 PPPPPVYSPPPPPS--PPPPSPPPPVYSPPP 337 Score = 38.1 bits (87), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -1 Query: 238 PGDPLVLERPPPRPPPPPPPPPLLS 164 P P V PPP P PPPPPPP+ S Sbjct: 292 PPPPPVYSPPPPPPSPPPPPPPVYS 316 Score = 41.6 bits (96), Expect(2) = 4e-07 Identities = 19/31 (61%), Positives = 20/31 (64%), Gaps = 5/31 (16%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL-----*PPPP 88 PPPPP PPPPPL+ PPPP PPPP Sbjct: 361 PPPPPNSPPPPPPLFSPPPPTPYYYSSPPPP 391 Score = 38.5 bits (88), Expect(2) = 4e-07 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLS 164 P P P+ PPP PPPP PPPP+ S Sbjct: 307 PPPPPPPVYSPPPPPSPPPPSPPPPVYS 334 Score = 40.4 bits (93), Expect(2) = 8e-07 Identities = 19/29 (65%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -2 Query: 168 SPPPPPLW*PPP-PPLW*PPPPL*PPPPL 85 SPPPPP PPP PP PPPP PPPP+ Sbjct: 396 SPPPPPHSPPPPSPPHSPPPPPHSPPPPI 424 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLS 164 P SP P V PPP P PPPPPPL S Sbjct: 349 PPSPLPPCVRPPPPPPPNSPPPPPPLFS 376 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -2 Query: 174 LSSPPPP-PLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRP 43 LS PPPP P++ PPPPP++ PPPP PPP + PP Y P Sbjct: 428 LSPPPPPHPVYSPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPP 472 Score = 30.0 bits (66), Expect(2) = 2e-06 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPP--PPPPL 170 P SP P PP PPPPP PPPP+ Sbjct: 401 PHSPPPP----SPPHSPPPPPHSPPPPI 424 Score = 40.8 bits (94), Expect(2) = 3e-06 Identities = 21/43 (48%), Positives = 24/43 (55%) Frame = -2 Query: 162 PPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 PPPP++ PPPPP PPP PPPP PP R P +P Sbjct: 328 PPPPVYSPPPPPP--SPPPPSPPPPSPLPPCVRPPPPPPPNSP 368 Score = 36.2 bits (82), Expect(2) = 3e-06 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 241 SPGDPLVLERPPPRPPPPPPPPP 173 SP P + PPP PP PPPPPP Sbjct: 290 SPPPPPPVYSPPPPPPSPPPPPP 312 Score = 45.4 bits (106), Expect(2) = 4e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 S PPPPP++ PPPPP PPP PPPP PP Y Sbjct: 257 SPPPPPPVYSPPPPPPSPPPPVYSPPPPP--PPVY 289 Score = 31.2 bits (69), Expect(2) = 4e-06 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPPPPPPPPPL 170 C P P + PPP PP P P PP+ Sbjct: 225 CKPFVPTLPAPPPPSPPMPVPSPPV 249 Score = 42.7 bits (99), Expect(2) = 5e-06 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP++ PPPPP PPP P PP PP Y Sbjct: 283 PPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVY 315 Score = 33.5 bits (75), Expect(2) = 5e-06 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 8/34 (23%) Frame = -1 Query: 241 SPGDPLVLERPPPRPP--------PPPPPPPLLS 164 SP P + PPP PP PPPPPPP+ S Sbjct: 257 SPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYS 290 [87][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 43.9 bits (102), Expect(2) = 6e-09 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPP ++ PPPP PPPP PP Sbjct: 154 PPPPPPPPPPPPVVFCPPPPPCPPPPAPCPP 184 Score = 42.4 bits (98), Expect(2) = 6e-09 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPPPPPPPPP 173 C P P+ PPP PPPPPPPPP Sbjct: 129 CPPPPPMCAPPPPPPPPPPPPPPP 152 Score = 43.5 bits (101), Expect(2) = 4e-08 Identities = 21/33 (63%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPP--PL*PPPPL**PP 73 PPPPP+ PPPPP PPP PL PPPP PP Sbjct: 186 PPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPP 218 Score = 40.0 bits (92), Expect(2) = 4e-08 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P + PPP PPPPPPPPP Sbjct: 127 PVCPPPPPMCAPPPPPPPPPPPPPP 151 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPP PPPP PPPP PP Sbjct: 194 PPPPPPPPPPPPCPLPPPPPPCPPPPAPCPP 224 Score = 40.0 bits (92), Expect(2) = 2e-07 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPPPPPPPPP 173 C+P P PPP PPPPPPPPP Sbjct: 136 CAPPPPPPPPPPPPPPPPPPPPPP 159 Score = 46.2 bits (108), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP+ PPPP PPPP PP Sbjct: 122 PPPPPPVCPPPPPMCAPPPPPPPPPPPPPPP 152 Score = 33.9 bits (76), Expect(2) = 4e-07 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPPPPPPPPP 173 C P P PPP P PPPPPPP Sbjct: 106 CGPPPPCP---PPPAPCPPPPPPP 126 Score = 45.8 bits (107), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP+ PPPPP PPPP PPPP PP Sbjct: 130 PPPPPMCAPPPPPPPPPPPPPPPPPPPPPPP 160 Score = 33.1 bits (74), Expect(2) = 8e-07 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPL 170 PC P P PPP PP PPPPP+ Sbjct: 111 PCPP-PPAPCPPPPPPPPVCPPPPPM 135 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPP ++ PPPPP PP P PPPP Sbjct: 162 PPPPVVFCPPPPPCPPPPAPCPPPPP 187 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLL 167 P P P PPP PPPPPPPPP++ Sbjct: 141 PPPPPPPPPPPPPPPPPPPPPPPPPVV 167 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPP PPPPP PPPP PPPP+ Sbjct: 140 PPPPPPPPPPPPPPPPPPPPPPPPPPV 166 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRP---PPPPPPPP 173 PC P P PPP P PPPPPPPP Sbjct: 118 PCPPPPPPPPVCPPPPPMCAPPPPPPPP 145 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPP PPPP Sbjct: 201 PPPPPCPLPPPPPPCPPPPAPCPPPP 226 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPP 162 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPP 88 +P PPP PPPPP+ PPPP PPPP Sbjct: 180 APCPPP---PPPPPMCLPPPPPPPPPP 203 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPP 163 Score = 38.9 bits (89), Expect(2) = 5e-06 Identities = 20/34 (58%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = -2 Query: 165 PPPPPLW*PPPPP---LW*PPPPL*PPPPL**PP 73 PPP P PPPPP L PPPP PPPP PP Sbjct: 177 PPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPP 210 Score = 37.4 bits (85), Expect(2) = 5e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 140 PPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 42.7 bits (99), Expect(2) = 8e-06 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 174 LSSPPPPPLW*PPPPPLW*PPPPL*PPPP 88 + +PPPPP PPPPP PPPP PPPP Sbjct: 135 MCAPPPPPPPPPPPPPPPPPPPPPPPPPP 163 Score = 32.7 bits (73), Expect(2) = 8e-06 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPP---PPPPP 173 P P P PPP PPPP PPPPP Sbjct: 97 PACPPPPPGCGPPPPCPPPPAPCPPPPP 124 [88][TOP] >UniRef100_Q75QN9 Cold shock domain protein 2 n=1 Tax=Triticum aestivum RepID=Q75QN9_WHEAT Length = 205 Score = 52.8 bits (125), Expect(2) = 6e-09 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG + GGGGGY GGGGG Sbjct: 107 GGYGGGGGGYGGGGGSY-GGGGGYGGGGGGG 136 Score = 33.5 bits (75), Expect(2) = 6e-09 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGG GGG R G G Sbjct: 164 GGGGGGGGYGGGGGRGGGGGG 184 Score = 52.8 bits (125), Expect(2) = 1e-08 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGG Y GGGGY GGGGG + GG GG Sbjct: 114 GGYGGGGGSYGGGGGYGGGGGGGRYGGGSGG 144 Score = 32.3 bits (72), Expect(2) = 1e-08 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGG G GGGR G G Sbjct: 165 GGGGGGGYGGGGGRGGGGGGGG 186 Score = 51.6 bits (122), Expect(3) = 1e-08 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G RG R GGY GGGGY GGGG + GGGG Y GGG G Sbjct: 87 GDRGGRGGGGYGGGGYGGGGGGYGGGGGGYGGGGGSYGGGGGYG 130 Score = 30.0 bits (66), Expect(3) = 1e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 174 GGGGGGGGGRGGGR 215 GGGGG GGG GGGR Sbjct: 124 GGGGGYGGGGGGGR 137 Score = 22.7 bits (47), Expect(3) = 1e-08 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 189 GGGGRGGGRSRTSGSPGLQGKPVCLERVKDGMVS 290 GGGG GGG G G G C + G S Sbjct: 164 GGGGGGGGYGGGGGRGGGGGGGGCFSCGESGHFS 197 [89][TOP] >UniRef100_A9NNT8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NNT8_PICSI Length = 205 Score = 50.4 bits (119), Expect(2) = 6e-09 Identities = 22/35 (62%), Positives = 25/35 (71%), Gaps = 4/35 (11%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHN----GGGGGYHNGGGGG 166 GGY GGGGY GGGG + GGGGG++ GGGGG Sbjct: 97 GGYGGGGGGYGGGGGGYGGGGYGGGGGWNGGGGGG 131 Score = 35.8 bits (81), Expect(2) = 6e-09 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGGR +G G Sbjct: 127 GGGGGRGGGRGGGRGGGAGGGG 148 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGGY GGGG + GGGGGY GG GG Sbjct: 90 GGRGGGGGGYGGGGGGYGGGGGGYGGGGYGG 120 Score = 31.6 bits (70), Expect(2) = 1e-07 Identities = 15/21 (71%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSG 230 GGG GGGGGGRGGGR G Sbjct: 121 GGGWNGGGGGGRGGGRGGGRG 141 Score = 47.8 bits (112), Expect(2) = 1e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG++ GGGGG G GGG Sbjct: 111 GGY--GGGGYGGGGGWNGGGGGGRGGGRGGG 139 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGGG GGG G G Sbjct: 173 GGNGGGGGGAGGGSCYQCGDFG 194 Score = 46.2 bits (108), Expect(2) = 9e-06 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = +2 Query: 68 YRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 Y GG + GGGG+NGGGG GGG G GGG G Sbjct: 113 YGGGGYGGGGGWNGGGGGGRGGGRGGGRGGGAG 145 Score = 44.3 bits (103), Expect(2) = 9e-06 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG GGG GGGG + GGGGGY GGGG Sbjct: 83 GGGGGRGGGRGGGGGGYGGGGGGYGGGGGG 112 Score = 31.2 bits (69), Expect(2) = 9e-06 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGG GGGG GGG G G +G Sbjct: 109 GGGGYGGGGYGGGGGWNGGGGGGRG 133 Score = 29.3 bits (64), Expect(2) = 9e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGGGGG G GGG Sbjct: 168 GGGGGGGNGGGGG 180 [90][TOP] >UniRef100_Q1BU84 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia AU 1054 RepID=Q1BU84_BURCA Length = 517 Score = 50.4 bits (119), Expect(2) = 7e-09 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NGGGG GGG+ NGGGGG GGGGG Sbjct: 303 GGHGNGGGGNGNGGGHGNGGGGGGGGGGGGG 333 Score = 35.4 bits (80), Expect(2) = 7e-09 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG +G G G Sbjct: 339 GGGGGGGGGNGGGNGGGNGGGGNGG 363 Score = 48.5 bits (114), Expect(2) = 4e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NGGG NGGGG NG GGG+ NGGGGG Sbjct: 297 GGHGNGGGHGNGGGG--NGNGGGHGNGGGGG 325 Score = 35.0 bits (79), Expect(2) = 4e-08 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G+ G G Sbjct: 333 GGGGGGGGGGGGGGGNGGGNGGGNG 357 Score = 45.4 bits (106), Expect(2) = 5e-07 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGG +G GG H GGGG+ NGGG G Sbjct: 276 GGGHGDGGGGHGNGGGHGDGGGGHGNGGGHG 306 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G+ G G Sbjct: 329 GGGGGGGGGGGGGGGGGGGNGGGNG 353 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NGGGG GGGG GGGGG GGGGG Sbjct: 316 GGHGNGGGGGGGGGGGGGGGGGGGGGGGGGG 346 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GGG GGG G G Sbjct: 343 GGGGGNGGGNGGGNGGGGNGGGNGG 367 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGG +G GG H GGGG NGGG G Sbjct: 289 GGGHGDGGGGHGNGGGHGNGGGGNGNGGGHG 319 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGGNG 349 Score = 45.8 bits (107), Expect(2) = 2e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG NGGG NGGGG GGGGG GGGGG Sbjct: 310 GGNGNGGGHGNGGGGGGGGGGGGGGGGGGGG 340 Score = 32.0 bits (71), Expect(2) = 2e-06 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG G G G+ G Sbjct: 337 GGGGGGGGGGGNGGGNGGGNGG 358 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGG-----GYHNGGGG 163 GG+ +GGGG+ GGG+ +GGGG G+ NGGGG Sbjct: 277 GGHGDGGGGHGNGGGHGDGGGGHGNGGGHGNGGGG 311 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGGNGG 350 Score = 43.1 bits (100), Expect(2) = 5e-06 Identities = 20/36 (55%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Frame = +2 Query: 74 GGYHNGGG----GYNGGGGYHNGGGGGYHNGGGGGE 169 GG H GGG G +G GG H GGGG+ NGGG G+ Sbjct: 259 GGGHGGGGDGDGGGHGNGGGHGDGGGGHGNGGGHGD 294 Score = 33.1 bits (74), Expect(2) = 5e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGG 342 Score = 45.4 bits (106), Expect(2) = 8e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGG GGGG GGGGG GGGGG Sbjct: 315 GGGHGNGGGGGGGGGGGGGGGGGGGGGGGGG 345 Score = 30.0 bits (66), Expect(2) = 8e-06 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GG + G+ G G Sbjct: 342 GGGGGGNGGGNGGGNGGGGNGGGNG 366 [91][TOP] >UniRef100_A0K9V3 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia HI2424 RepID=A0K9V3_BURCH Length = 509 Score = 50.4 bits (119), Expect(2) = 7e-09 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NGGGG GGG+ NGGGGG GGGGG Sbjct: 303 GGHGNGGGGNGNGGGHGNGGGGGGGGGGGGG 333 Score = 35.4 bits (80), Expect(2) = 7e-09 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG +G G G Sbjct: 339 GGGGGGGGGNGGGNGGGNGGGGNGG 363 Score = 48.5 bits (114), Expect(2) = 4e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NGGG NGGGG NG GGG+ NGGGGG Sbjct: 297 GGHGNGGGHGNGGGG--NGNGGGHGNGGGGG 325 Score = 35.0 bits (79), Expect(2) = 4e-08 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G+ G G Sbjct: 333 GGGGGGGGGGGGGGGNGGGNGGGNG 357 Score = 45.4 bits (106), Expect(2) = 5e-07 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGG +G GG H GGGG+ NGGG G Sbjct: 276 GGGHGDGGGGHGNGGGHGDGGGGHGNGGGHG 306 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G+ G G Sbjct: 329 GGGGGGGGGGGGGGGGGGGNGGGNG 353 Score = 48.1 bits (113), Expect(2) = 6e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NGGGG GGGG GGGGG GGGGG Sbjct: 316 GGHGNGGGGGGGGGGGGGGGGGGGGGGGGGG 346 Score = 31.2 bits (69), Expect(2) = 6e-07 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 G GGG GGG GGG G G G Sbjct: 380 GNGGGNGGGNGGGHGNGGGGHGNGG 404 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGG +G GG H GGGG NGGG G Sbjct: 289 GGGHGDGGGGHGNGGGHGNGGGGNGNGGGHG 319 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGGNG 349 Score = 45.8 bits (107), Expect(2) = 2e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG NGGG NGGGG GGGGG GGGGG Sbjct: 310 GGNGNGGGHGNGGGGGGGGGGGGGGGGGGGG 340 Score = 32.0 bits (71), Expect(2) = 2e-06 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG G G G+ G Sbjct: 337 GGGGGGGGGGGNGGGNGGGNGG 358 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGG-----GYHNGGGG 163 GG+ +GGGG+ GGG+ +GGGG G+ NGGGG Sbjct: 277 GGHGDGGGGHGNGGGHGDGGGGHGNGGGHGNGGGG 311 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGGNGG 350 Score = 43.1 bits (100), Expect(2) = 5e-06 Identities = 20/36 (55%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Frame = +2 Query: 74 GGYHNGGG----GYNGGGGYHNGGGGGYHNGGGGGE 169 GG H GGG G +G GG H GGGG+ NGGG G+ Sbjct: 259 GGGHGGGGDGDGGGHGNGGGHGDGGGGHGNGGGHGD 294 Score = 33.1 bits (74), Expect(2) = 5e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGG 342 Score = 45.4 bits (106), Expect(2) = 8e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGG GGGG GGGGG GGGGG Sbjct: 315 GGGHGNGGGGGGGGGGGGGGGGGGGGGGGGG 345 Score = 30.0 bits (66), Expect(2) = 8e-06 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GG + G+ G G Sbjct: 342 GGGGGGNGGGNGGGNGGGGNGGGNG 366 [92][TOP] >UniRef100_UPI000185F331 hypothetical protein BRAFLDRAFT_64022 n=1 Tax=Branchiostoma floridae RepID=UPI000185F331 Length = 449 Score = 52.4 bits (124), Expect(2) = 7e-09 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ GGGG+ GGGG+ GGGGG+ GGGGG Sbjct: 386 GGFGGGGGGFGGGGGFGAGGGGGFGGGGGGG 416 Score = 33.5 bits (75), Expect(2) = 7e-09 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSG 230 +GGGGGGG RGGG SR G Sbjct: 419 KGGGGGGGFSRGGGGSRGGG 438 Score = 47.0 bits (110), Expect(2) = 5e-06 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 74 GGYHNGGG-GYNGGGGYHNGGGGGYHNGGGGG 166 GG+ GGG G GGGG+ GGGGG+ GGGGG Sbjct: 393 GGFGGGGGFGAGGGGGFGGGGGGGFSKGGGGG 424 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 14/22 (63%), Positives = 15/22 (68%), Gaps = 3/22 (13%) Frame = +3 Query: 174 GGGG---GGGGGRGGGRSRTSG 230 GGGG GGGG RGGG S+ G Sbjct: 423 GGGGFSRGGGGSRGGGFSKGGG 444 [93][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 47.0 bits (110), Expect(2) = 8e-09 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPPL PPPPP PPP L PPPP PP Sbjct: 120 SPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPP 151 Score = 46.2 bits (108), Expect(2) = 8e-09 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -2 Query: 177 LLSSPPPPPL-W*PPPPPLW*PPPPL*PPPPL**PP 73 L S PPPPPL PPPPP PPPPL PPPP PP Sbjct: 101 LPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPP 136 Score = 45.4 bits (106), Expect(2) = 8e-09 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPPL PP PL PP Sbjct: 149 SPPPPPPPSPPPPPPS--PPPPLPPPSPLPPPP 179 Score = 40.4 bits (93), Expect(2) = 8e-09 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P +L PPP P PPPPPPP Sbjct: 132 PPSPPPPPLLSPPPPPPSPPPPPPP 156 Score = 39.7 bits (91), Expect(2) = 8e-09 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP PL PPP PP PPPPPP Sbjct: 37 PPSPPSPLPPSPPPPPPPSPPPPPP 61 Score = 38.9 bits (89), Expect(2) = 8e-09 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLSS 161 P SP PL PPP P PPPPPPL SS Sbjct: 85 PPSPPPPLPSPPPPPPLPSPPPPPPLPSS 113 Score = 47.0 bits (110), Expect(2) = 2e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 174 LSSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 L SPPPPP PPPPP PPPP PPPPL PP Sbjct: 140 LLSPPPPPPSPPPPPPPSPPPPPPSPPPPL--PP 171 Score = 37.7 bits (86), Expect(2) = 2e-08 Identities = 19/33 (57%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPP----PPPLLS 164 LP SP P PPP PPPPP PPPLLS Sbjct: 110 LPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLS 142 Score = 44.3 bits (103), Expect(2) = 4e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPPL PP P P PPL PP Sbjct: 197 SPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPP 228 Score = 39.3 bits (90), Expect(2) = 4e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP PL PPP PP PPPPPP Sbjct: 179 PPSPPHPLPPSPPPPPPPSPPPPPP 203 Score = 46.6 bits (109), Expect(2) = 8e-08 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 177 LLSSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 L SSPPPPP PPPP PPPP PPPPL PP Sbjct: 110 LPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPP 144 Score = 45.1 bits (105), Expect(2) = 8e-08 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPP 88 S PPPPP PPPPP PPPP PPPP Sbjct: 47 SPPPPPPPSPPPPPPSQPPPPPSSPPPP 74 Score = 37.4 bits (85), Expect(2) = 8e-08 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP P PPPPPPP Sbjct: 14 PSSPPPPPPPSPPPPPPSPPPPPPP 38 Score = 35.8 bits (81), Expect(2) = 8e-08 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPP Sbjct: 54 PSPPPPPPSQPPPPPSSPPPPPPPP 78 Score = 45.4 bits (106), Expect(2) = 2e-07 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = -2 Query: 177 LLSSPPPPPLW*PPPPPLW----*PPPPL*PPPPL**PP 73 L S PPPPPL PPPPP PPPP PPPPL PP Sbjct: 92 LPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPP 130 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PP PPPPPP Sbjct: 61 PSQPPPPPSSPPPPPPPPSPPPPPP 85 Score = 44.3 bits (103), Expect(2) = 3e-07 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPP 88 SPPPPPL PPPPP PPPP PPP Sbjct: 134 SPPPPPLLSPPPPPPSPPPPPPPSPPP 160 Score = 36.2 bits (82), Expect(2) = 3e-07 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 241 SPGDPLVLERPPPRPPPPPPPPPL 170 SP P L PP PPP PPPPPL Sbjct: 103 SPPPPPPLPSSPPPPPPSPPPPPL 126 Score = 44.3 bits (103), Expect(2) = 4e-07 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL---*PPPPL**PP 73 S PPPPP PPPPP PPPPL PPPPL PP Sbjct: 70 SPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPP 105 Score = 35.8 bits (81), Expect(2) = 4e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPP PPPPP Sbjct: 5 PSPPPPPPPPSSPPPPPPPSPPPPP 29 Score = 43.1 bits (100), Expect(2) = 8e-07 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPP 88 SPPPPP PPPP L PPPP PPPP Sbjct: 127 SPPPPPPSPPPPPLLSPPPPPPSPPPP 153 Score = 42.4 bits (98), Expect(2) = 8e-07 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 226 PPPPPPPSPPPPPPPSPPPPSPPPPP 251 Score = 36.6 bits (83), Expect(2) = 8e-07 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPPLLS 164 LP SP P PPP PPP PPPPPL S Sbjct: 186 LPPSPPPPPP-PSPPPPPPPSPPPPPLPS 213 Score = 35.8 bits (81), Expect(2) = 8e-07 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPP 176 LP P P + PPP PP PPPPP Sbjct: 101 LPSPPPPPPLPSSPPPPPPSPPPPP 125 Score = 43.5 bits (101), Expect(2) = 1e-06 Identities = 22/35 (62%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -2 Query: 171 SSPPPPPLW--*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPP PPPPL PP Sbjct: 62 SQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPP 96 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P L PP PPPP PPPP Sbjct: 35 PPPPSPPSPLPPSPPPPPPPSPPPP 59 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 10 PPPPPSSPPPPPPPSPPPPPPSPPPP 35 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP P PP PP Sbjct: 189 SPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPP 220 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPPP PP Sbjct: 147 PPSPPPP-----PPPSPPPPPPSPP 166 Score = 33.9 bits (76), Expect(2) = 3e-06 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 211 PPPRPPPPPPPP 176 PPP PPPPPPPP Sbjct: 3 PPPSPPPPPPPP 14 Score = 42.7 bits (99), Expect(2) = 4e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP P PP PP Sbjct: 55 SPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPP 86 Score = 33.9 bits (76), Expect(2) = 4e-06 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 238 PGDPLVLERPPPRPPPPPPPPP 173 P P PPP PP PPPPPP Sbjct: 9 PPPPPPSSPPPPPPPSPPPPPP 30 Score = 41.6 bits (96), Expect(2) = 5e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPP PPL PPPPP PPPP PPP PP Sbjct: 218 SPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPP 249 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P L PP PPPP PPPP Sbjct: 177 PPPPSPPHPLPPSPPPPPPPSPPPP 201 Score = 42.7 bits (99), Expect(2) = 7e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPP PP PL PP Sbjct: 16 SPPPPPPPSPPPPPPSPPPPPPPSPPSPL--PP 46 Score = 33.1 bits (74), Expect(2) = 7e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 211 PPPRPPPPPPPPP 173 PPP P PPPPPPP Sbjct: 1 PPPPPSPPPPPPP 13 Score = 42.0 bits (97), Expect(2) = 9e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPP PP Sbjct: 47 SPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPP 78 Score = 33.5 bits (75), Expect(2) = 9e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PP PPPP PPPP Sbjct: 4 PPSPPPPPPPPSSPPPPPPPSPPPP 28 [94][TOP] >UniRef100_UPI0000F2CB43 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2CB43 Length = 252 Score = 47.4 bits (111), Expect(2) = 8e-09 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +2 Query: 41 RGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 R RR R GG GGGG GGGG GGGGG GGGGG Sbjct: 174 RRRRRRRGAAAGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215 Score = 38.5 bits (88), Expect(2) = 8e-09 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GG S +SGS G G+ Sbjct: 212 GGGGGGGGGGSGGSSSSSGSGGSGGE 237 Score = 45.8 bits (107), Expect(2) = 8e-08 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +2 Query: 41 RGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 R RR R A G GGGG GGGG GGGGG GGGGG Sbjct: 175 RRRRRRGAAAGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216 Score = 36.6 bits (83), Expect(2) = 8e-08 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG +S S G G Sbjct: 209 GGGGGGGGGGGGGSGGSSSSSGSGG 233 Score = 44.7 bits (104), Expect(2) = 4e-07 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = +2 Query: 47 RRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RR R R R G GG G GGGG GGGGG GGGGG Sbjct: 171 RRQRRRRRRRGAAAGGAGGGGGGGGGGGGGGGGGGGGGGG 210 Score = 35.4 bits (80), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG + GS G Sbjct: 206 GGGGGGGGGGGGGGGGSGGSSSSSG 230 Score = 44.3 bits (103), Expect(2) = 8e-07 Identities = 22/40 (55%), Positives = 23/40 (57%) Frame = +2 Query: 47 RRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 R+ R R RG G GG GGGG GGGGG GGGGG Sbjct: 172 RQRRRRRRRGAAAGGAGGGGGGGGGGGGGGGGGGGGGGGG 211 Score = 34.7 bits (78), Expect(2) = 8e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG GS G Sbjct: 203 GGGGGGGGGGGGGGGGGGGSGG 224 [95][TOP] >UniRef100_Q7UA83 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 8102 RepID=Q7UA83_SYNPX Length = 214 Score = 52.4 bits (124), Expect(2) = 8e-09 Identities = 23/34 (67%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG---GGGYHNGGGGG 166 GGY GGGGY GGGGY GG GGG + GGGGG Sbjct: 89 GGYRGGGGGYGGGGGYGGGGGRDGGGGYGGGGGG 122 Score = 33.5 bits (75), Expect(2) = 8e-09 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPG 239 RGGGGG GGG GGGR G G Sbjct: 124 RGGGGGYGGGGGGGRDGGGGYGG 146 Score = 55.1 bits (131), Expect(2) = 2e-08 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEE 172 GG +GGGGY GGGG + GGGGGY GGGGG + Sbjct: 107 GGGRDGGGGYGGGGGGYRGGGGGYGGGGGGGRD 139 Score = 29.6 bits (65), Expect(2) = 2e-08 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = +3 Query: 174 GGGGGGGGGRGGGRS--RTSGSPGLQGK 251 G GGGGGG RGGG + R SG+ G + + Sbjct: 143 GYGGGGGGYRGGGDAGDRPSGARGWEDR 170 Score = 47.4 bits (111), Expect(2) = 6e-07 Identities = 21/35 (60%), Positives = 23/35 (65%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGY-----HNGGGGGYHNGGGG 163 GG + GGGGY GGGG + GGGGGY GGGG Sbjct: 95 GGGYGGGGGYGGGGGRDGGGGYGGGGGGYRGGGGG 129 Score = 32.0 bits (71), Expect(2) = 6e-07 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 G GGGGGGGR GG G G +G Sbjct: 129 GYGGGGGGGRDGGGGYGGGGGGYRG 153 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGG +GGGG Sbjct: 114 GGYGGGGGGYRGGGGGYGGGGGGGRDGGGG 143 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRS-RTSGSPG 239 R GG GGGG GRS R GS G Sbjct: 175 RDSGGEGGGGHDDGRSRRRRGSSG 198 [96][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 298 PPPPPPCPPPPPPPPPPPPPCPPPPP 323 Score = 42.0 bits (97), Expect(2) = 1e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPPPP Sbjct: 252 PCPPPCPPPCPPPPPPPPPPPPPPP 276 Score = 43.1 bits (100), Expect(2) = 2e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 297 PPPPPPPCPPPPPPPPPPPPPCPPPPPPPPP 327 Score = 41.2 bits (95), Expect(2) = 2e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPPPP Sbjct: 256 PCPPPCPPPPPPPPPPPPPPPPPPP 280 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPP 314 Score = 38.1 bits (87), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPP P Sbjct: 260 PCPPPPPPPPPPPPPPPPPPPPPCP 284 Score = 41.6 bits (96), Expect(2) = 3e-07 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPPPP Sbjct: 293 PCPPPPPPPPPCPPPPPPPPPPPPP 317 Score = 38.9 bits (89), Expect(2) = 3e-07 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PP P PP Sbjct: 311 PPPPPPPCPPPPP---PPPPCPPPCPPPCPP 338 Score = 41.6 bits (96), Expect(2) = 4e-07 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPPPP Sbjct: 303 PCPPPPPPPPPPPPPCPPPPPPPPP 327 Score = 38.5 bits (88), Expect(2) = 4e-07 Identities = 20/36 (55%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = -2 Query: 165 PPPPPLW*PPP-----PPLW*PPPPL*PPPPL**PP 73 PPPPP PPP PP PPPP PPPP PP Sbjct: 321 PPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPP 356 Score = 40.0 bits (92), Expect(2) = 1e-06 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -2 Query: 162 PPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPP PPPPP PPPP PPPP PP Sbjct: 295 PPPP---PPPPPCPPPPPPPPPPPPPCPPP 321 Score = 40.0 bits (92), Expect(2) = 1e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP P PP PP Sbjct: 305 PPPPPPPPPPPPPCPPPPPPPPPCPPPCPPP 335 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPPPP Sbjct: 282 PCPPPCP---PPPPPCPPPPPPPPP 303 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PP PPPPPP Sbjct: 286 PCPPPPPPCPPPPPPPPPCPPPPPP 310 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPP PPPP PPPP PP Sbjct: 288 PPPPPPCPPPPP----PPPPCPPPPPPPPPP 314 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -1 Query: 247 PCSPGDPLVLER-PPPRPPPPPPPPP 173 PC P P PPP PPPPPPPPP Sbjct: 245 PCPPPPPPCPPPCPPPCPPPPPPPPP 270 [97][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 47.8 bits (112), Expect(2) = 1e-08 Identities = 24/46 (52%), Positives = 27/46 (58%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 S PPPPP++ PPPPP PPPP PPPP+ PP Y P P Sbjct: 462 SPPPPPPVYSPPPPP---PPPP--PPPPVXSPPPPIIYESPPPPTP 502 Score = 37.7 bits (86), Expect(2) = 1e-08 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = -1 Query: 241 SPGDPLVLERPPPRPPPP---PPPPPLLS 164 SP P++ PPP PPPP PPPPP+ S Sbjct: 434 SPPPPVLSSPPPPSPPPPSPSPPPPPVYS 462 Score = 46.6 bits (109), Expect(2) = 6e-07 Identities = 19/28 (67%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = -2 Query: 168 SPPPPPLW*PPPPP-LW*PPPPL*PPPP 88 SPPPPP++ PPPPP ++ PPPP PPPP Sbjct: 454 SPPPPPVYSPPPPPPVYSPPPPPPPPPP 481 Score = 32.7 bits (73), Expect(2) = 6e-07 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 15/43 (34%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPP----PPP-----------PPPPLLSS 161 CSP P + PPP PP PPP PPPP+LSS Sbjct: 400 CSPFVPSLPTPPPPSPPVFPSPPPTPVYSPPPVFSPPPPVLSS 442 [98][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 42.0 bits (97), Expect(2) = 1e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPPPP Sbjct: 353 PCQPCPPPPPPPPPPPPPPPPPPPP 377 Score = 43.5 bits (101), Expect(2) = 8e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 38.9 bits (89), Expect(2) = 8e-08 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPP P Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSP 380 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 37.7 bits (86), Expect(2) = 5e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPP 388 Score = 37.7 bits (86), Expect(2) = 5e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 389 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPP 88 SPPPPP PPPPP PPPP PPPP Sbjct: 379 SPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -1 Query: 256 TGLP--CSPGDPLVLERPPPRPPPPPPPPP 173 TG P C P P P PPPPPPPPP Sbjct: 338 TGSPNACCPPPPSANPCQPCPPPPPPPPPP 367 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPP PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPP 382 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPP 88 S PPPPP PPPPP PPPP PPPP Sbjct: 379 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPP PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPP 383 Score = 42.0 bits (97), Expect(2) = 5e-06 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 34.3 bits (77), Expect(2) = 5e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPP PPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPP 384 [99][TOP] >UniRef100_B9PV72 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9PV72_TOXGO Length = 488 Score = 54.7 bits (130), Expect(2) = 1e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 63 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 92 Score = 30.8 bits (68), Expect(2) = 1e-08 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GGG G G G Sbjct: 87 GGGGGGYGGGGGGYGAGGGGYGAGG 111 Score = 54.7 bits (130), Expect(2) = 3e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 70 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 99 Score = 29.3 bits (64), Expect(2) = 3e-08 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGS 233 GGGGGG G GGG S GS Sbjct: 124 GGGGGGYGAGGGNSGGYGS 142 Score = 53.9 bits (128), Expect(2) = 6e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 77 GGYGGGGGGYGGGGGGYGGGGGGYGAGGGG 106 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGG G GG GGG G+ G G Sbjct: 117 GGGGYGAGGGGGGYGAGGGNSGGYG 141 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 13/55 (23%) Frame = +2 Query: 38 FRGRRYR*ARYRGGYHNG-------------GGGYNGGGGYHNGGGGGYHNGGGG 163 FRG R Y GGY G GGGY GGGG + GGGGGY GGGG Sbjct: 31 FRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGG 85 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GGG G G G Sbjct: 80 GGGGGGYGGGGGGYGGGGGGYGAGG 104 Score = 51.6 bits (122), Expect(2) = 5e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGY GGGG Sbjct: 84 GGYGGGGGGYGGGGGGYGAGGGGYGAGGGG 113 Score = 28.1 bits (61), Expect(2) = 5e-07 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 156 EEEERRGGGGGGGGGRGGGRSRTSGSPGLQGKP 254 E+ R GGGG GGG+ G P + P Sbjct: 152 EKHRSRSRSPGGGGAAGGGKGARGGQPKPRRNP 184 Score = 50.8 bits (120), Expect(2) = 6e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGG + GGGGY GGGGG Sbjct: 98 GGYGAGGGGYGAGGGGYGAGGGGYGAGGGGG 128 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +3 Query: 174 GGGGGGGGGRGG-----GRSRTSGSPGLQG 248 G G G GGGR G RSR+ G G G Sbjct: 139 GYGSGYGGGRSGREKHRSRSRSPGGGGAAG 168 [100][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 PPPPP PPPPP PPPP PPPP PP+ Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQ 368 Score = 42.0 bits (97), Expect(2) = 1e-08 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -1 Query: 262 KHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 K G+ C+ P V + PPP PPPPPPPPP Sbjct: 305 KFGGIYCNGFTPDVEQPPPPPPPPPPPPPP 334 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPP PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPEPPPQPDPP 372 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPP 345 [101][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 45.1 bits (105), Expect(2) = 1e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 PPPPP PPPPP PPPP PPPP PPR Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 40.4 bits (93), Expect(2) = 1e-08 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -1 Query: 256 TGLPCSPGDPLVLERPPPRPPPPPPPPP 173 TG P P P+ ER P PPPPPPPPP Sbjct: 7 TGYPKVPYTPIAPERIIPPPPPPPPPPP 34 Score = 45.1 bits (105), Expect(2) = 3e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 PPPPP PPPPP PPPP PPPP PPR Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 38.9 bits (89), Expect(2) = 3e-08 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 283 IPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 +P ++ +P P P PPP PPPPPPPPP Sbjct: 12 VPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPPPP 82 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 PPPPP PPPPP PPPP PPPP PP R P P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARP 113 Score = 37.4 bits (85), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 37.4 bits (85), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 37.4 bits (85), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 PC P P PPP PPPPPPPPP Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 37.7 bits (86), Expect(2) = 5e-07 Identities = 18/33 (54%), Positives = 20/33 (60%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP PPPPP PPPP P P PP++ Sbjct: 90 PPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKH 122 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPP PPPP PPPP PP Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPP 83 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPP P PPPP PPPP PP Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPP PPPPP PPPP PPPP PP Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 39.7 bits (91), Expect(2) = 3e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPP PPPP PP Sbjct: 51 PPPPPPPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 37.4 bits (85), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 [102][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 45.8 bits (107), Expect(2) = 1e-08 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPPL PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 39.7 bits (91), Expect(2) = 1e-08 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP +P P PPP PPPPPPPPP Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPP 83 Score = 44.7 bits (104), Expect(2) = 4e-08 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPPL PPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 38.9 bits (89), Expect(2) = 4e-08 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPP 81 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 +PPPPP PPPPP PPPP PPPP PP Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 37.7 bits (86), Expect(2) = 2e-07 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 232 DPLVLERPPPRPPPPPPPPP 173 + +V+E PPP PP PPPPPP Sbjct: 48 EKMVIELPPPLPPAPPPPPP 67 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 229 PLVLERPPPRPPPPPPPPP 173 P L PP PPPPPPPPP Sbjct: 55 PPPLPPAPPPPPPPPPPPP 73 [103][TOP] >UniRef100_C0H6D7 Putative cuticle protein n=1 Tax=Bombyx mori RepID=C0H6D7_BOMMO Length = 224 Score = 52.4 bits (124), Expect(2) = 1e-08 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +2 Query: 32 YGFRGRRYR*ARY-RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 +G +G R Y RGG + GGGGY GGGGY GGGGGY GGG G Sbjct: 112 FGLKGYRKGHHGYDRGGGYGGGGGYGGGGGY--GGGGGYGGGGGYG 155 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GGG GGG G G QG Sbjct: 173 GGGGGHGGGYGGGGGHGGGYGGNQG 197 Score = 49.3 bits (116), Expect(2) = 3e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG + GGGGY GGGGY GGGGGY GGG G Sbjct: 133 GGGYGGGGGYGGGGGY--GGGGGYGGGGGYG 161 Score = 31.2 bits (69), Expect(2) = 3e-07 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGG GGGGG GGG G+ G Sbjct: 179 GGGYGGGGGHGGGYGGNQGNYG 200 Score = 47.8 bits (112), Expect(2) = 1e-06 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG--GGGYHNGGGGG 166 GG + GGGGY GGGGY GG GGG GGGGG Sbjct: 139 GGGYGGGGGYGGGGGYGGGGGYGGGSGYGGGGG 171 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGG GGG G G G Sbjct: 169 GGGYGGGGGHGGGYGGGGGHGGGYG 193 Score = 48.1 bits (113), Expect(2) = 9e-06 Identities = 22/35 (62%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHN----GGGGGYHNGGGGG 166 GG + GGGGY GGGGY GGGGGY GGG G Sbjct: 145 GGGYGGGGGYGGGGGYGGGSGYGGGGGYGGGGGHG 179 Score = 27.3 bits (59), Expect(2) = 9e-06 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GGG GG + G G Sbjct: 183 GGGGGHGGGYGGNQGNYGYPTGCGG 207 [104][TOP] >UniRef100_A5XS09 Single-stranded DNA-binding protein n=3 Tax=Burkholderia mallei RepID=A5XS09_BURMA Length = 212 Score = 46.6 bits (109), Expect(2) = 1e-08 Identities = 20/34 (58%), Positives = 21/34 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEER 175 GGY GGGGY GG GGGGG +GGGG R Sbjct: 144 GGYGGGGGGYGGGRDMERGGGGGRASGGGGAGAR 177 Score = 38.9 bits (89), Expect(2) = 1e-08 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGGGGGG GGG SR S G Sbjct: 177 RSGGGGGGGGGGGGGASRPSAPAG 200 [105][TOP] >UniRef100_A9JZM2 Single-stranded DNA-binding protein n=1 Tax=Burkholderia mallei ATCC 10399 RepID=A9JZM2_BURMA Length = 209 Score = 46.6 bits (109), Expect(2) = 1e-08 Identities = 20/34 (58%), Positives = 21/34 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEER 175 GGY GGGGY GG GGGGG +GGGG R Sbjct: 141 GGYGGGGGGYGGGRDMERGGGGGRASGGGGAGAR 174 Score = 38.9 bits (89), Expect(2) = 1e-08 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGGGGGG GGG SR S G Sbjct: 174 RSGGGGGGGGGGGGGASRPSAPAG 197 [106][TOP] >UniRef100_B4M7I0 GJ16994 n=1 Tax=Drosophila virilis RepID=B4M7I0_DROVI Length = 205 Score = 53.1 bits (126), Expect(2) = 1e-08 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 4/35 (11%) Frame = +2 Query: 74 GGYHNGG---GGYNGGGGYHNGGG-GGYHNGGGGG 166 GGY +GG GGY GGGG+ GGG GGYH GGGGG Sbjct: 128 GGYQSGGYQGGGYQGGGGHQGGGGIGGYHGGGGGG 162 Score = 32.3 bits (72), Expect(2) = 1e-08 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGGGGG GG S S S Sbjct: 158 GGGGGGGGGGGGAGSYASSS 177 Score = 55.8 bits (133), Expect(2) = 1e-08 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGG---GGYHNGGGGGYHNGGGG 163 G++G Y+ Y+GG + GGGG+ GG GGYH GGGGG GGGG Sbjct: 124 GYQGGGYQSGGYQGGGYQGGGGHQGGGGIGGYHGGGGGGGGGGGGG 169 Score = 29.3 bits (64), Expect(2) = 1e-08 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGGGGG G S ++ S Sbjct: 161 GGGGGGGGGAGSYASSSANS 180 Score = 53.1 bits (126), Expect(2) = 5e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG + GGGGY GGGGY GGGGGYH GGG G Sbjct: 44 GGGYGGGGGYGGGGGY--GGGGGYHGGGGYG 72 Score = 26.6 bits (57), Expect(2) = 5e-07 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGG GGGG GG + G G Sbjct: 67 GGGGYGGGGYQGGGYQGGGYQG 88 Score = 51.2 bits (121), Expect(2) = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 5/36 (13%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNG---GGGGYHNGG--GGG 166 GG + GGGGY GGGGYH G GGGGY GG GGG Sbjct: 50 GGGYGGGGGYGGGGGYHGGGGYGGGGYQGGGYQGGG 85 Score = 27.3 bits (59), Expect(2) = 1e-06 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGG +GGG S G QG Sbjct: 118 GGGGGGGYQGGGYQ----SGGYQG 137 [107][TOP] >UniRef100_A2S6E2 Single-stranded DNA-binding protein n=3 Tax=Burkholderia mallei RepID=A2S6E2_BURM9 Length = 192 Score = 46.6 bits (109), Expect(2) = 1e-08 Identities = 20/34 (58%), Positives = 21/34 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEER 175 GGY GGGGY GG GGGGG +GGGG R Sbjct: 124 GGYGGGGGGYGGGRDMERGGGGGRASGGGGAGAR 157 Score = 38.9 bits (89), Expect(2) = 1e-08 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGGGGGG GGG SR S G Sbjct: 157 RSGGGGGGGGGGGGGASRPSAPAG 180 [108][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 52.0 bits (123), Expect(2) = 1e-08 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = +2 Query: 74 GGYHNGGGGY--NGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGGY GGGGGY GGGG Sbjct: 92 GGYGGGGGGYGGGGGGGYGGGGGGGYGGGGGG 123 Score = 33.5 bits (75), Expect(2) = 1e-08 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGG GG GGGRS G G Sbjct: 124 RSGGGGGYGGGGGGRSGGGGGGG 146 Score = 48.5 bits (114), Expect(2) = 1e-07 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = +2 Query: 86 NGGGGYNGGGGYHNGGGGGYHNGGGGG 166 +GGGGY GGGG + GGGGG + GGGGG Sbjct: 89 SGGGGYGGGGGGYGGGGGGGYGGGGGG 115 Score = 33.5 bits (75), Expect(2) = 1e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGG GG GGGRS G G Sbjct: 111 GGGGGGYGGGGGGRSGGGGGYG 132 Score = 50.8 bits (120), Expect(2) = 4e-07 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGG +GGGG + GGGGG GGGGG Sbjct: 115 GGYGGGGGGRSGGGGGYGGGGGGRSGGGGGG 145 Score = 29.3 bits (64), Expect(2) = 4e-07 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 13/37 (35%) Frame = +3 Query: 168 RRGGGGGGG-------------GGRGGGRSRTSGSPG 239 R GGGGGGG GG GGGRS G G Sbjct: 138 RSGGGGGGGDGGFRSPYGAGPRGGGGGGRSGGGGGYG 174 [109][TOP] >UniRef100_B2ICA8 Putative uncharacterized protein n=1 Tax=Beijerinckia indica subsp. indica ATCC 9039 RepID=B2ICA8_BEII9 Length = 152 Score = 58.2 bits (139), Expect(2) = 1e-08 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G+RG + + GG+H GGGG+ GGGG +GGGGG+H GGGGG Sbjct: 98 GWRGGGW----HGGGWHGGGGGWRGGGGGWHGGGGGWHGGGGGG 137 Score = 27.3 bits (59), Expect(2) = 1e-08 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 2/15 (13%) Frame = +3 Query: 174 GGGG--GGGGGRGGG 212 GGGG GGGGG GGG Sbjct: 134 GGGGWHGGGGGHGGG 148 Score = 50.1 bits (118), Expect(2) = 5e-06 Identities = 25/47 (53%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = +2 Query: 32 YGFRGRRYR*ARYRGGYHNG---GGGYNGGGGYHNGGGGGYHNGGGG 163 YG+RG Y GG+ G GGG++GGGG GGGGG+H GGGG Sbjct: 84 YGWRGWGVP-GGYYGGWRGGGWHGGGWHGGGGGWRGGGGGWHGGGGG 129 Score = 26.2 bits (56), Expect(2) = 5e-06 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GG GGG G G Sbjct: 125 GGGGGWHGGGGGGWHGGGGGHG 146 [110][TOP] >UniRef100_UPI00016E10B4 UPI00016E10B4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B4 Length = 1323 Score = 44.3 bits (103), Expect(2) = 1e-08 Identities = 34/109 (31%), Positives = 46/109 (42%) Frame = -1 Query: 484 SCSSSPISPSISDLERQKKGLVRRVQSEGNLEDLAFATCNNNEDRFNYMDSSSKRYSVRQ 305 +C +P SP D + Q G R++ DL F+ ED + +D + + Sbjct: 660 TCQMTPCSPDPWD-KLQPSGSALRIK------DLDFSDLVEEED-IDVLDMDTFDSASAS 711 Query: 304 RCLALETIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPPLLSSS 158 C + L GL P P PPP PPPPPPPPP L +S Sbjct: 712 SCFSGLPPAPPPLPPGAGLGAPPAPP-----PPPPPPPPPPPPPALLAS 755 Score = 40.8 bits (94), Expect(2) = 1e-08 Identities = 21/33 (63%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 180 LLLSSPPPPPLW*PPPPP--LW*PPPPL*PPPP 88 LL S PPPPP PPPPP + PPPP PPPP Sbjct: 752 LLASPPPPPPPPPPPPPPPGVLGPPPP--PPPP 782 [111][TOP] >UniRef100_UPI00016E10B5 UPI00016E10B5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B5 Length = 1246 Score = 44.3 bits (103), Expect(2) = 1e-08 Identities = 34/109 (31%), Positives = 46/109 (42%) Frame = -1 Query: 484 SCSSSPISPSISDLERQKKGLVRRVQSEGNLEDLAFATCNNNEDRFNYMDSSSKRYSVRQ 305 +C +P SP D + Q G R++ DL F+ ED + +D + + Sbjct: 583 TCQMTPCSPDPWD-KLQPSGSALRIK------DLDFSDLVEEED-IDVLDMDTFDSASAS 634 Query: 304 RCLALETIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPPLLSSS 158 C + L GL P P PPP PPPPPPPPP L +S Sbjct: 635 SCFSGLPPAPPPLPPGAGLGAPPAPP-----PPPPPPPPPPPPPALLAS 678 Score = 40.8 bits (94), Expect(2) = 1e-08 Identities = 21/33 (63%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 180 LLLSSPPPPPLW*PPPPP--LW*PPPPL*PPPP 88 LL S PPPPP PPPPP + PPPP PPPP Sbjct: 675 LLASPPPPPPPPPPPPPPPGVLGPPPP--PPPP 705 [112][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 43.1 bits (100), Expect(2) = 1e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 42.0 bits (97), Expect(2) = 1e-08 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP PL PPP PPPPPPPPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 43.1 bits (100), Expect(2) = 3e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 40.8 bits (94), Expect(2) = 3e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P L PPP PPPPPPPPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 43.5 bits (101), Expect(2) = 8e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 678 SPPPPPPPPPPPPP---PPPPPPPPPPPHPPP 706 Score = 38.9 bits (89), Expect(2) = 8e-08 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPL 170 P P P PPP PPPPPPPPPL Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPL 675 Score = 43.1 bits (100), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP P P PPP PPPPPPPPP Sbjct: 240 LPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 43.1 bits (100), Expect(2) = 1e-07 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPP PPPP PP Sbjct: 678 SPPPPPPPPPPPPPP---PPPPPPPPPPHPPPP 707 Score = 38.5 bits (88), Expect(2) = 1e-07 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLSSS 158 P P P PPP PPPPPPPPP L S Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Score = 43.9 bits (102), Expect(2) = 2e-07 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPPL PP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPL--PP 677 Score = 43.1 bits (100), Expect(2) = 2e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 38.1 bits (87), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 37.4 bits (85), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 43.9 bits (102), Expect(2) = 3e-07 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -2 Query: 174 LSSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 L PPPPP PPPPP PPPP PPPP PP Sbjct: 240 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 36.6 bits (83), Expect(2) = 3e-07 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 238 PGDPLVLERPPPRPPPPPPPPP 173 P PL PPP PPPPPP PP Sbjct: 216 PPPPLPPSPPPPSPPPPPPSPP 237 Score = 43.1 bits (100), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 42.7 bits (99), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPPL P PP PP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 42.7 bits (99), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPPL PPP PPPP PP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 42.7 bits (99), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPPL PPPP PPPP PPPP PP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 37.4 bits (85), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 37.4 bits (85), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 37.4 bits (85), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 37.0 bits (84), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 43.1 bits (100), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 35.8 bits (81), Expect(2) = 8e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PP PPPPPPPPP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPP 250 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP P PPP PPPP PPPPL PP Sbjct: 213 SPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPP 244 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P PL PPP PPPPPPPPP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPP PPPPP PPPP PPPL Sbjct: 688 PPPPPPPPPPPPPPPHPPPP--SPPPL 712 Score = 33.1 bits (74), Expect(2) = 1e-06 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 256 TGLPCSPGDPLVLERPPPRPPPPPPPPP 173 T C P ++ PPP PPPPPP P Sbjct: 194 TPCQCCPVSTVIGYNPPPPSPPPPPPLP 221 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP P PP PPPP PP Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP P PPP PPPP PPPP PP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 37.4 bits (85), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 37.4 bits (85), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 34.7 bits (78), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPP 248 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PP P PPPP PP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP SP P PP PPP PPPPP Sbjct: 220 LPPSPPPPSPPPPPPSPPPPLPPPPP 245 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -2 Query: 162 PPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPL PPPPP PPPP PPPP PP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 33.9 bits (76), Expect(2) = 3e-06 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = -1 Query: 280 PSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPP 176 P T+ + P SP P L PP P PPPPPP Sbjct: 200 PVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPP 234 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P + PPP PPPPPP P Sbjct: 212 PSPPPPPPLPPSPPPPSPPPPPPSP 236 Score = 43.1 bits (100), Expect(2) = 8e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 32.3 bits (72), Expect(2) = 8e-06 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPP PPP Sbjct: 219 PLPPSPPPPSPPPPPPSPPPPLPPP 243 [113][TOP] >UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO Length = 510 Score = 54.3 bits (129), Expect(2) = 1e-08 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 32 YGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGG-GGGYHNGGGGG 166 YG G Y Y GG + GGGGY GGGGY GG GGG + GG GG Sbjct: 287 YGGHGSPYGGGGYGGGGYGGGGGYGGGGGYGGGGYGGGGYGGGNGG 332 Score = 30.8 bits (68), Expect(2) = 1e-08 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GGG G G G Sbjct: 354 GGGGGGYGGGGGGYGGYGGGGGYGG 378 Score = 51.2 bits (121), Expect(2) = 6e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY G GGY GGGG + GGGGGY GGGG Sbjct: 344 GGYGGGNGGYGGGGGGYGGGGGGYGGYGGGG 374 Score = 28.1 bits (61), Expect(2) = 6e-07 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 GG GGGGG GGG SG G Sbjct: 368 GGYGGGGGYGGGGGFGSGGYG 388 Score = 48.9 bits (115), Expect(2) = 6e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG + G GGG GGGGG Sbjct: 351 GGYGGGGGGYGGGGGGYGGYGGGGGYGGGGG 381 Score = 26.9 bits (58), Expect(2) = 6e-06 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSP 236 GGGG G GG GGG + P Sbjct: 378 GGGGFGSGGYGGGGGYSPAGP 398 [114][TOP] >UniRef100_Q1IRT5 Putative uncharacterized protein n=1 Tax=Candidatus Koribacter versatilis Ellin345 RepID=Q1IRT5_ACIBL Length = 315 Score = 55.5 bits (132), Expect(2) = 1e-08 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 77 GYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G H GG G GGGG+H GGGGG+H GGGGG Sbjct: 41 GQHGGGHGGGGGGGFHGGGGGGFHGGGGGG 70 Score = 29.6 bits (65), Expect(2) = 1e-08 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGG GGG G G G Sbjct: 65 GGGGGGGFHGGGGGFHGGGGGYHG 88 Score = 56.6 bits (135), Expect(2) = 2e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+H GGGG++GGGG ++GGGG YH GG GG Sbjct: 70 GGFHGGGGGFHGGGGGYHGGGGAYHGGGYGG 100 Score = 21.2 bits (43), Expect(2) = 2e-06 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPGLQG 248 GGG GGG G G G G Sbjct: 95 GGGYGGGYHGAGAYHGGYGGGYHG 118 [115][TOP] >UniRef100_Q75QN8 Cold shock domain protein 3 n=1 Tax=Triticum aestivum RepID=Q75QN8_WHEAT Length = 231 Score = 56.6 bits (135), Expect(2) = 1e-08 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 RGGY GGGGY GGGG + GGGGGY GGGG Sbjct: 92 RGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 122 Score = 28.5 bits (62), Expect(2) = 1e-08 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 180 GGGGGGGRGGGRSRTSGSPGLQGKPVCLERVKDGMVS 290 GGGGGGG GGG G G + C + ++G +S Sbjct: 154 GGGGGGGYGGGGYGGGGGGGRE----CYKCGEEGHIS 186 Score = 53.9 bits (128), Expect(2) = 1e-07 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G RG R GGY GGGGY GGGG + GGGGGY GG GG Sbjct: 87 GDRGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGYGG 130 Score = 28.1 bits (61), Expect(2) = 1e-07 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGG GGGG GGG Sbjct: 157 GGGGYGGGGYGGG 169 Score = 48.5 bits (114), Expect(2) = 4e-07 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG G GGY GGGG + GGGGGY GGGG Sbjct: 86 GGDRGGRGGYGGGGGGYGGGGGGYGGGGGG 115 Score = 31.6 bits (70), Expect(2) = 4e-07 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCLERVKDGMVS 290 GGGGGG GG GGG G G C + +DG +S Sbjct: 110 GGGGGGYGGGGGGYGGGGYGGGGGGGRGCYKCGEDGHIS 148 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG + GGGGY GGGGG Sbjct: 107 GGYGGGGGGYGGGGGGY--GGGGYGGGGGGG 135 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 177 GGGGGGGGRGGGR 215 GGGG GGG GGGR Sbjct: 162 GGGGYGGGGGGGR 174 [116][TOP] >UniRef100_B4JMZ8 GH24721 n=1 Tax=Drosophila grimshawi RepID=B4JMZ8_DROGR Length = 207 Score = 57.8 bits (138), Expect(2) = 1e-08 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 4/40 (10%) Frame = +2 Query: 74 GGYH--NGGGGYNGGGG--YHNGGGGGYHNGGGGGEERRR 181 GG H GGGGY+GGGG YH GGGGGYH GGGGG R+ Sbjct: 65 GGGHPGGGGGGYHGGGGGGYHGGGGGGYHGGGGGGGYGRK 104 Score = 27.3 bits (59), Expect(2) = 1e-08 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVC 260 GGGG GGG G G G G G P C Sbjct: 131 GGGGYHGGGGGVGGGGYHGGGGGGGGPQC 159 Score = 55.5 bits (132), Expect(2) = 2e-08 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG + GGGGY GGGG H GGGGG H GGGGG Sbjct: 44 GGGYGGGGGYGGGGGGHPGGGGGGHPGGGGG 74 Score = 28.9 bits (63), Expect(2) = 2e-08 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCLE 266 GGGGGG G GGG G G G+ +E Sbjct: 78 GGGGGGYHGGGGGGYHGGGGGGGYGRKPTIE 108 Score = 52.4 bits (124), Expect(2) = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNG----GGGGYHNGGGGG 166 GGYH GG G GGGYH G GGGGYH GGGGG Sbjct: 123 GGYHGGGAG---GGGYHGGGGGVGGGGYHGGGGGG 154 Score = 31.6 bits (70), Expect(2) = 3e-08 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGGG G GGG S S S Sbjct: 161 GGGGGGGHGGGGGGSYASSS 180 Score = 57.0 bits (136), Expect(2) = 5e-08 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 10/41 (24%) Frame = +2 Query: 74 GGYHNGGGGY----------NGGGGYHNGGGGGYHNGGGGG 166 GGY GGGG+ GGGGYH GGGGGYH GGGGG Sbjct: 51 GGYGGGGGGHPGGGGGGHPGGGGGGYHGGGGGGYHGGGGGG 91 Score = 26.2 bits (56), Expect(2) = 5e-08 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GG GG G G+ G Sbjct: 120 GGGGGYHGGGAGGGGYHGGGGGVGG 144 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG GGGGY GGGGY GGGGGY GGGG Sbjct: 32 GGGFGGGGGYGGGGGY--GGGGGYGGGGGG 59 Score = 28.9 bits (63), Expect(2) = 1e-06 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG G GGG G G G Sbjct: 62 GGGGGGHPGGGGGGYHGGGGGGYHG 86 Score = 47.8 bits (112), Expect(2) = 3e-06 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 22/52 (42%) Frame = +2 Query: 74 GGYHNGGGGYN--------------------GGGGYHNG--GGGGYHNGGGG 163 GGYH GGGG GGGGYH G GGGGYH GGGG Sbjct: 90 GGYHGGGGGGGYGRKPTIEVYVVKPVYQGGGGGGGYHGGGAGGGGYHGGGGG 141 Score = 29.3 bits (64), Expect(2) = 3e-06 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGGG GG GGG +S + Sbjct: 162 GGGGGGHGGGGGGSYASSSA 181 Score = 50.4 bits (119), Expect(2) = 9e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 12/43 (27%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYH------------NGGGGGYHNGGGGG 166 GGYH GGGG GGGGYH GGGGG H GGGGG Sbjct: 133 GGYHGGGGGV-GGGGYHGGGGGGGGPQCCGGGGGGGHGGGGGG 174 Score = 25.0 bits (53), Expect(2) = 9e-06 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGGG S S S G Sbjct: 166 GGHGGGGGGSYASSSANSYSHG 187 [117][TOP] >UniRef100_A6RXS7 Putative uncharacterized protein n=1 Tax=Botryotinia fuckeliana B05.10 RepID=A6RXS7_BOTFB Length = 197 Score = 57.0 bits (136), Expect(2) = 1e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG ++GGGGY+GGGGY+ GGGGG ++GGGGG Sbjct: 143 GGGYSGGGGYSGGGGYNGGGGGGGYSGGGGG 173 Score = 28.1 bits (61), Expect(2) = 1e-08 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GG G R+++ G+ G G Sbjct: 170 GGGGGYSGGGGYDRNQSGGNAGSWG 194 Score = 53.1 bits (126), Expect(2) = 8e-08 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G+ G R GG ++GGGGY+GGGGY GGGGY+ GGGGG Sbjct: 124 GYGGGRGYDNNNSGGGYSGGGGYSGGGGY--SGGGGYNGGGGGG 165 Score = 29.3 bits (64), Expect(2) = 8e-08 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 GGGGGGG GGG SG G Sbjct: 160 GGGGGGGYSGGGGGGYSGGGG 180 Score = 48.1 bits (113), Expect(2) = 5e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 G RG R GGY GGGGY GG GY N GG ++GGGG Sbjct: 103 GGRGGGGYGGRGGGGYGGGGGGYGGGRGYDNNNSGGGYSGGGG 145 Score = 28.1 bits (61), Expect(2) = 5e-06 Identities = 14/21 (66%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = +3 Query: 174 GGGGGGG--GGRGGGRSRTSG 230 GGGGGGG GG GGG S G Sbjct: 160 GGGGGGGYSGGGGGGYSGGGG 180 [118][TOP] >UniRef100_A9PIZ6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PIZ6_9ROSI Length = 171 Score = 49.7 bits (117), Expect(2) = 1e-08 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGGY+ GGG + GGG GY +GGGGG Sbjct: 109 GGRREGGGGYSRGGGGYGGGGSGYGSGGGGG 139 Score = 35.4 bits (80), Expect(2) = 1e-08 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGG GGGR R G G Sbjct: 135 GGGGGGGGYGGGRDRGYGDGG 155 [119][TOP] >UniRef100_A7YFB9 Glycine-rich protein n=1 Tax=Lilium formosanum RepID=A7YFB9_9LILI Length = 135 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/36 (77%), Positives = 28/36 (77%), Gaps = 5/36 (13%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGG-----GGYHNGGGGG 166 GGYHNGGG GGGGYHNGGG GGYHNGGGGG Sbjct: 62 GGYHNGGGYQGGGGGYHNGGGYQGGGGGYHNGGGGG 97 Score = 56.6 bits (135), Expect(2) = 2e-07 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 5/34 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHN-----GGGGGYHNGGG 160 GGY +GGGGY GGGGYHN GGGGGYHNGGG Sbjct: 50 GGY-SGGGGYPGGGGYHNGGGYQGGGGGYHNGGG 82 Score = 25.0 bits (53), Expect(2) = 2e-07 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 171 RGGGGGGGGGRGGGR 215 +GGGGG G GGGR Sbjct: 84 QGGGGGYHNGGGGGR 98 [120][TOP] >UniRef100_Q2PF07 Putative uncharacterized protein (Fragment) n=1 Tax=Trifolium pratense RepID=Q2PF07_TRIPR Length = 149 Score = 61.2 bits (147), Expect(2) = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGG 160 A+Y GGYH G G +NGGG YHNGGG GYHNGGG Sbjct: 88 AKY-GGYHGGSGYHNGGGSYHNGGGSGYHNGGG 119 Score = 23.9 bits (50), Expect(2) = 1e-08 Identities = 11/16 (68%), Positives = 11/16 (68%), Gaps = 3/16 (18%) Frame = +3 Query: 174 GGG---GGGGGGRGGG 212 GGG GGG GG GGG Sbjct: 123 GGGYHHGGGHGGHGGG 138 [121][TOP] >UniRef100_A8JAG8 Argonaute-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JAG8_CHLRE Length = 1037 Score = 49.3 bits (116), Expect(2) = 2e-08 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GG G GGGGY GGGGG GGGGG Sbjct: 41 GGYGGGGRGGGGGGGYGGGGGGGGRGGGGGG 71 Score = 35.4 bits (80), Expect(2) = 2e-08 Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG---KPVCLERVKDGMVSSAKHL 305 G GGGGGGG GGG R G G G P D ++ SAK L Sbjct: 64 GRGGGGGGGYGGGGGRGGGGGGGGGGVVSPAQAAASLDAILKSAKSL 110 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGGY GGGG GGGGGY GGGGG Sbjct: 34 GGGDRGGGGY-GGGGRGGGGGGGYGGGGGGG 63 Score = 34.3 bits (77), Expect(2) = 1e-07 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPG 239 RGGGGGGG G GGGR G G Sbjct: 65 RGGGGGGGYGGGGGRGGGGGGGG 87 Score = 46.6 bits (109), Expect(2) = 3e-07 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 89 GGGGYNGGGGYHNGGGGGYHNGGGGGE 169 GGGGY GGGGY GGGGG GGGGG+ Sbjct: 13 GGGGYGGGGGYGGGGGGG--RGGGGGD 37 Score = 46.6 bits (109), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG + GGGGY GGGG GGGGG GGG G Sbjct: 14 GGGYGGGGGYGGGGGGGRGGGGGDRGGGGYG 44 Score = 33.9 bits (76), Expect(2) = 3e-07 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPGLQG 248 R GGGGGG GG GGG R G G G Sbjct: 48 RGGGGGGGYGGGGGGGGRGGGGGGGYG 74 Score = 33.9 bits (76), Expect(2) = 3e-07 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGRGGG G G +G Sbjct: 57 GGGGGGGGRGGGGGGGYGGGGGRG 80 [122][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 329 SPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPP 360 Score = 39.3 bits (90), Expect(2) = 2e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPPRPPPP PPPP Sbjct: 304 PPSPPPPSPPPPPPPRPPPPSPPPP 328 Score = 44.3 bits (103), Expect(2) = 2e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 270 PPPPPSPPPPPPPRPPPPPPPSPPPPSPPPP 300 Score = 37.0 bits (84), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPPPP P Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSP 276 Score = 42.4 bits (98), Expect(2) = 3e-07 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 371 SPPPPPPPSPPPPPPPRPPPPS-PPPPSPPPP 401 Score = 38.1 bits (87), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPPRPPPP PPPP Sbjct: 336 PSPPPPPSPPPPPPPRPPPPSPPPP 360 Score = 42.4 bits (98), Expect(2) = 5e-07 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 402 SPPPPPPPSPPPPPPPRPPPPS-PPPPSPPPP 432 Score = 37.4 bits (85), Expect(2) = 5e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPPRPPPP PPPP Sbjct: 372 PPPPPPPSPPPPPPPRPPPPSPPPP 396 Score = 42.0 bits (97), Expect(2) = 6e-07 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 P PPP PPPPP PPPP PPPP PPR Sbjct: 323 PSPPPPSPPPPPPPSPPPPPSPPPPP---PPR 351 Score = 37.4 bits (85), Expect(2) = 6e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPPRPPPPPPP P Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSP 292 Score = 42.4 bits (98), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 275 SPPPPPPPRPPPPPPPSPPPPS-PPPPSPPPP 305 Score = 36.6 bits (83), Expect(2) = 8e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PP PPPPPP Sbjct: 257 PPSPPPPPPPSPPPPPPPSPPPPPP 281 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -2 Query: 162 PPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPP PPPPP PPPP PPPP PP Sbjct: 367 PPPPSPPPPPPPSPPPPPPPRPPPPSPPPP 396 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -2 Query: 162 PPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPP PPPPP PPPP PPPP PP Sbjct: 398 PPPPSPPPPPPPSPPPPPPPRPPPPSPPPP 427 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPP PPPP Sbjct: 309 PPSPPPPPPPRPPPPSPPPPSPPPP 333 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPP PPPP Sbjct: 341 PPSPPPPPPPRPPPPSPPPPSPPPP 365 Score = 40.8 bits (94), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PP PP PPPP PPPP PP Sbjct: 382 PPPPPRPPPPSPPPPSPPPPSPPPPPPPSPP 412 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPP PPP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPSPPP 346 Score = 42.7 bits (99), Expect(2) = 2e-06 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 262 PPPPPSPPPPPPPSPPPPPPPRPPPP 287 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPP PPP PP Sbjct: 267 SPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPP 299 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP P PPPPPPP Sbjct: 250 PPPPSPPPPSPPPPPPPSPPPPPPP 274 Score = 34.7 bits (78), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPP PPPP Sbjct: 202 PPSPPPP---SPPPPSPPPPSPPPP 223 Score = 40.8 bits (94), Expect(2) = 3e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPP PPPP PPPP PP Sbjct: 311 SPPPPPPPRPPPPS---PPPPSPPPPPPPSPP 339 Score = 36.2 bits (82), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PP PPPPPP Sbjct: 265 PPSPPPPPPPSPPPPPPPRPPPPPP 289 Score = 41.2 bits (95), Expect(2) = 4e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 337 SPPPPPSPPPPPPPR--PPPPS-PPPPSPPPP 365 Score = 35.4 bits (80), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPP PPPP Sbjct: 286 PPPPPSPPPPSPPPPSPPPPSPPPP 310 Score = 41.2 bits (95), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 162 PPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 PPPP PPPPP PPPP PPPP PPR Sbjct: 255 PPPPSPPPPPPPSPPPPPPPSPPPPP--PPR 283 Score = 41.2 bits (95), Expect(2) = 6e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP P PP PP Sbjct: 259 SPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPP 290 Score = 34.7 bits (78), Expect(2) = 6e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPP PPPP Sbjct: 197 PPSPPPP---SPPPPSPPPPSPPPP 218 Score = 34.7 bits (78), Expect(2) = 6e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPP PPPP Sbjct: 207 PPSPPPP---SPPPPSPPPPSPPPP 228 [123][TOP] >UniRef100_A9U2M5 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9U2M5_PHYPA Length = 219 Score = 51.6 bits (122), Expect(2) = 2e-08 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGYH GGGG GGGG GGGGG GGGGG Sbjct: 173 GGYHRGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Score = 33.1 bits (74), Expect(2) = 2e-08 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGG 216 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +2 Query: 77 GYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GY +G G +G GGYH GGGGG GGGGG Sbjct: 161 GYGDGSGYGHGPGGYHRGGGGGGGGGGGGG 190 Score = 33.1 bits (74), Expect(2) = 1e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGG 203 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +2 Query: 77 GYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GY +G GGY+ GGG GGGGG GGGGG Sbjct: 167 GYGHGPGGYHRGGGGGGGGGGGGGGGGGGG 196 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGG 209 [124][TOP] >UniRef100_Q07202 Cold and drought-regulated protein CORA n=1 Tax=Medicago sativa RepID=CORA_MEDSA Length = 204 Score = 57.8 bits (138), Expect(2) = 2e-08 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 4/38 (10%) Frame = +2 Query: 62 ARYRGGYHNGGG----GYNGGGGYHNGGGGGYHNGGGG 163 A+Y GGY++GGG GYN GGGY N GGGGYHNGGGG Sbjct: 48 AKYGGGYNHGGGYNGGGYNHGGGY-NHGGGGYHNGGGG 84 Score = 26.9 bits (58), Expect(2) = 2e-08 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 180 GGGGGGGRGGGRSRTSGSPGLQG 248 GGGG GG GGG G G G Sbjct: 94 GGGGHGGHGGGGYNGGGGHGGHG 116 Score = 56.6 bits (135), Expect(2) = 4e-08 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 74 GGYHNGGGGYN-GGGGYHNGGGGGYHNGGG 160 GGYHNGGGGYN GGGGY+ GGG G H GGG Sbjct: 76 GGYHNGGGGYNHGGGGYNGGGGHGGHGGGG 105 Score = 26.9 bits (58), Expect(2) = 4e-08 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 180 GGGGGGGRGGGRSRTSGSPGLQG 248 GGGG GG GGG G G G Sbjct: 108 GGGGHGGHGGGGYNGGGGHGGHG 130 Score = 55.5 bits (132), Expect(2) = 1e-07 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G+ G Y + GGY++GGGGY+ GGG +N GGGGY+ GGG G Sbjct: 59 GYNGGGYN---HGGGYNHGGGGYHNGGGGYNHGGGGYNGGGGHG 99 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPGLQG 248 GG GGGG GGG G G G Sbjct: 99 GGHGGGGYNGGGGHGGHGGGGYNG 122 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY++GGGGYNGGGG+ GGGGY+ GGG G Sbjct: 83 GGYNHGGGGYNGGGGHGGHGGGGYNGGGGHG 113 Score = 25.0 bits (53), Expect(2) = 2e-07 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPGLQG 248 GGGG GG GGG + G G G Sbjct: 108 GGGGHGGHGGGGYNGGGGHGGHGG 131 [125][TOP] >UniRef100_Q6QI34 LRRGT00174 n=1 Tax=Rattus norvegicus RepID=Q6QI34_RAT Length = 419 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 936 QFPFAIQAAQLLGRAIGAGLFAIRQLGERGMCCKAIKLGNARV 808 Q PFAIQ A +LGRAIGAGLFAI GERGMCCKAIKL +++ Sbjct: 324 QAPFAIQDAHMLGRAIGAGLFAITPAGERGMCCKAIKLVESQI 366 [126][TOP] >UniRef100_C6CD22 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Dickeya dadantii Ech703 RepID=C6CD22_DICDC Length = 1032 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = +1 Query: 772 SLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEW 930 +LA +L RRDW NP +Q+NRL AHPPF+ + AR D PS++ + LNGEW Sbjct: 9 TLAQILARRDWENPACSQVNRLDAHPPFSSWRNLQHARDDEPSRRRQPLNGEW 61 [127][TOP] >UniRef100_B9MXR5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MXR5_POPTR Length = 87 Score = 64.7 bits (156), Expect = 2e-08 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 12/78 (15%) Frame = -1 Query: 643 MLLRSSSTPVLGSLLSSSSFTDSPIHHNHSLHPESCHALKHLPLQH-------HHHS--- 494 MLLRSSSTPVLGSLL SSF+DSP + +++ H + KH P+ H +H + Sbjct: 6 MLLRSSSTPVLGSLL--SSFSDSPNNSSNNHHHDINTTFKHNPIHHQSINKLSYHQTGCF 63 Query: 493 --NKISCSSSPISPSISD 446 N ISC+SSPISPSIS+ Sbjct: 64 CLNTISCNSSPISPSISE 81 [128][TOP] >UniRef100_B7QJ84 Glycine-rich RNA-binding protein GRP1A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJ84_IXOSC Length = 105 Score = 55.5 bits (132), Expect(2) = 2e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ GGGG+ GGGG H GGGGG H GGGGG Sbjct: 44 GGHGGGGGGHGGGGGGHGGGGGGGHGGGGGG 74 Score = 29.3 bits (64), Expect(2) = 2e-08 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GG GGGGGG GGG Sbjct: 66 GGHGGGGGGHGGG 78 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +2 Query: 89 GGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGGG+ GGGG H GGGGG+ GGGGG Sbjct: 42 GGGGHGGGGGGHGGGGGGHGGGGGGG 67 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGG GGGG GGG Sbjct: 93 GGGGHGGGGHGGG 105 [129][TOP] >UniRef100_UPI00016C5334 RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C5334 Length = 137 Score = 54.7 bits (130), Expect(2) = 2e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 98 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 127 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 174 GGGGGGGGGRGGGR 215 GGGGGG GG GGGR Sbjct: 122 GGGGGGYGGGGGGR 135 Score = 49.3 bits (116), Expect(2) = 9e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 RGG GGGGY GGGG + GGGGGY GGGG Sbjct: 93 RGG---GGGGYGGGGGGYGGGGGGYGGGGGG 120 Score = 29.6 bits (65), Expect(2) = 9e-07 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGGG GGG G G Sbjct: 112 GGYGGGGGGYGGGGGGYGGGGG 133 [130][TOP] >UniRef100_B4NCL4 GK25061 n=1 Tax=Drosophila willistoni RepID=B4NCL4_DROWI Length = 694 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHN---GGGGGYHNGGGGGEERRRRRRRRR 199 GFRG R GG ++ GGG GGGG HN GGGGG GGGGG + +++R R R Sbjct: 172 GFRGGR-------GGGNSQGGG--GGGGNHNQGGGGGGGGQGGGGGGHQHQQQRDRNR 220 Score = 33.9 bits (76), Expect(2) = 2e-08 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSR 221 GGGGGGGGG GGG +R Sbjct: 238 GGGGGGGGGGGGGNAR 253 [131][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 46.6 bits (109), Expect(2) = 2e-08 Identities = 19/28 (67%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = -2 Query: 168 SPPPPPLW*PPPPP-LW*PPPPL*PPPP 88 SPPPPP++ PPPPP ++ PPPP PPPP Sbjct: 454 SPPPPPVYSPPPPPPVYSPPPPPPPPPP 481 Score = 37.7 bits (86), Expect(2) = 2e-08 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = -1 Query: 241 SPGDPLVLERPPPRPPPP---PPPPPLLS 164 SP P++ PPP PPPP PPPPP+ S Sbjct: 434 SPPPPVLSSPPPPSPPPPSPSPPPPPVYS 462 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL 85 S PPPPP++ PPPPP PPPP PPPP+ Sbjct: 462 SPPPPPPVYSPPPPP---PPPP--PPPPV 485 Score = 32.7 bits (73), Expect(2) = 4e-06 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 15/43 (34%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPP----PPP-----------PPPPLLSS 161 CSP P + PPP PP PPP PPPP+LSS Sbjct: 400 CSPFVPSLPTPPPPSPPVFPSPPPTPVYSPPPVFSPPPPVLSS 442 [132][TOP] >UniRef100_B4JYE9 GH14280 n=1 Tax=Drosophila grimshawi RepID=B4JYE9_DROGR Length = 214 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 G+ G Y Y GG ++GGGGY GGGGY GGGGGY G GG Sbjct: 107 GYSGGGYSGGGYSGGGYSGGGGYGGGGGY--GGGGGYGGGHGG 147 Score = 30.4 bits (67), Expect(2) = 2e-08 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGG GGGG GGG G G G Sbjct: 169 GGGGYGGGGYGGGGYGGGGHGGYSG 193 Score = 50.4 bits (119), Expect(2) = 6e-07 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G+ G Y Y GG ++GGGGY GGGGY GGGGGY GGGGG Sbjct: 44 GYSGGGYSGGGYSGGGYSGGGGY-GGGGY--GGGGGY--GGGGG 82 Score = 28.9 bits (63), Expect(2) = 6e-07 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGG GGGG GGG G G Sbjct: 94 GGGGYGGGGYGGGGYSGGGYSG 115 Score = 48.1 bits (113), Expect(2) = 2e-06 Identities = 25/52 (48%), Positives = 27/52 (51%), Gaps = 8/52 (15%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGG--------GGYHNGGGGG 166 G+ G Y Y GG GGGGY GGGGY GGG GG+ GG GG Sbjct: 49 GYSGGGYSGGGYSGGGGYGGGGYGGGGGYGGGGGVQVIKIIDGGHGGGGYGG 100 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGG GGGGG GGG G G Sbjct: 126 GGGYGGGGGYGGGGGYGGGHGG 147 [133][TOP] >UniRef100_Q03251 Glycine-rich RNA-binding protein 8 n=2 Tax=Arabidopsis thaliana RepID=GRP8_ARATH Length = 169 Score = 54.3 bits (129), Expect(2) = 2e-08 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 74 GGYHNGGGGYN--GGGGYHNGGGGGYHNGGGGGEERR 178 GG GGGY GGGGY GGGGGY GGGGG ERR Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERR 128 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 GGGGGG G GGG R G G Sbjct: 135 GGGGGGRGYGGGGRREGGGYG 155 Score = 48.5 bits (114), Expect(2) = 2e-07 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 A+ RG GGG GGGY +GGGGGY GGGGG Sbjct: 82 AQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 32.3 bits (72), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GG GGG R SG G G Sbjct: 112 GGGGGYSGGGGGGYERRSGGYGSGG 136 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 10/41 (24%) Frame = +2 Query: 74 GGYHNGGGGY---NGGGGYHNGGGGGYH-------NGGGGG 166 GGY +GGGG GGGGY GGGGGY +GGGGG Sbjct: 99 GGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGG 139 Score = 29.6 bits (65), Expect(2) = 9e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG G GGGR G G G Sbjct: 135 GGGGGGRGYGGGGRREGGGYGGGDG 159 [134][TOP] >UniRef100_Q09134 Abscisic acid and environmental stress-inducible protein n=1 Tax=Medicago sativa subsp. falcata RepID=GRPA_MEDFA Length = 159 Score = 59.3 bits (142), Expect(2) = 2e-08 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 11/45 (24%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGG------GYHNGGG-----GGYHNGGGG 163 A+Y GGY++GGGGYNGGG GY+NGGG GGY+NGGGG Sbjct: 35 AKYGGGYNHGGGGYNGGGYNHGGGGYNNGGGYNHGGGGYNNGGGG 79 Score = 25.0 bits (53), Expect(2) = 2e-08 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +3 Query: 174 GGGG---GGGGGRGGGRSRTSGSPGLQG 248 GGGG GGGG GG G G G Sbjct: 90 GGGGYNHGGGGYNNGGGGYNHGGGGYNG 117 Score = 58.9 bits (141), Expect(2) = 4e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY++GGGGYN GGG +N GGGGY+NGGGG Sbjct: 64 GGYNHGGGGYNNGGGGYNHGGGGYNNGGGG 93 Score = 24.6 bits (52), Expect(2) = 4e-08 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +3 Query: 174 GGGG---GGGGGRGGGRSRTSG 230 GGGG GGGG GGG + G Sbjct: 104 GGGGYNHGGGGYNGGGYNHGGG 125 Score = 58.9 bits (141), Expect(2) = 8e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY+NGGGGYN GGG +N GGGGY++GGGG Sbjct: 71 GGYNNGGGGYNHGGGGYNNGGGGYNHGGGG 100 Score = 23.5 bits (49), Expect(2) = 8e-08 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQ 245 GGG GGG GG G G Q Sbjct: 112 GGGYNGGGYNHGGGGYNHGGGGCQ 135 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY++GGGGYN GGG +N GGGGY+NGGGG Sbjct: 78 GGYNHGGGGYNNGGGGYNHGGGGYNNGGGG 107 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY+NGGGGYN GGG +N GGGGY++GGGG Sbjct: 85 GGYNNGGGGYNHGGGGYNNGGGGYNHGGGG 114 [135][TOP] >UniRef100_Q4W5R4 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans RepID=Q4W5R4_CAEEL Length = 643 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/61 (45%), Positives = 41/61 (67%), Gaps = 2/61 (3%) Frame = +2 Query: 32 YGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRRRRRR--RRTW 205 +G R RY+ GG NGGGG GGGG +GGGGG+ +GGGGG ++++++R ++ W Sbjct: 582 FGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQSGGGGGRQQQQQQRAQPQQDW 641 Query: 206 W 208 W Sbjct: 642 W 642 [136][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 22/41 (53%), Positives = 23/41 (56%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRP 43 PPPPP PPPPP PPPP PPPP PPR + P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIP 68 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -1 Query: 259 HTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 H+ P P P PPP PPPPPPPPP Sbjct: 5 HSLTPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 45.1 bits (105), Expect(2) = 9e-08 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRA 61 PPPPP PPPPP PPPP PPPP PP RA Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRA 61 Score = 37.4 bits (85), Expect(2) = 9e-08 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 [137][TOP] >UniRef100_Q03251-2 Isoform 2 of Glycine-rich RNA-binding protein 8 n=1 Tax=Arabidopsis thaliana RepID=Q03251-2 Length = 110 Score = 54.3 bits (129), Expect(2) = 2e-08 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 74 GGYHNGGGGYN--GGGGYHNGGGGGYHNGGGGGEERR 178 GG GGGY GGGGY GGGGGY GGGGG ERR Sbjct: 33 GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERR 69 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 GGGGGG G GGG R G G Sbjct: 76 GGGGGGRGYGGGGRREGGGYG 96 Score = 48.5 bits (114), Expect(2) = 3e-07 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 A+ RG GGG GGGY +GGGGGY GGGGG Sbjct: 23 AQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGG 57 Score = 32.3 bits (72), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GG GGG R SG G G Sbjct: 53 GGGGGYSGGGGGGYERRSGGYGSGG 77 Score = 45.8 bits (107), Expect(2) = 1e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 10/41 (24%) Frame = +2 Query: 74 GGYHNGGGGY---NGGGGYHNGGGGGYH-------NGGGGG 166 GGY +GGGG GGGGY GGGGGY +GGGGG Sbjct: 40 GGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGG 80 Score = 29.6 bits (65), Expect(2) = 1e-05 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG G GGGR G G G Sbjct: 76 GGGGGGRGYGGGGRREGGGYGGGDG 100 [138][TOP] >UniRef100_B6HS19 Pc22g21030 protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6HS19_PENCW Length = 552 Score = 54.7 bits (130), Expect(2) = 3e-08 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 6/52 (11%) Frame = +2 Query: 29 SYGFR------GRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 SYG+ G YR GGY GGGGY GGGGY G GGGY G GGG Sbjct: 2 SYGYSRGGGGGGDSYRSRGGDGGYGGGGGGYGGGGGYGGGRGGGYGGGYGGG 53 Score = 29.3 bits (64), Expect(2) = 3e-08 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGG GGG GG R G+ Sbjct: 52 GGGGGYGGGAGGDRMNNLGA 71 [139][TOP] >UniRef100_B6KPI0 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KPI0_TOXGO Length = 538 Score = 54.7 bits (130), Expect(2) = 3e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 120 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 149 Score = 29.3 bits (64), Expect(2) = 3e-08 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGS 233 GGGGGG G GGG S GS Sbjct: 174 GGGGGGYGAGGGNSGGYGS 192 Score = 53.9 bits (128), Expect(2) = 6e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 127 GGYGGGGGGYGGGGGGYGGGGGGYGAGGGG 156 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGG G GG GGG G+ G G Sbjct: 167 GGGGYGAGGGGGGYGAGGGNSGGYG 191 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 13/55 (23%) Frame = +2 Query: 38 FRGRRYR*ARYRGGYHNG-------------GGGYNGGGGYHNGGGGGYHNGGGG 163 FRG R Y GGY G GGGY GGGG + GGGGGY GGGG Sbjct: 88 FRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGG 142 Score = 30.8 bits (68), Expect(2) = 2e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GGG G G G Sbjct: 137 GGGGGGYGGGGGGYGAGGGGYGAGG 161 Score = 51.6 bits (122), Expect(2) = 5e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGY GGGG Sbjct: 134 GGYGGGGGGYGGGGGGYGAGGGGYGAGGGG 163 Score = 28.1 bits (61), Expect(2) = 5e-07 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 156 EEEERRGGGGGGGGGRGGGRSRTSGSPGLQGKP 254 E+ R GGGG GGG+ G P + P Sbjct: 202 EKHRSRSRSPGGGGAAGGGKGARGGQPKPRRNP 234 Score = 50.8 bits (120), Expect(2) = 6e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGG + GGGGY GGGGG Sbjct: 148 GGYGAGGGGYGAGGGGYGAGGGGYGAGGGGG 178 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +3 Query: 174 GGGGGGGGGRGG-----GRSRTSGSPGLQG 248 G G G GGGR G RSR+ G G G Sbjct: 189 GYGSGYGGGRSGREKHRSRSRSPGGGGAAG 218 [140][TOP] >UniRef100_B9QIA3 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG RepID=B9QIA3_TOXGO Length = 481 Score = 54.7 bits (130), Expect(2) = 3e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 63 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 92 Score = 29.3 bits (64), Expect(2) = 3e-08 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGS 233 GGGGGG G GGG S GS Sbjct: 117 GGGGGGYGAGGGNSGGYGS 135 Score = 53.9 bits (128), Expect(2) = 6e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGGY GGGG Sbjct: 70 GGYGGGGGGYGGGGGGYGGGGGGYGAGGGG 99 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGG G GG GGG G+ G G Sbjct: 110 GGGGYGAGGGGGGYGAGGGNSGGYG 134 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 27/55 (49%), Positives = 28/55 (50%), Gaps = 13/55 (23%) Frame = +2 Query: 38 FRGRRYR*ARYRGGYHNG-------------GGGYNGGGGYHNGGGGGYHNGGGG 163 FRG R Y GGY G GGGY GGGG + GGGGGY GGGG Sbjct: 31 FRGDREYRGDYYGGYGPGSSSGGPQSDRGYGGGGYGGGGGGYGGGGGGYGGGGGG 85 Score = 30.8 bits (68), Expect(2) = 2e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GGG G G G Sbjct: 80 GGGGGGYGGGGGGYGAGGGGYGAGG 104 Score = 51.6 bits (122), Expect(2) = 5e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG + GGGGY GGGG Sbjct: 77 GGYGGGGGGYGGGGGGYGAGGGGYGAGGGG 106 Score = 28.1 bits (61), Expect(2) = 5e-07 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 156 EEEERRGGGGGGGGGRGGGRSRTSGSPGLQGKP 254 E+ R GGGG GGG+ G P + P Sbjct: 145 EKHRSRSRSPGGGGAAGGGKGARGGQPKPRRNP 177 Score = 50.8 bits (120), Expect(2) = 6e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGG + GGGGY GGGGG Sbjct: 91 GGYGAGGGGYGAGGGGYGAGGGGYGAGGGGG 121 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +3 Query: 174 GGGGGGGGGRGG-----GRSRTSGSPGLQG 248 G G G GGGR G RSR+ G G G Sbjct: 132 GYGSGYGGGRSGREKHRSRSRSPGGGGAAG 161 [141][TOP] >UniRef100_C3ZP43 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3ZP43_BRAFL Length = 445 Score = 50.4 bits (119), Expect(2) = 3e-08 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG+ GGGG+ GGGGG+ GGGGG Sbjct: 382 GGGFGGGGGFGGGGGFGAGGGGGFGGGGGGG 412 Score = 33.5 bits (75), Expect(2) = 3e-08 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSG 230 +GGGGGGG RGGG SR G Sbjct: 415 KGGGGGGGFSRGGGGSRGGG 434 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +2 Query: 77 GYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G+ GGGG+ GGGG+ GGGGG+ GGGGG Sbjct: 377 GFGGGGGGFGGGGGF--GGGGGFGAGGGGG 404 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGG GGG S+ G G Sbjct: 400 GGGGGFGGGGGGGFSKGGGGGG 421 Score = 47.0 bits (110), Expect(2) = 5e-06 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 74 GGYHNGGG-GYNGGGGYHNGGGGGYHNGGGGG 166 GG+ GGG G GGGG+ GGGGG+ GGGGG Sbjct: 389 GGFGGGGGFGAGGGGGFGGGGGGGFSKGGGGG 420 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 14/22 (63%), Positives = 15/22 (68%), Gaps = 3/22 (13%) Frame = +3 Query: 174 GGGG---GGGGGRGGGRSRTSG 230 GGGG GGGG RGGG S+ G Sbjct: 419 GGGGFSRGGGGSRGGGFSKGGG 440 [142][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPPL PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 38.1 bits (87), Expect(2) = 3e-08 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -1 Query: 256 TGLPCSPGDPLVLERPPPRPPPPPPPPP 173 T + P V+ PPP PPPPPPPPP Sbjct: 221 TAVVVPPPQVQVVPPPPPPPPPPPPPPP 248 Score = 44.7 bits (104), Expect(2) = 8e-08 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPPL PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 37.7 bits (86), Expect(2) = 8e-08 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 +P P P PPP PPPPPPPPP Sbjct: 233 VPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -1 Query: 286 TIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 T+P+ + + P P PPP PPPPPPPPP Sbjct: 218 TLPTAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPPPPP 255 Score = 42.0 bits (97), Expect(2) = 6e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPP PPPPL PP Sbjct: 256 PPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 37.4 bits (85), Expect(2) = 6e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPP 259 [143][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 45.4 bits (106), Expect(2) = 3e-08 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPPL PPPPP PPPP PPPP Sbjct: 311 PPPPPLPSPPPPPPTPPPPPPPPPPP 336 Score = 38.5 bits (88), Expect(2) = 3e-08 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 211 PPPRPPPPPPPPPLLS 164 PPP PPPPPPPPPL S Sbjct: 303 PPPSPPPPPPPPPLPS 318 [144][TOP] >UniRef100_UPI0000DA3CD5 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3CD5 Length = 311 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG GGGG GGGG GGGGG GGGGG Sbjct: 178 RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 209 Score = 38.1 bits (87), Expect(2) = 3e-08 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGL 242 GGGGGGGGG GGGRS G G+ Sbjct: 219 GGGGGGGGGGGGGRSGGGGGRGI 241 Score = 44.7 bits (104), Expect(2) = 1e-07 Identities = 23/45 (51%), Positives = 24/45 (53%) Frame = +2 Query: 32 YGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 Y +G R GG GGGG GGGG GGGGG GGGGG Sbjct: 166 YRIKGCSVRVPGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 210 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG R+ G G Sbjct: 217 GGGGGGGGGGGGGGGRSGGGGG 238 Score = 43.9 bits (102), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 211 Score = 36.2 bits (82), Expect(2) = 4e-07 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG SG G +G Sbjct: 216 GGGGGGGGGGGGGGGGRSGGGGGRG 240 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 212 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 210 GGGGGGGGGGGGGGGGGGGGGGRSG 234 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 213 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 214 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G G G+ Sbjct: 207 GGGGGGGGGGGGGGGGGGGGGGGGGR 232 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCL 263 GGGGGGGGG GGG S G G+ + L Sbjct: 214 GGGGGGGGGGGGGGGGGGRSGGGGGRGILL 243 [145][TOP] >UniRef100_UPI0000DA1EB9 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1EB9 Length = 270 Score = 46.6 bits (109), Expect(2) = 3e-08 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 65 RYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 R RGG GGGG GGGG GGGGG GGGGG Sbjct: 151 RGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 184 Score = 37.4 bits (85), Expect(2) = 3e-08 Identities = 22/48 (45%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG-----SPGLQGKPVCLERVKDGMVSSAKH 302 GGGGGGGGG GGGR R G S L G + + VS+AK+ Sbjct: 196 GGGGGGGGGGGGGRGRGRGRGRRISVDLSGLKLSGAEQGEPTVSTAKY 243 Score = 43.9 bits (102), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 185 Score = 35.0 bits (79), Expect(2) = 8e-07 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G G +G+ Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGRGR 211 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 186 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 187 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G G G+ Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGR 209 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG 230 GGGGGGGGG GGG R G Sbjct: 194 GGGGGGGGGGGGGGGRGRG 212 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 188 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 189 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 191 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGG 201 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGG 202 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGG 203 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGG 204 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 192 Score = 32.3 bits (72), Expect(2) = 5e-06 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCLE 266 GGGGGGGGG GGG G +G+ + ++ Sbjct: 192 GGGGGGGGGGGGGGGGGRGRGRGRGRRISVD 222 Score = 43.9 bits (102), Expect(2) = 7e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 163 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193 Score = 32.0 bits (71), Expect(2) = 7e-06 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G +G+ Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGRGRGR 213 [146][TOP] >UniRef100_A4CWS8 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 7805 RepID=A4CWS8_SYNPV Length = 197 Score = 48.9 bits (115), Expect(2) = 3e-08 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGG--YHNGGGGGYHNGGGGG 166 RGG GGGGY GGGG Y GGGGGY GGGGG Sbjct: 86 RGG---GGGGYGGGGGGGYGGGGGGGYGGGGGGG 116 Score = 35.0 bits (79), Expect(2) = 3e-08 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 3/30 (10%) Frame = +3 Query: 171 RGGGGG---GGGGRGGGRSRTSGSPGLQGK 251 RGGGGG GGGG GGG R SG+ G + + Sbjct: 118 RGGGGGYNDGGGGYGGGGERRSGARGWEDR 147 [147][TOP] >UniRef100_A1UZL0 Single-stranded DNA-binding protein n=2 Tax=Burkholderia mallei RepID=A1UZL0_BURMS Length = 196 Score = 46.6 bits (109), Expect(2) = 3e-08 Identities = 20/34 (58%), Positives = 21/34 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEER 175 GGY GGGGY GG GGGGG +GGGG R Sbjct: 124 GGYGGGGGGYGGGRDMERGGGGGRASGGGGAGAR 157 Score = 37.4 bits (85), Expect(2) = 3e-08 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG SR S G Sbjct: 163 GGGGGGGGGGGGGASRPSAPAG 184 [148][TOP] >UniRef100_D0CMI9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. WH 8109 RepID=D0CMI9_9SYNE Length = 190 Score = 55.5 bits (132), Expect(2) = 3e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGGY GGGGG GGGGG Sbjct: 94 GGYGGGGGGYRGGGGYGGGGGGGGGGGGGGG 124 Score = 28.5 bits (62), Expect(2) = 3e-08 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 5/31 (16%) Frame = +3 Query: 174 GGGGGG--GGGRGGGRS---RTSGSPGLQGK 251 GGGGGG GGG GGG + R SG+ G + + Sbjct: 119 GGGGGGYAGGGGGGGYAGGDRPSGARGWEDR 149 Score = 47.4 bits (111), Expect(2) = 8e-08 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG GGGGY GGGG + GGGGY GGGGG Sbjct: 86 RGGGGYGGGGYGGGGGGYR-GGGGYGGGGGGG 116 Score = 35.0 bits (79), Expect(2) = 8e-08 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG + G G G Sbjct: 112 GGGGGGGGGGGGGYAGGGGGGGYAG 136 [149][TOP] >UniRef100_B1Y6Y3 RNP-1 like RNA-binding protein n=1 Tax=Leptothrix cholodnii SP-6 RepID=B1Y6Y3_LEPCP Length = 157 Score = 47.8 bits (112), Expect(2) = 3e-08 Identities = 21/33 (63%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHN--GGGGG 166 GG +GGGGY GGGG GGGGG+ + GGGGG Sbjct: 101 GGGRSGGGGYGGGGGAGGGGGGGFRSPYGGGGG 133 Score = 36.2 bits (82), Expect(2) = 3e-08 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +3 Query: 174 GGGGGGGGGR-GGGRSRTSGSPGLQG 248 GGGGGGGGGR GGG R+ G G G Sbjct: 129 GGGGGGGGGRSGGGGGRSGGGGGYGG 154 [150][TOP] >UniRef100_A3ZRX9 RNA-binding protein n=1 Tax=Blastopirellula marina DSM 3645 RepID=A3ZRX9_9PLAN Length = 149 Score = 47.8 bits (112), Expect(2) = 3e-08 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = +2 Query: 65 RYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 R R G GGGGY GGGG GGGGY GGGG Sbjct: 82 RERSGGGGGGGGYGGGGGGGRSGGGGYGGGGGG 114 Score = 36.2 bits (82), Expect(2) = 3e-08 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGGRGG R G G Sbjct: 124 GGGGGGGGGRGGDRGGRGGDRG 145 Score = 47.0 bits (110), Expect(2) = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG +GGGGY GGGG GGGGY GGGGG Sbjct: 99 GGGRSGGGGYGGGGG-GRSGGGGYGGGGGGG 128 Score = 29.6 bits (65), Expect(2) = 4e-06 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGG GGGR G G Sbjct: 122 GGGGGGGG-GGGRGGDRGGRG 141 [151][TOP] >UniRef100_A1JTC4 Beta-galactosidase n=1 Tax=Yersinia enterocolitica subsp. enterocolitica 8081 RepID=BGAL_YERE8 Length = 1050 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/63 (44%), Positives = 41/63 (65%) Frame = +1 Query: 742 QSDPRVPSSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLN 921 Q + + ++ +L+ +L RRDW NP +TQ NRL AHPPF + + A+ D PS Q + LN Sbjct: 4 QQEVKPQATPALSQILFRRDWENPQITQYNRLEAHPPFYSWRHLDAAQNDTPSPQRQLLN 63 Query: 922 GEW 930 G+W Sbjct: 64 GQW 66 [152][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 50.8 bits (120), Expect(2) = 3e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 65 RYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 R RGG G GG GGGGY GGGGGY GGGGG Sbjct: 36 RGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGGGG 69 Score = 33.1 bits (74), Expect(2) = 3e-08 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 174 GGGGGGGGGRGGGR 215 GGGG GGGGRGGGR Sbjct: 87 GGGGRGGGGRGGGR 100 Score = 46.2 bits (108), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGG GGG GGGGGY GGGGG Sbjct: 22 GGYGGRGGGGGGGGRGRGGGGGGYGGGGGGG 52 Score = 33.9 bits (76), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGG G GGG R G G G Sbjct: 55 GGGGGGGYGGGGGGGRGGGGGGFGG 79 Score = 48.1 bits (113), Expect(2) = 6e-07 Identities = 26/44 (59%), Positives = 26/44 (59%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G RGR Y GG GGGGY GGGG GGGGG GGGGG Sbjct: 34 GGRGRGGGGGGYGGG--GGGGGYGGGGGGGYGGGGGGGRGGGGG 75 Score = 31.6 bits (70), Expect(2) = 6e-07 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVC 260 GGGG GG G GGGR G +G VC Sbjct: 78 GGGGRGGVGGGGGRGGGGRGGGREGDWVC 106 Score = 44.7 bits (104), Expect(2) = 3e-06 Identities = 23/42 (54%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +2 Query: 53 YR*ARYRGGYHNGG----GGYNGGGGYHNGGGGGYHNGGGGG 166 YR GGY +GG GG GGGG GGGGG + GGGGG Sbjct: 10 YRGGGGGGGYGSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGG 51 Score = 32.3 bits (72), Expect(2) = 3e-06 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGG GGG GGGR G G G+ Sbjct: 57 GGGGGYGGGGGGGRGGGGGGFGGGGR 82 [153][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 45.1 bits (105), Expect(2) = 3e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 PPPPP PPPPP PPPP PPPP PPR Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 38.9 bits (89), Expect(2) = 3e-08 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP P P PPP PPPPPPPPP Sbjct: 2 LPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 [154][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 44.3 bits (103), Expect(2) = 3e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 1164 SPPPPPSPMPPPPPS--PPPPRPPPPPSPPPP 1193 Score = 39.3 bits (90), Expect(2) = 3e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPPRPPPPP PPP Sbjct: 1099 PPSPPPPPPPSPPPPRPPPPPSPPP 1123 Score = 42.0 bits (97), Expect(2) = 4e-08 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PP PP PPPP PPPP+ PP Sbjct: 1101 SPPPPP---PPSPPPPRPPPPPSPPPPVHEPP 1129 Score = 41.2 bits (95), Expect(2) = 4e-08 Identities = 21/52 (40%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Frame = -1 Query: 310 RQRCLALETIPSFTLSKHTGLPC------SPGDPLVLERPPPRPPPPPPPPP 173 R+ CL E P+ + PC SP P PPP PPP PPPPP Sbjct: 1055 REGCLTNERFPAPPAAAMDNRPCEKPPPPSPPSPPSPPSPPPPPPPSPPPPP 1106 Score = 42.4 bits (98), Expect(2) = 3e-07 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPP P PPPPP PPPP PPPP PP Sbjct: 1156 SPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPP 1187 Score = 38.1 bits (87), Expect(2) = 3e-07 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P + PPP PPPPP PPP Sbjct: 1116 PPPPSPPPPVHEPPPSPPPPPSPPP 1140 Score = 40.0 bits (92), Expect(2) = 8e-07 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPP PPP PPPP PP Sbjct: 1200 SPPPPPNPSPPPPSPMPPPPSPMPPPPSPPPP 1231 Score = 38.9 bits (89), Expect(2) = 8e-07 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPPRPPPPP PPP Sbjct: 1168 PPSPMPPPPPSPPPPRPPPPPSPPP 1192 Score = 41.6 bits (96), Expect(2) = 5e-06 Identities = 21/35 (60%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPP--PL*PPPPL**PPR 70 SPPPPP PP PP PPP P+ PPPP PPR Sbjct: 1149 SPPPPPPSPPPSPPPSPPPPPSPMPPPPPSPPPPR 1183 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPP PPPP Sbjct: 1094 PPPPPPPSPPPPPPPSPPPPRPPPP 1118 [155][TOP] >UniRef100_B9H5S2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H5S2_POPTR Length = 1494 Score = 43.5 bits (101), Expect(2) = 3e-08 Identities = 23/34 (67%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL--*PPPPL**PP 73 SPPPPP PPPPPL PPPL PPPPL PP Sbjct: 1240 SPPPPPPLPPPPPPLPSQPPPLPSQPPPPL--PP 1271 Score = 40.0 bits (92), Expect(2) = 3e-08 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPPL 170 LP SP PL L PP P PPPPPPL Sbjct: 1221 LPTSPPPPLPLSPPPSTSPSPPPPPPL 1247 [156][TOP] >UniRef100_UPI00001EDBAC DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Mus musculus RepID=UPI00001EDBAC Length = 1384 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGG GGGGG+ GGGGG Sbjct: 1218 GGFGSGGGGFGSGGGGFGGGGGGFSGGGGGG 1248 Score = 33.9 bits (76), Expect(2) = 3e-08 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG GS G Sbjct: 1244 GGGGGFGGGRGGGGGGFGGSGG 1265 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = +2 Query: 23 Y*SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 Y S GF G + GG+++GGGG+ GGG GGGG+ GGGG Sbjct: 1194 YGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGG 1240 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGG GGGR G G G Sbjct: 1238 GGGFSGGGGGGFGGGRGGGGGGFGGSG 1264 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 74 GGYHNGGGGYN-GGGGYHNGGGGGYHNGGGG 163 GG+ +GGGGY GGGGY GGGGGY G GG Sbjct: 1264 GGFGSGGGGYGVGGGGYGGGGGGGYGGGSGG 1294 Score = 47.0 bits (110), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGGG +GGGGG GG GG Sbjct: 1225 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 1255 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 G GGGGGGG GGG G G G Sbjct: 1279 GYGGGGGGGYGGGSGGYGGGGGGYG 1303 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKP 254 GG GGG GG GGG G G P Sbjct: 1286 GGYGGGSGGYGGGGGGYGGGEGYSISP 1312 [157][TOP] >UniRef100_UPI0000025476 DEAH (Asp-Glu-Ala-His) box polypeptide 9 n=1 Tax=Mus musculus RepID=UPI0000025476 Length = 1383 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGG GGGGG+ GGGGG Sbjct: 1217 GGFGSGGGGFGSGGGGFGGGGGGFSGGGGGG 1247 Score = 33.9 bits (76), Expect(2) = 3e-08 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG GS G Sbjct: 1243 GGGGGFGGGRGGGGGGFGGSGG 1264 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = +2 Query: 23 Y*SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 Y S GF G + GG+++GGGG+ GGG GGGG+ GGGG Sbjct: 1193 YGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGG 1239 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGG GGGR G G G Sbjct: 1237 GGGFSGGGGGGFGGGRGGGGGGFGGSG 1263 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 74 GGYHNGGGGYN-GGGGYHNGGGGGYHNGGGG 163 GG+ +GGGGY GGGGY GGGGGY G GG Sbjct: 1263 GGFGSGGGGYGVGGGGYGGGGGGGYGGGSGG 1293 Score = 47.0 bits (110), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGGG +GGGGG GG GG Sbjct: 1224 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 1254 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 G GGGGGGG GGG G G G Sbjct: 1278 GYGGGGGGGYGGGSGGYGGGGGGYG 1302 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKP 254 GG GGG GG GGG G G P Sbjct: 1285 GGYGGGSGGYGGGGGGYGGGEGYSISP 1311 [158][TOP] >UniRef100_O70133-2 Isoform 2 of ATP-dependent RNA helicase A n=1 Tax=Mus musculus RepID=O70133-2 Length = 1381 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGG GGGGG+ GGGGG Sbjct: 1217 GGFGSGGGGFGSGGGGFGGGGGGFSGGGGGG 1247 Score = 33.9 bits (76), Expect(2) = 3e-08 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG GS G Sbjct: 1243 GGGGGFGGGRGGGGGGFGGSGG 1264 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = +2 Query: 23 Y*SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 Y S GF G + GG+++GGGG+ GGG GGGG+ GGGG Sbjct: 1193 YGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGG 1239 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGG GGGR G G G Sbjct: 1237 GGGFSGGGGGGFGGGRGGGGGGFGGSG 1263 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 74 GGYHNGGGGYN-GGGGYHNGGGGGYHNGGGG 163 GG+ NGGGGY GGGGY GGGGGY G GG Sbjct: 1263 GGFGNGGGGYGVGGGGYGGGGGGGYGGGSGG 1293 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = +3 Query: 174 GGGGGG--GGGRGGGRSRTSG 230 GGGGGG GG +GG R+ G Sbjct: 1317 GGGGGGYRGGSQGGYRNNFGG 1337 Score = 47.0 bits (110), Expect(2) = 8e-06 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGGG +GGGGG GG GG Sbjct: 1224 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 1254 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG 230 G GGGGGGG GGG G Sbjct: 1278 GYGGGGGGGYGGGSGGYGG 1296 [159][TOP] >UniRef100_O70133 ATP-dependent RNA helicase A n=2 Tax=Mus musculus RepID=DHX9_MOUSE Length = 1380 Score = 49.7 bits (117), Expect(2) = 3e-08 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGG GGGGG+ GGGGG Sbjct: 1216 GGFGSGGGGFGSGGGGFGGGGGGFSGGGGGG 1246 Score = 33.9 bits (76), Expect(2) = 3e-08 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG GS G Sbjct: 1242 GGGGGFGGGRGGGGGGFGGSGG 1263 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = +2 Query: 23 Y*SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 Y S GF G + GG+++GGGG+ GGG GGGG+ GGGG Sbjct: 1192 YGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGG 1238 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGG GGGR G G G Sbjct: 1236 GGGFSGGGGGGFGGGRGGGGGGFGGSG 1262 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 74 GGYHNGGGGYN-GGGGYHNGGGGGYHNGGGG 163 GG+ NGGGGY GGGGY GGGGGY G GG Sbjct: 1262 GGFGNGGGGYGVGGGGYGGGGGGGYGGGSGG 1292 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = +3 Query: 174 GGGGGG--GGGRGGGRSRTSG 230 GGGGGG GG +GG R+ G Sbjct: 1316 GGGGGGYRGGSQGGYRNNFGG 1336 Score = 47.0 bits (110), Expect(2) = 8e-06 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGGG +GGGGG GG GG Sbjct: 1223 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 1253 Score = 28.5 bits (62), Expect(2) = 8e-06 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG 230 G GGGGGGG GGG G Sbjct: 1277 GYGGGGGGGYGGGSGGYGG 1295 [160][TOP] >UniRef100_Q4TB22 Chromosome 15 SCAF7210, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4TB22_TETNG Length = 1021 Score = 53.9 bits (128), Expect(2) = 3e-08 Identities = 28/50 (56%), Positives = 30/50 (60%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRRR 184 G+RGR GG + GGGGY GGGGY GGGGGY GGG G R R Sbjct: 933 GYRGRGGPFQGGGGGGYGGGGGYRGGGGY--GGGGGYRGGGGYGGRRGYR 980 Score = 29.6 bits (65), Expect(2) = 3e-08 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPG 239 RG GGGGG G GGG G+ G Sbjct: 995 RGNGGGGGYGGGGGYGGGGGNGG 1017 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 23/44 (52%), Positives = 24/44 (54%), Gaps = 10/44 (22%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGG----------GGYHNGGGGGEER 175 GG + GGGGY GGGGY GGG GGY GGG G R Sbjct: 952 GGGYRGGGGYGGGGGYRGGGGYGGRRGYRGSGGYRGGGGYGGGR 995 Score = 28.9 bits (63), Expect(2) = 5e-06 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG 230 GGG GGGGG GGG G Sbjct: 1000 GGGYGGGGGYGGGGGNGGG 1018 [161][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 45.4 bits (106), Expect(2) = 4e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 159 SPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 190 Score = 38.1 bits (87), Expect(2) = 4e-08 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 253 GLPCSPGDPLVLERPPPRPPPPPPPPP 173 G P P +P PPP PPPPPPP P Sbjct: 120 GCPPPPPEPECPPPPPPSPPPPPPPSP 146 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPP PPPP PP Sbjct: 165 SPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPP P Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSP 160 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 151 SPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPP 182 Score = 43.5 bits (101), Expect(2) = 5e-07 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYR 49 S PPPPP PPPPP PPPP PPPP PP R R + Sbjct: 173 SPPPPPPPPPPPPPP---PPPPPPPPPPPPPPPVDRNARLK 210 Score = 36.2 bits (82), Expect(2) = 5e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPPPPP Sbjct: 157 PPSPPPPPSPPPPPPPSPPPPPPPP 181 Score = 34.7 bits (78), Expect(2) = 5e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPP PPP Sbjct: 135 PPSPPPP-----PPPSPPPPPSPPP 154 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 198 Score = 35.8 bits (81), Expect(2) = 6e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPP PPP Sbjct: 144 PSPPPPPSPPPPPPPSPPPPPSPPP 168 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 145 SPPPPPS-PPPPPPPSPPPPPSPPPPPPPSPP 175 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPPPPPPPPP 173 C P P PPP PPPPP PP Sbjct: 130 CPPPPPPSPPPPPPPSPPPPPSPP 153 [162][TOP] >UniRef100_P0C7L0 WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=WIPF3_MOUSE Length = 485 Score = 45.8 bits (107), Expect(2) = 4e-08 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPPL PPPPPL PPPP P PP+ Sbjct: 16 PPPPPLGAPPPPPLGAPPPPPPPGPPV 42 Score = 37.7 bits (86), Expect(2) = 4e-08 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPPL 170 PPP PPPPPPPPPL Sbjct: 8 PPPPPPPPPPPPPL 21 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 21/34 (61%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPP---L*PPPPL**PP 73 PPPPP PPPPPL PPPP PPPP PP Sbjct: 8 PPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPP 41 Score = 36.2 bits (82), Expect(2) = 1e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPP 173 PPP PPPPPPPPP Sbjct: 4 PPPPPPPPPPPPP 16 [163][TOP] >UniRef100_UPI0001552DAA PREDICTED: similar to CR16 n=1 Tax=Mus musculus RepID=UPI0001552DAA Length = 483 Score = 45.8 bits (107), Expect(2) = 4e-08 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPPL PPPPPL PPPP P PP+ Sbjct: 16 PPPPPLGAPPPPPLGAPPPPPPPGPPV 42 Score = 37.7 bits (86), Expect(2) = 4e-08 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPPL 170 PPP PPPPPPPPPL Sbjct: 8 PPPPPPPPPPPPPL 21 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 21/34 (61%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPP---L*PPPPL**PP 73 PPPPP PPPPPL PPPP PPPP PP Sbjct: 8 PPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPP 41 Score = 36.2 bits (82), Expect(2) = 1e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPP 173 PPP PPPPPPPPP Sbjct: 4 PPPPPPPPPPPPP 16 [164][TOP] >UniRef100_UPI0001552F36 PREDICTED: similar to SH3 domain binding protein n=1 Tax=Mus musculus RepID=UPI0001552F36 Length = 455 Score = 45.8 bits (107), Expect(2) = 4e-08 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPPL PPPPPL PPPP P PP+ Sbjct: 16 PPPPPLGAPPPPPLGAPPPPPPPGPPV 42 Score = 37.7 bits (86), Expect(2) = 4e-08 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPPL 170 PPP PPPPPPPPPL Sbjct: 8 PPPPPPPPPPPPPL 21 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 21/34 (61%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPP---L*PPPPL**PP 73 PPPPP PPPPPL PPPP PPPP PP Sbjct: 8 PPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPP 41 Score = 36.2 bits (82), Expect(2) = 1e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPP 173 PPP PPPPPPPPP Sbjct: 4 PPPPPPPPPPPPP 16 [165][TOP] >UniRef100_P0C7L0-2 Isoform 2 of WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=P0C7L0-2 Length = 451 Score = 45.8 bits (107), Expect(2) = 4e-08 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPPL PPPPPL PPPP P PP+ Sbjct: 16 PPPPPLGAPPPPPLGAPPPPPPPGPPV 42 Score = 37.7 bits (86), Expect(2) = 4e-08 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPPL 170 PPP PPPPPPPPPL Sbjct: 8 PPPPPPPPPPPPPL 21 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 21/34 (61%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPP---L*PPPPL**PP 73 PPPPP PPPPPL PPPP PPPP PP Sbjct: 8 PPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPP 41 Score = 36.2 bits (82), Expect(2) = 1e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPP 173 PPP PPPPPPPPP Sbjct: 4 PPPPPPPPPPPPP 16 [166][TOP] >UniRef100_B6ID90 DEAH (Asp-Glu-Ala-His) box polypeptide 9 (Fragment) n=2 Tax=root RepID=B6ID90_9ZZZZ Length = 448 Score = 49.7 bits (117), Expect(2) = 4e-08 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGG GGGGG+ GGGGG Sbjct: 282 GGFGSGGGGFGSGGGGFGGGGGGFSGGGGGG 312 Score = 33.9 bits (76), Expect(2) = 4e-08 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG GS G Sbjct: 308 GGGGGFGGGRGGGGGGFGGSGG 329 Score = 48.1 bits (113), Expect(2) = 1e-06 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = +2 Query: 23 Y*SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 Y S GF G + GG+++GGGG+ GGG GGGG+ GGGG Sbjct: 258 YGSGGFGGGFGSGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGG 304 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGG GGGR G G G Sbjct: 302 GGGFSGGGGGGFGGGRGGGGGGFGGSG 328 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 74 GGYHNGGGGYN-GGGGYHNGGGGGYHNGGGG 163 GG+ +GGGGY GGGGY GGGGGY G GG Sbjct: 328 GGFGSGGGGYGVGGGGYGGGGGGGYGGGSGG 358 Score = 47.0 bits (110), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGGG +GGGGG GG GG Sbjct: 289 GGFGSGGGGFGGGGGGFSGGGGGGFGGGRGG 319 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 G GGGGGGG GGG G G G Sbjct: 343 GYGGGGGGGYGGGSGGYGGGGGGYG 367 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKP 254 GG GGG GG GGG G G P Sbjct: 350 GGYGGGSGGYGGGGGGYGGGEGYSISP 376 [167][TOP] >UniRef100_UPI0001867639 hypothetical protein BRAFLDRAFT_237268 n=1 Tax=Branchiostoma floridae RepID=UPI0001867639 Length = 360 Score = 55.5 bits (132), Expect(2) = 4e-08 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG + GGGGGY G GGG Sbjct: 272 GGYSGGGGGYGGGGGSYGGGGGGYGGGSGGG 302 Score = 28.1 bits (61), Expect(2) = 4e-08 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 6/31 (19%) Frame = +3 Query: 174 GGGGGGGGGR------GGGRSRTSGSPGLQG 248 GGGG GGGGR GGG S G G G Sbjct: 324 GGGGYGGGGRQGGGPYGGGYSSGGGGGGGYG 354 Score = 52.8 bits (125), Expect(2) = 6e-08 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY+GGGG + GGGG Y GGGG Sbjct: 265 GGYGGGGGGYSGGGGGYGGGGGSYGGGGGG 294 Score = 30.0 bits (66), Expect(2) = 6e-08 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQ 245 GGGGG GGG GGG S G Q Sbjct: 290 GGGGGYGGGSGGGYSDFGSGYGSQ 313 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 G RG Y Y GG GGGGY G GG GGGGGY GGGG Sbjct: 231 GDRGGGYNNGNYGGGGGYGGGGYGGSGGGGYGGGGGYGGGGGG 273 Score = 49.7 bits (117), Expect(2) = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 5/47 (10%) Frame = +2 Query: 41 RGRRYR*ARYRGGYHNGGGGYNG--GGGYHNG---GGGGYHNGGGGG 166 RG Y RGG + GGGGY G GGGY+NG GGGGY GG GG Sbjct: 209 RGGGYGGGGGRGGGYGGGGGYGGDRGGGYNNGNYGGGGGYGGGGYGG 255 Score = 31.6 bits (70), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGG GGG SG G G Sbjct: 258 GGGYGGGGGYGGGGGGYSGGGGGYG 282 Score = 28.9 bits (63), Expect(2) = 2e-07 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGGG--GGGGGRGGGRSRTSGSPGLQG 248 GGGG GGGGG GGG G G G Sbjct: 270 GGGGYSGGGGGYGGGGGSYGGGGGGYG 296 Score = 50.8 bits (120), Expect(2) = 1e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG + GGGGY GGGG ++GGGGGY GGGGG Sbjct: 258 GGGYGGGGGYGGGGGGYSGGGGGY--GGGGG 286 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGG GGG G G Sbjct: 279 GGYGGGGGSYGGGGGGYGGGSG 300 Score = 47.4 bits (111), Expect(2) = 4e-06 Identities = 27/50 (54%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = +2 Query: 32 YGFRGRRYR*ARYRGGYHNGGG---GYNGGGGYHNGGGGGYHNG--GGGG 166 +G RGR GGY GGG GY GGGGY GGGY+NG GGGG Sbjct: 204 FGGRGRG-------GGYGGGGGRGGGYGGGGGYGGDRGGGYNNGNYGGGG 246 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 G GG GGGG GGG G G G Sbjct: 252 GYGGSGGGGYGGGGGYGGGGGGYSG 276 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = +2 Query: 68 YRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 Y G + GGGGY GGGGY GGGGY GGG G Sbjct: 237 YNNGNYGGGGGY-GGGGYGGSGGGGYGGGGGYG 268 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GG GGGGGG GG G G G Sbjct: 265 GGYGGGGGGYSGGGGGYGGGGGSYG 289 [168][TOP] >UniRef100_O65514 Putative glycine-rich cell wall protein n=1 Tax=Arabidopsis thaliana RepID=O65514_ARATH Length = 221 Score = 47.0 bits (110), Expect(2) = 4e-08 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRRRRR 190 +R GG GGGG GGGG +GGGGG NGG G + +R + Sbjct: 86 SRAGGGGGGGGGGGGGGGGQGSGGGGGEGNGGNGKDNSHKRNK 128 Score = 36.6 bits (83), Expect(2) = 4e-08 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G G GK Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGSDGK 185 Score = 42.7 bits (99), Expect(2) = 1e-06 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRRRRRR 193 GG GGGG GGGG GGGG GG G++ +R + Sbjct: 89 GGGGGGGGGGGGGGGGQGSGGGGGEGNGGNGKDNSHKRNK 128 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG GS G G Sbjct: 163 GGGGGGGGGGGGGGGGGGGSDGKGG 187 [169][TOP] >UniRef100_B4NCX9 GK10119 n=1 Tax=Drosophila willistoni RepID=B4NCX9_DROWI Length = 201 Score = 55.1 bits (131), Expect(2) = 4e-08 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 5/36 (13%) Frame = +2 Query: 74 GGYHNGGGGYN-----GGGGYHNGGGGGYHNGGGGG 166 GG+H GGGG GGGGY GGGGGYH GGGGG Sbjct: 102 GGHHGGGGGGGYHGGGGGGGYPGGGGGGYHGGGGGG 137 Score = 28.5 bits (62), Expect(2) = 4e-08 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGG GGG GG + +S + Sbjct: 144 GGGGGSGGGGGGSYASSSAN 163 Score = 49.3 bits (116), Expect(2) = 8e-07 Identities = 21/32 (65%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = +2 Query: 80 YHNGGGGYN---GGGGYHNGGGGGYHNGGGGG 166 Y GGGG++ GGGGYH GGGGG + GGGGG Sbjct: 97 YQGGGGGHHGGGGGGGYHGGGGGGGYPGGGGG 128 Score = 29.6 bits (65), Expect(2) = 8e-07 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGGGG--GGGGRGGGRSRTSGSPGLQG 248 GGGGG GGGG GGG + G G G Sbjct: 125 GGGGGYHGGGGGGGGYPQWGGGGGSGG 151 [170][TOP] >UniRef100_UPI00016C3DAE RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C3DAE Length = 144 Score = 52.4 bits (124), Expect(2) = 4e-08 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY GGGGY GGGG GGGGGY GGGG Sbjct: 90 GGYGGGGGGYGGGGGGGYGGGGGYGGGGGG 119 Score = 31.2 bits (69), Expect(2) = 4e-08 Identities = 15/21 (71%), Positives = 15/21 (71%), Gaps = 3/21 (14%) Frame = +3 Query: 168 RRGGGG---GGGGGRGGGRSR 221 RRGGGG GGGGG GGG R Sbjct: 120 RRGGGGGYGGGGGGYGGGGGR 140 Score = 45.8 bits (107), Expect(2) = 6e-06 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +2 Query: 89 GGGGYNGGGGYHNGGGGGYHNGGGG 163 GGGGY GGGG + GGGGG + GGGG Sbjct: 88 GGGGYGGGGGGYGGGGGGGYGGGGG 112 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GG GGGGG GGG R G G G Sbjct: 105 GGYGGGGGYGGGGGGRRGGGGGYGG 129 [171][TOP] >UniRef100_A0R4Q4 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis str. MC2 155 RepID=A0R4Q4_MYCS2 Length = 93 Score = 52.0 bits (123), Expect(2) = 4e-08 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -2 Query: 165 PPPPPLW-*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP W PPPPP+W PPPP PPPP PP Sbjct: 54 PPPPPFWRPPPPPPIWLPPPP--PPPPFWGPP 83 Score = 31.6 bits (70), Expect(2) = 4e-08 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P+ + P P PPPPPPPP Sbjct: 20 PAGDSAPMSVLGPVPAFPPPPPPPP 44 Score = 45.8 bits (107), Expect(2) = 4e-07 Identities = 18/27 (66%), Positives = 19/27 (70%), Gaps = 3/27 (11%) Frame = -2 Query: 165 PPPPPLW*PPPPP---LW*PPPPL*PP 94 PPPPP+W PPPPP W PPPP PP Sbjct: 63 PPPPPIWLPPPPPPPPFWGPPPPPRPP 89 Score = 34.3 bits (77), Expect(2) = 4e-07 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -1 Query: 289 ETIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPP---PPP 173 ++ P L P P P PPP PPPPPP PPP Sbjct: 23 DSAPMSVLGPVPAFPPPPPPPPPFWGPPPPPPPPPPFWRPPP 64 [172][TOP] >UniRef100_A8X1N4 C. briggsae CBR-GRSP-3 protein n=1 Tax=Caenorhabditis briggsae RepID=A8X1N4_CAEBR Length = 124 Score = 48.5 bits (114), Expect(2) = 4e-08 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG + GGGG NGG G +NGGGGG GGGGG Sbjct: 61 RGGGNWGGGGNNGGWGGNNGGGGGGGRGGGGG 92 Score = 35.0 bits (79), Expect(2) = 4e-08 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPGLQG 248 RGGGGGG GG GGGR G G G Sbjct: 94 RGGGGGGRGGGGGGRGGGRGGGGRGG 119 Score = 42.0 bits (97), Expect(2) = 4e-06 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG G GG N GGG +NGG GG + GGGGG Sbjct: 55 GGGWGGRGGGNWGGGGNNGGWGGNNGGGGGG 85 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPG 239 RGGGGGG GG GGGR G G Sbjct: 87 RGGGGGGRGGGGGGRGGGGGGRG 109 Score = 42.4 bits (98), Expect(2) = 6e-06 Identities = 21/32 (65%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +2 Query: 74 GGYHNGG-GGYNGGGGYHNGGGGGYHNGGGGG 166 GG +NGG GG NGGGG GGGG GGGGG Sbjct: 68 GGGNNGGWGGNNGGGGGGGRGGGGGGRGGGGG 99 Score = 33.9 bits (76), Expect(2) = 6e-06 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GG GGGGGGRGGG G G G+ Sbjct: 92 GGRGGGGGGRGGGGGGRGGGRGGGGR 117 Score = 42.7 bits (99), Expect(2) = 1e-05 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G GGGG GGGG GGGGG GGGGG Sbjct: 77 GNNGGGGGGGRGGGGGGRGGGGGGRGGGGGG 107 Score = 32.7 bits (73), Expect(2) = 1e-05 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPGLQGK 251 R GGGGG GGGRGGG G G +GK Sbjct: 101 RGGGGGGRGGGRGGG-----GRGGGRGK 123 [173][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 46.2 bits (108), Expect(2) = 4e-08 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRY 52 PPPPP PPPPP PPPP PPPP PP +++R+ Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRF 60 Score = 37.4 bits (85), Expect(2) = 4e-08 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 [174][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 43.1 bits (100), Expect(2) = 4e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 40.0 bits (92), Expect(2) = 4e-08 Identities = 24/78 (30%), Positives = 30/78 (38%), Gaps = 3/78 (3%) Frame = -1 Query: 397 NLEDLAFATCNNNEDRFNYMDSSSKRYSVRQRCLA---LETIPSFTLSKHTGLPCSPGDP 227 N ++ F C N + + + V C+ E P T P P P Sbjct: 803 NWDNFGFECCEYNGQYYKDGEGFIRSDGVSCYCVGSDNYEPAPMVCEEPTTPPPPPPPPP 862 Query: 226 LVLERPPPRPPPPPPPPP 173 PPP PPPPPPPPP Sbjct: 863 PPPPPPPPPPPPPPPPPP 880 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPPPGAPP 966 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPP 881 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPP 882 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPP 883 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 42.7 bits (99), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 937 PPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 37.4 bits (85), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 41.6 bits (96), Expect(2) = 8e-07 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 943 PPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 37.4 bits (85), Expect(2) = 8e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPP PPPP PP Sbjct: 944 PPPPPPPPPPPPPPPPPPPGAPPPPPPALPP 974 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPP 944 [175][TOP] >UniRef100_B4MDY4 GJ18398 n=1 Tax=Drosophila virilis RepID=B4MDY4_DROVI Length = 1362 Score = 56.6 bits (135), Expect(2) = 4e-08 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG++NGGGG+N GGG +N GGGGY++GGGG Sbjct: 1290 GGFNNGGGGFNSGGGGYNSGGGGYNSGGGG 1319 Score = 26.6 bits (57), Expect(2) = 4e-08 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +3 Query: 174 GGGG---GGGGGRGGGRSRTSGSPGLQG 248 GGGG GGGG GG SG G G Sbjct: 1316 GGGGYNSGGGGFNSGGGGFNSGGAGFGG 1343 Score = 55.5 bits (132), Expect(2) = 4e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG++NGGGG+N GGG N GGGGY++GGGG Sbjct: 1283 GGFNNGGGGFNNGGGGFNSGGGGYNSGGGG 1312 Score = 24.6 bits (52), Expect(2) = 4e-07 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 174 GGGG---GGGGGRGGGRSRTSGSPG 239 GGGG GGGG GG SG G Sbjct: 1309 GGGGYNSGGGGYNSGGGGFNSGGGG 1333 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG+++GGGGYN GGG +N GGGGY++GGGG Sbjct: 1297 GGFNSGGGGYNSGGGGYNSGGGGYNSGGGG 1326 Score = 21.6 bits (44), Expect(2) = 2e-06 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGG GG G G S G Sbjct: 1330 GGGGFNSGGAGFGGGNNFQSEG 1351 Score = 56.2 bits (134), Expect = 6e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY++GGGGYN GGG +N GGGG+++GGGG Sbjct: 1304 GGYNSGGGGYNSGGGGYNSGGGGFNSGGGG 1333 [176][TOP] >UniRef100_Q2GSQ8 Putative uncharacterized protein n=1 Tax=Chaetomium globosum RepID=Q2GSQ8_CHAGB Length = 1005 Score = 48.1 bits (113), Expect(2) = 4e-08 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 11/44 (25%) Frame = +2 Query: 68 YRGGYHNGGGGYN--------GGGGYHNG---GGGGYHNGGGGG 166 YRGG GGGG N GGGGY G GGGGY GGGGG Sbjct: 42 YRGGGRGGGGGDNYQGGGRGGGGGGYQGGGGRGGGGYQGGGGGG 85 Score = 35.0 bits (79), Expect(2) = 4e-08 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +3 Query: 171 RGGGGGG---GGGRGGGRSRTSGSPG 239 RGGGGGG GGGRGGGR G G Sbjct: 93 RGGGGGGGYQGGGRGGGRGGRGGYSG 118 Score = 45.1 bits (105), Expect(2) = 8e-07 Identities = 24/43 (55%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 41 RGRRYR*ARYRGGYHNGGGG-YNGGGGYHNGGGGGYHNGGGGG 166 RG R R RGG GGGG + GGGG N GGGY GG GG Sbjct: 7 RGGRGRGGGGRGGGGRGGGGEFRGGGGQGNYAGGGYRGGGRGG 49 Score = 33.9 bits (76), Expect(2) = 8e-07 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPGLQG 248 +GGGGGGGG +GGGR G G QG Sbjct: 79 QGGGGGGGGYQGGGRG-GGGGGGYQG 103 [177][TOP] >UniRef100_UPI0000F2DD8B PREDICTED: similar to zinc finger protein 312, n=1 Tax=Monodelphis domestica RepID=UPI0000F2DD8B Length = 800 Score = 48.5 bits (114), Expect(2) = 5e-08 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGGG GGGG GGGGG +GGGGG Sbjct: 526 GGSHGGGGGGGGGGGGGGGGGGGGGSGGGGG 556 Score = 34.7 bits (78), Expect(2) = 5e-08 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 G GGGGGGG GGG SG P + G Sbjct: 550 GSGGGGGGGGGGGGGGGSGGPQICG 574 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG +GGGGG GGGGG Sbjct: 534 GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGG 564 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGL 242 GGGGGGGGG G G + G+ GL Sbjct: 556 GGGGGGGGGGGSGGPQICGASGL 578 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +2 Query: 68 YRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 ++ GGG + GGGG GGGGG GGGGG Sbjct: 518 WKSSLRGGGGSHGGGGGGGGGGGGGGGGGGGGG 550 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVC 260 GGGGGG GG GGG G G G +C Sbjct: 545 GGGGGGSGGGGGGGGGGGGGGGSGGPQIC 573 [178][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 43.9 bits (102), Expect(2) = 5e-08 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL 85 SPPPPP PPPPP PPPP PPPP+ Sbjct: 276 SPPPPPPPPPPPPPPPPPPPPPPPPPPV 303 Score = 39.3 bits (90), Expect(2) = 5e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPPPPPP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 252 SPPPPPPPPPPPPP---PPPPPPPPPPSPPPP 280 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 38.5 bits (88), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP SP P PP PPPPPPPPP Sbjct: 222 LPPSPPPPPPPSPPPSPPPPPPPPPP 247 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 S PPPPP PPPPP PPPP PPPP PP Y Sbjct: 276 SPPPPPP---PPPPP---PPPPPPPPPPPPPPPVY 304 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 43.5 bits (101), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 37.0 bits (84), Expect(2) = 3e-07 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP +P PL PPP PP PPP PP Sbjct: 214 LPNAPPSPLPPSPPPPPPPSPPPSPP 239 Score = 43.1 bits (100), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 37.0 bits (84), Expect(2) = 4e-07 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 238 PGDPLVLERPPPRPPPPPPPPP 173 P P PPP PPPPPPPPP Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPP 261 Score = 43.1 bits (100), Expect(2) = 6e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 36.2 bits (82), Expect(2) = 6e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPP PPPPP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPP 242 Score = 43.1 bits (100), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPP PP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPP 250 Score = 42.0 bits (97), Expect(2) = 5e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPP PPPP PP Sbjct: 252 SPPPPPP---PPPPP---PPPPPPPPPPPPSPP 278 Score = 34.3 bits (77), Expect(2) = 5e-06 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 238 PGDPLVLERPPPRPPPPPPPPP 173 P P PPP PPP PPPPP Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPP 257 [179][TOP] >UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia MC0-3 RepID=B1JXE0_BURCC Length = 505 Score = 48.5 bits (114), Expect(2) = 5e-08 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG NGGG NGGGG GGGGG NGGGGG Sbjct: 318 GGNGNGGGPGNGGGGGGGGGGGGNGNGGGGG 348 Score = 34.7 bits (78), Expect(2) = 5e-08 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G+ G G Sbjct: 346 GGGGGGGGGGGGGGGGAGGNGGNGG 370 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NGGG NGGGG NGGG G GGGGG Sbjct: 305 GGHGNGGGHGNGGGGNGNGGGPGNGGGGGGG 335 Score = 34.3 bits (77), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG +G G G Sbjct: 345 GGGGGGGGGGGGGGGGGAGGNGGNG 369 Score = 46.2 bits (108), Expect(2) = 2e-07 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG NGGGG GGGG NG GGG GGGGG Sbjct: 324 GGPGNGGGGGGGGGGGGNGNGGGGGGGGGGG 354 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 382 GGGGGGGGGGGGGNGGNGGGGG 403 Score = 46.2 bits (108), Expect(2) = 3e-07 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG+ NGGGG GGG NGGGGG GGGG Sbjct: 311 GGHGNGGGGNGNGGGPGNGGGGGGGGGGGG 340 Score = 34.3 bits (77), Expect(2) = 3e-07 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G+ G Sbjct: 379 GGGGGGGGGGGGGGGGNGGNGG 400 Score = 44.7 bits (104), Expect(2) = 1e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +2 Query: 77 GYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G GGGG GGGG NGGGGG GGGGG Sbjct: 327 GNGGGGGGGGGGGGNGNGGGGGGGGGGGGG 356 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGNG 396 Score = 45.4 bits (106), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGG +G GG H GGGG+ NGGG G Sbjct: 284 GGGHGDGGGGHGSGGGHGDGGGGHGNGGGHG 314 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG NG GG GGGGG GGGGG Sbjct: 331 GGGGGGGGGGNGNGGGGGGGGGGGGGGGGGG 361 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 375 GGGGGGGGGGGGGGGGGGGGNGGNG 399 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GG G G Sbjct: 352 GGGGGGGGGGAGGNGGNGGGGG 373 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGY----HNGGGGG 166 GG NGGGG GGGG GGGGG NGGGGG Sbjct: 339 GGNGNGGGGGGGGGGGGGGGGGGAGGNGGNGGGGG 373 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G+ G G Sbjct: 376 GGGGGGGGGGGGGGGGGGGNGGNGG 400 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GG G NGGGG GGGGG GGGGG Sbjct: 358 GGGGAGGNGGNGGGGGGGGGGGGGGGGGGGG 388 Score = 33.9 bits (76), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG + +G G Sbjct: 381 GGGGGGGGGGGGGGNGGNGGGG 402 Score = 44.3 bits (103), Expect(2) = 4e-06 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GGG +G GG H GGGG NGGG G Sbjct: 297 GGGHGDGGGGHGNGGGHGNGGGGNGNGGGPG 327 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGG GGG G G Sbjct: 329 GGGGGGGGGGGGNGNGGGGGG 349 Score = 43.9 bits (102), Expect(2) = 6e-06 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGG-----GYHNGGGG 163 GG+ +GGGG+ GGG+ +GGGG G+ NGGGG Sbjct: 285 GGHGDGGGGHGSGGGHGDGGGGHGNGGGHGNGGGG 319 Score = 43.9 bits (102), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G NGGGG GGGG GGGGG GGGGG Sbjct: 364 GNGGNGGGGGGGGGGGGGGGGGGGGGGGGGG 394 Score = 32.0 bits (71), Expect(2) = 6e-06 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 G GGGGGGG GGG + G G Sbjct: 327 GNGGGGGGGGGGGGNGNGGGGG 348 Score = 32.0 bits (71), Expect(2) = 6e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GG G G G Sbjct: 386 GGGGGGGGGNGGNGGGGGGGHGNGG 410 [180][TOP] >UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4IYP5_MAIZE Length = 441 Score = 43.5 bits (101), Expect(2) = 5e-08 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -2 Query: 177 LLSSPPP-PPLW*PPPPPLW*PPP-PL*PPPPL**PP 73 L+S PPP PP PPPPPL PPP P PPPPL PP Sbjct: 273 LMSPPPPSPPPPSPPPPPLLPPPPQPHSPPPPLSSPP 309 Score = 39.7 bits (91), Expect(2) = 5e-08 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -1 Query: 301 CLALETIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPPLLS 164 C A P LP P P PPP PPPP PPPPL+S Sbjct: 235 CAAFHCKPFVPPMPPPRLPSPPPSP-----PPPSPPPPSPPPPLMS 275 Score = 42.0 bits (97), Expect(2) = 8e-08 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 8/43 (18%) Frame = -2 Query: 177 LLSSPPPPPLW*P--PPPPLW*PPP------PL*PPPPL**PP 73 L S PPPPPL P PPPPL PPP P PPPPL PP Sbjct: 305 LSSPPPPPPLPQPHSPPPPLSSPPPPPPLPQPHSPPPPLSSPP 347 Score = 40.4 bits (93), Expect(2) = 8e-08 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLL 167 P SP PL+ PP PPP PPPPPLL Sbjct: 266 PPSPPPPLMSPPPPSPPPPSPPPPPLL 292 [181][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 45.1 bits (105), Expect(2) = 5e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 110 SPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141 Score = 38.1 bits (87), Expect(2) = 5e-08 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -1 Query: 250 LPCSPGDPLVLERPPPRPPPPPPPPP 173 LP SP P P P PPPPPPPPP Sbjct: 81 LPPSPSPPPPPPPPVPPPPPPPPPPP 106 Score = 45.1 bits (105), Expect(2) = 8e-08 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP+ PPPPP PPPP PPPP PP Sbjct: 90 PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPP 120 Score = 37.4 bits (85), Expect(2) = 8e-08 Identities = 19/33 (57%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPP--PPLLSSSS 155 P +P P E PPP PPPPPPP PPL S S Sbjct: 57 PPTPSGP---EHPPPPPPPPPPPPQPPLPPSPS 86 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPP 134 Score = 37.7 bits (86), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 85 PSPPPPPPPPVPPPPPPPPPPPPPP 109 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPPPPPP 148 Score = 37.7 bits (86), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 99 PPPPPPPPPPPSPPPPPPPPPPPPP 123 Score = 43.5 bits (101), Expect(2) = 4e-07 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPP PPPP PP Sbjct: 124 SPPPPPP---PPPPPPPNPPPPPPPPPPSPSPP 153 Score = 36.6 bits (83), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P V PPP PPPPPPP P Sbjct: 87 PPPPPPPPVPPPPPPPPPPPPPPSP 111 Score = 42.4 bits (98), Expect(2) = 5e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = -2 Query: 162 PPPPLW*PP--PPPLW*PP--PPL*PPPPL**PPRYRAYRYRRPRNPY 31 PPPPL PP PPPL PP PP PPPP PP R + P NP+ Sbjct: 261 PPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPF 308 Score = 37.4 bits (85), Expect(2) = 5e-07 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPPL 170 PPPRPPPP PPPPL Sbjct: 252 PPPRPPPPSPPPPL 265 Score = 43.1 bits (100), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 117 PPPPPPPSPPPPPPPPPPPPPNPPPPPPPPP 147 Score = 35.8 bits (81), Expect(2) = 8e-07 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P+ PPP PPPPPP PP Sbjct: 88 PPPPPPPVPPPPPPPPPPPPPPSPP 112 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 89 PPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126 Score = 38.9 bits (89), Expect(2) = 2e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP P PP PP Sbjct: 131 PPPPPPPNPPPPP---PPPPPSPSPPPSPPP 158 Score = 38.5 bits (88), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 238 PGDPLVLERPPPRPPPPPPPPP 173 PG P P PPPPPPPPP Sbjct: 53 PGVPPPTPSGPEHPPPPPPPPP 74 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P PL PP PPPPP PPP Sbjct: 74 PPPPQPPLPPSPSPPPPPPPPVPPP 98 Score = 43.5 bits (101), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 97 PPPPPPPPPPPPPSPPPPPPPPPPPPPSPPP 127 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPP PPPPP Sbjct: 76 PPQPPLPPSPSPPPPPPPPVPPPPP 100 Score = 41.2 bits (95), Expect(2) = 5e-06 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPP PPPP PPPP PP Sbjct: 110 SPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 35.0 bits (79), Expect(2) = 5e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPP Sbjct: 94 PVPPPPPPPPPPPPPPSPPPPPPPP 118 Score = 43.1 bits (100), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 32.7 bits (73), Expect(2) = 6e-06 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P + P P PPPPPP PP Sbjct: 73 PPPPPQPPLPPSPSPPPPPPPPVPP 97 [182][TOP] >UniRef100_A3BDN5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BDN5_ORYSJ Length = 321 Score = 47.0 bits (110), Expect(2) = 5e-08 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEER 175 GG GGGG GGGG GGGGG GGGGG ER Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGER 121 Score = 36.2 bits (82), Expect(2) = 5e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +3 Query: 165 ERRGGGGGGGGGRGGGRSRTSGSPG 239 ER GGGGGGGGG GGG G G Sbjct: 120 ERGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 45.1 bits (105), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGERGGGGGG 127 Score = 35.4 bits (80), Expect(2) = 3e-07 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G G G+ Sbjct: 135 GGGGGGGGGGGGGNGGDDGDNGDDGE 160 Score = 45.1 bits (105), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 105 GGGGGGGGGGGGGGGERGGGGGGGGGGGGGG 135 Score = 44.3 bits (103), Expect(2) = 4e-07 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = +2 Query: 68 YRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 + GG GGGG GGGG GGGGG GGGGG Sbjct: 80 WSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112 Score = 35.8 bits (81), Expect(2) = 4e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG R G G Sbjct: 106 GGGGGGGGGGGGGGERGGGGGG 127 Score = 35.0 bits (79), Expect(2) = 4e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGNGGDDGDNG 156 Score = 44.7 bits (104), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGERGGGGG 126 Score = 34.3 bits (77), Expect(2) = 8e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G+ G G Sbjct: 129 GGGGGGGGGGGGGGGGGGGNGGDDG 153 Score = 44.7 bits (104), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 104 GGGGGGGGGGGGGGGGERGGGGGGGGGGGGG 134 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERR 178 GG GGGG GGGG GGGGG GGGGG R Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGER 121 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 105 GGGGGGGGGGGGGGGERGGGGG 126 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 111 GGGGGGGGGERGGGGGGGGGGGGGGGGGGGG 141 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 107 GGGGGGGGGGGGGERGGGGGGG 128 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 162 EERRGGGGGGGGGRGGGRSRTSGSPG 239 E GGGGGGGGG GGG G G Sbjct: 120 ERGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GG +G G G Sbjct: 138 GGGGGGGGGGNGGDDGDNGDDGEDG 162 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 21/40 (52%), Positives = 24/40 (60%) Frame = +2 Query: 47 RRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 +R+ R G + GGGG GGGG GGGGG GGGGG Sbjct: 69 KRHTSLRGWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGG 108 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 104 GGGGGGGGGGGGGGGGERGGGG 125 Score = 32.7 bits (73), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GG R G G Sbjct: 108 GGGGGGGGGGGGERGGGGGGGG 129 [183][TOP] >UniRef100_Q5CWS3 Putative uncharacterized protein (Fragment) n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CWS3_CRYPV Length = 296 Score = 44.3 bits (103), Expect(2) = 5e-08 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPPL PPPP PPPP Sbjct: 194 PPPPP---PPPPPLPSPPPPTLPPPP 216 Score = 38.9 bits (89), Expect(2) = 5e-08 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 211 PPPRPPPPPPPPPLLSSSS 155 PPP PPPPPPPPPL + S+ Sbjct: 170 PPPPPPPPPPPPPLQAPSN 188 Score = 39.3 bits (90), Expect(2) = 4e-06 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPPL PPPP L PPPP PP P+ Sbjct: 199 PPPPPLPSPPPPTL--PPPPSLPPYPV 223 Score = 37.4 bits (85), Expect(2) = 4e-06 Identities = 18/33 (54%), Positives = 19/33 (57%), Gaps = 5/33 (15%) Frame = -1 Query: 247 PCSPGDPLVLERP-----PPRPPPPPPPPPLLS 164 P P P L+ P PP PPPPPPPPPL S Sbjct: 174 PPPPPPPPPLQAPSNEDFPPPPPPPPPPPPLPS 206 [184][TOP] >UniRef100_Q7YYP5 Hydroxyproline-rich glycoprotein dz-hrgp, probable n=1 Tax=Cryptosporidium parvum RepID=Q7YYP5_CRYPV Length = 203 Score = 44.3 bits (103), Expect(2) = 5e-08 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPPL PPPP PPPP Sbjct: 101 PPPPP---PPPPPLPSPPPPTLPPPP 123 Score = 38.9 bits (89), Expect(2) = 5e-08 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 211 PPPRPPPPPPPPPLLSSSS 155 PPP PPPPPPPPPL + S+ Sbjct: 77 PPPPPPPPPPPPPLQAPSN 95 Score = 39.3 bits (90), Expect(2) = 4e-06 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPPL PPPP L PPPP PP P+ Sbjct: 106 PPPPPLPSPPPPTL--PPPPSLPPYPV 130 Score = 37.4 bits (85), Expect(2) = 4e-06 Identities = 18/33 (54%), Positives = 19/33 (57%), Gaps = 5/33 (15%) Frame = -1 Query: 247 PCSPGDPLVLERP-----PPRPPPPPPPPPLLS 164 P P P L+ P PP PPPPPPPPPL S Sbjct: 81 PPPPPPPPPLQAPSNEDFPPPPPPPPPPPPLPS 113 [185][TOP] >UniRef100_Q9SL23 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9SL23_ARATH Length = 154 Score = 55.1 bits (131), Expect(2) = 5e-08 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG++ GGGG+ GGGG H GGGGG++ GGGGG Sbjct: 86 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 116 Score = 28.1 bits (61), Expect(2) = 5e-08 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGG GGG G G G Sbjct: 114 GGGHGGGGHYGGGGGGYGGGGGHHG 138 Score = 52.8 bits (125), Expect(2) = 8e-08 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG++ GGGG+ GGGG H GGGGG++ GGGG Sbjct: 79 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 108 Score = 29.6 bits (65), Expect(2) = 8e-08 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGG GGG G G G Sbjct: 106 GGGHYGGGGGGHGGGGHYGGGGGGYGG 132 Score = 50.8 bits (120), Expect(2) = 9e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGG 160 GG++ GGGG+ GGGG H GGGGG H GGG Sbjct: 93 GGHYGGGGGHYGGGGGHYGGGGGGHGGGG 121 Score = 28.1 bits (61), Expect(2) = 9e-07 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQGKPV 257 GGG GGGGGG GGG G +PV Sbjct: 119 GGGHYGGGGGGYGGGGGHHGGGGHGLNEPV 148 [186][TOP] >UniRef100_Q2V4A1 Putative uncharacterized protein At2g05440.4 n=1 Tax=Arabidopsis thaliana RepID=Q2V4A1_ARATH Length = 147 Score = 55.1 bits (131), Expect(2) = 5e-08 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG++ GGGG+ GGGG H GGGGG++ GGGGG Sbjct: 79 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 109 Score = 28.1 bits (61), Expect(2) = 5e-08 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGG GGG G G G Sbjct: 107 GGGHGGGGHYGGGGGGYGGGGGHHG 131 Score = 50.8 bits (120), Expect(2) = 9e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGG 160 GG++ GGGG+ GGGG H GGGGG H GGG Sbjct: 86 GGHYGGGGGHYGGGGGHYGGGGGGHGGGG 114 Score = 28.1 bits (61), Expect(2) = 9e-07 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQGKPV 257 GGG GGGGGG GGG G +PV Sbjct: 112 GGGHYGGGGGGYGGGGGHHGGGGHGLNEPV 141 Score = 47.4 bits (111), Expect(2) = 3e-06 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = +2 Query: 83 HNGGGGYNGGGGYHNGGGGGYHNGGGG 163 + GGGG+ GGGG H GGGGG++ GGGG Sbjct: 75 YGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Score = 29.6 bits (65), Expect(2) = 3e-06 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGG GGG G G G Sbjct: 99 GGGHYGGGGGGHGGGGHYGGGGGGYGG 125 [187][TOP] >UniRef100_Q4PFH2 Putative uncharacterized protein n=1 Tax=Ustilago maydis RepID=Q4PFH2_USTMA Length = 2195 Score = 38.1 bits (87), Expect(3) = 5e-08 Identities = 20/34 (58%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Frame = -2 Query: 174 LSSPPPPPLW*PPPPP-----LW*PPPPL*PPPP 88 L PPPPP PPPP L PPPPL PPPP Sbjct: 1525 LLPPPPPP---PPPPSLQAGMLGGPPPPLPPPPP 1555 Score = 33.5 bits (75), Expect(3) = 5e-08 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 241 SPGDPLVLERPPPRPPPPPPPPP 173 SP P PPP PPPPPPP P Sbjct: 1465 SPSSP-----PPPPPPPPPPPGP 1482 Score = 30.4 bits (67), Expect(3) = 5e-08 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -1 Query: 199 PPPPPPPPPL 170 PPPPPPPPPL Sbjct: 1500 PPPPPPPPPL 1509 [188][TOP] >UniRef100_C0Z2P2 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2P2_ARATH Length = 137 Score = 55.1 bits (131), Expect(2) = 5e-08 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG++ GGGG+ GGGG H GGGGG++ GGGGG Sbjct: 69 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 99 Score = 28.1 bits (61), Expect(2) = 5e-08 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGG GGG G G G Sbjct: 97 GGGHGGGGHYGGGGGGYGGGGGHHG 121 Score = 52.8 bits (125), Expect(2) = 9e-08 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 GG++ GGGG+ GGGG H GGGGG++ GGGG Sbjct: 62 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 91 Score = 29.6 bits (65), Expect(2) = 9e-08 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQG 248 GGG GGGGGG GGG G G G Sbjct: 89 GGGHYGGGGGGHGGGGHYGGGGGGYGG 115 Score = 50.8 bits (120), Expect(2) = 9e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGG 160 GG++ GGGG+ GGGG H GGGGG H GGG Sbjct: 76 GGHYGGGGGHYGGGGGHYGGGGGGHGGGG 104 Score = 28.1 bits (61), Expect(2) = 9e-07 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPGLQGKPV 257 GGG GGGGGG GGG G +PV Sbjct: 102 GGGHYGGGGGGYGGGGGHHGGGGHGLNEPV 131 [189][TOP] >UniRef100_Q02021 Glycine-rich protein n=2 Tax=Solanum lycopersicum RepID=Q02021_SOLLC Length = 132 Score = 48.9 bits (115), Expect(2) = 5e-08 Identities = 24/39 (61%), Positives = 25/39 (64%), Gaps = 8/39 (20%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGY----HNGGGGGY----HNGGGGG 166 GGY GGGGY GGGGY GGGGGY +GGGGG Sbjct: 38 GGYPGGGGGYPGGGGYPGGGRGGGGGGYPGGGRSGGGGG 76 Score = 34.3 bits (77), Expect(2) = 5e-08 Identities = 17/27 (62%), Positives = 17/27 (62%), Gaps = 4/27 (14%) Frame = +3 Query: 171 RGGGG----GGGGGRGGGRSRTSGSPG 239 RGGGG GGGGGRGGGR G G Sbjct: 89 RGGGGRYPGGGGGGRGGGRYSGGGGRG 115 Score = 47.0 bits (110), Expect(2) = 6e-06 Identities = 22/36 (61%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +2 Query: 68 YRGGYHNGGGGYNGGGGYHNGGGGGYHNGG---GGG 166 Y GG + GGGGY GGGG + GGGGG GG GGG Sbjct: 77 YPGGGYPGGGGYRGGGGRYPGGGGGGRGGGRYSGGG 112 Score = 29.3 bits (64), Expect(2) = 6e-06 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 171 RGGGGGGGGGRGGGR 215 RGGGGG GG GGGR Sbjct: 114 RGGGGGRGGRGGGGR 128 [190][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 44.3 bits (103), Expect(2) = 5e-08 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP PPPPP PPPP PPPP PP++ Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQW 100 Score = 38.9 bits (89), Expect(2) = 5e-08 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 280 PSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 PS L + P P PPP PPPPPPPPP Sbjct: 32 PSLFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 43.1 bits (100), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -1 Query: 259 HTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 H+ P P P PPP PPPPPPPPP Sbjct: 43 HSPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 43.1 bits (100), Expect(2) = 2e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 38.5 bits (88), Expect(2) = 2e-07 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -1 Query: 265 SKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 S++ P P P PPP PPPPPPPPP Sbjct: 39 SRNAHSPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPP 75 [191][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 42.0 bits (97), Expect(2) = 6e-08 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPPPPPP Sbjct: 1923 PISPSSPETPPPPPPPPPPPPPPPP 1947 Score = 40.8 bits (94), Expect(2) = 6e-08 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP P PPP PPPP PPPP PP Sbjct: 1942 PPPPPPPTPAPPPTPPPPPPPPPPPPPPPPP 1972 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 +P PPP PPPPP PPPP PPPP PP+ Sbjct: 1949 TPAPPPTPPPPPPP---PPPPPPPPPPPSAPPQ 1978 Score = 37.0 bits (84), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPPPP P Sbjct: 1926 PSSPETPPPPPPPPPPPPPPPPPTP 1950 [192][TOP] >UniRef100_Q0BCI9 Putative uncharacterized protein n=1 Tax=Burkholderia ambifaria AMMD RepID=Q0BCI9_BURCM Length = 529 Score = 45.8 bits (107), Expect(2) = 6e-08 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NG GG+ G G NGGGGG GGGGG Sbjct: 384 GGHGNGNGGHGNGNGNGNGGGGGGGGGGGGG 414 Score = 37.0 bits (84), Expect(2) = 6e-08 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG S SG G G Sbjct: 432 GGGGGGGGGGGGGGSGGSGGGGGSG 456 Score = 45.8 bits (107), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ NG G NGGGG GGGGG GGGGG Sbjct: 391 GGHGNGNGNGNGGGGGGGGGGGGGGGGGGGG 421 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG + GS G Sbjct: 430 GGGGGGGGGGGGGGGGSGGSGG 451 Score = 44.3 bits (103), Expect(2) = 5e-07 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +2 Query: 77 GYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G NGGGG GGGG GGGGG GGGGG Sbjct: 398 GNGNGGGGGGGGGGGGGGGGGGGGGGGGGG 427 Score = 35.4 bits (80), Expect(2) = 5e-07 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG GS G G Sbjct: 427 GGGGGGGGGGGGGGGGGGGSGGSGG 451 Score = 43.9 bits (102), Expect(2) = 6e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 402 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 432 Score = 35.4 bits (80), Expect(2) = 6e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG + G G G Sbjct: 433 GGGGGGGGGGGGGSGGSGGGGGSGG 457 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 403 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 433 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 426 GGGGGGGGGGGGGGGGGGGGSGGSG 450 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 404 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 434 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 405 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 435 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG G G S G G G Sbjct: 435 GGGGGGGGGGGSGGSGGGGGSGGSG 459 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GG GS G G Sbjct: 436 GGGGGGGGGGSGGSGGGGGSGGSGG 460 Score = 47.8 bits (112), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG H GG G GGGG H GG GG H GG GG Sbjct: 287 GGGHGGGHGGGGGGGGHGGGNGGGHGGGNGG 317 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 406 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 436 Score = 42.7 bits (99), Expect(2) = 4e-06 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G + GGGG GGGG GGGGG GGGGG Sbjct: 398 GNGNGGGGGGGGGGGGGGGGGGGGGGGGGGG 428 Score = 33.9 bits (76), Expect(2) = 4e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 423 GGGGGGGGGGGGGGGGGGGGGGGSG 447 Score = 32.7 bits (73), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGG GG G GGG + GS G G Sbjct: 442 GGGGSGGSGGGGGSGGSGGSGGAGG 466 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG 230 G GGG GGG GGG SG Sbjct: 310 GHGGGNGGGNGGGSGGGSG 328 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 407 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 437 Score = 32.3 bits (72), Expect(2) = 5e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GG GGG S SG G G Sbjct: 441 GGGGGSGGSGGGGGSGGSGGSGGAG 465 Score = 45.4 bits (106), Expect(2) = 6e-06 Identities = 21/32 (65%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGG-GGYHNGGGGG 166 GG H GGG GG G NGGG GG H GGGGG Sbjct: 269 GGGHGDGGGNGGGNGVGNGGGHGGGHGGGGGG 300 Score = 43.9 bits (102), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 408 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 438 Score = 42.0 bits (97), Expect(2) = 6e-06 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +2 Query: 77 GYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 G NG GG GGGG GGGGG GGGGG Sbjct: 396 GNGNGNGGGGGGGGGGGGGGGGGGGGGGGG 425 Score = 33.9 bits (76), Expect(2) = 6e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 424 GGGGGGGGGGGGGGGGGGGGGGSGG 448 Score = 32.0 bits (71), Expect(2) = 6e-06 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGG G GG + GS G G Sbjct: 439 GGGGGGGSGGSGGGGGSGGSGGSGG 463 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG 230 GGGGG GGG GGG +G Sbjct: 298 GGGGGHGGGNGGGHGGGNG 316 [193][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 43.1 bits (100), Expect(2) = 6e-08 Identities = 24/62 (38%), Positives = 31/62 (50%) Frame = -1 Query: 358 EDRFNYMDSSSKRYSVRQRCLALETIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPP 179 +DR N + S + S+ + C + + P S CSP P PPP PPPPPPP Sbjct: 341 DDRRNCLPSRPMQRSLAE-CKSFSSYPIDCAS----FGCSPPSPPPPPPPPPPPPPPPPP 395 Query: 178 PP 173 PP Sbjct: 396 PP 397 Score = 39.7 bits (91), Expect(2) = 6e-08 Identities = 23/46 (50%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW--*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 PPPPP PPPPP PPPP PPP PP Y Y P +P Sbjct: 397 PPPPPP--PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 37.7 bits (86), Expect(2) = 8e-06 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPLLSSS 158 P P P PPP PPPPPPPPP + S Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPS 412 Score = 37.7 bits (86), Expect(2) = 8e-06 Identities = 21/45 (46%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*P----PPPL**PPRYRAYRYRRP 43 P PPP PPPPP + PPP P PPP PP + Y Y P Sbjct: 418 PSPPPYVYPPPPPPYVYPPPPSPPYVYPPP---PPSPQPYMYPSP 459 [194][TOP] >UniRef100_C1N2F3 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N2F3_9CHLO Length = 379 Score = 48.5 bits (114), Expect(2) = 6e-08 Identities = 21/37 (56%), Positives = 25/37 (67%), Gaps = 6/37 (16%) Frame = +2 Query: 74 GGYHN------GGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+H+ GGGG+ GGGG+ GGGGG GGGGG Sbjct: 46 GGFHDHGARGGGGGGFGGGGGFGGGGGGGGGRGGGGG 82 Score = 34.3 bits (77), Expect(2) = 6e-08 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPGLQGK 251 RGGGG GGGGRGGG R G G G+ Sbjct: 84 RGGGGRGGGGRGGG-GRGGGGRGGGGR 109 [195][TOP] >UniRef100_B6TI13 Glycine-rich RNA-binding protein 7 n=1 Tax=Zea mays RepID=B6TI13_MAIZE Length = 276 Score = 53.5 bits (127), Expect(2) = 6e-08 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GFRG Y GG + GGGGY GGGG + GGGGGY GGGGG Sbjct: 112 GFRGG----GGYGGGGYGGGGGYGGGGGGY-GGGGGYGGGGGGG 150 Score = 29.3 bits (64), Expect(2) = 6e-08 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 177 GGGGGGGGRGGG 212 GGGGGGGG GGG Sbjct: 144 GGGGGGGGYGGG 155 Score = 53.9 bits (128), Expect(2) = 5e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRR 181 GGY GGGGY GGGGY GGGGG + GG G R R Sbjct: 128 GGYGGGGGGYGGGGGYGGGGGGGGYGGGDYGGNRNR 163 Score = 22.3 bits (46), Expect(2) = 5e-06 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKP 254 GG G GG GG ++G G G P Sbjct: 199 GGNGAGGFDATGG---STGDDGFSGTP 222 [196][TOP] >UniRef100_B7PDJ6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ6_IXOSC Length = 275 Score = 43.9 bits (102), Expect(2) = 6e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 12 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 42 Score = 38.9 bits (89), Expect(2) = 6e-08 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 12/90 (13%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCLERVKDGMVSSAKHLC------------LTE 317 GGGGGGGGG GGG G P CL + +V C + + Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGSHFNFPECLISLVREIVIKPNFWCQNNAGMSNKSGNIIK 142 Query: 318 YLLEEESI*LNLSSLLLQVAKAKSSKFPSD 407 +E E + +N + + +K+S+FPS+ Sbjct: 143 LSVERERV-INTNGAVFYAKASKNSEFPSE 171 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 31 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 32 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 33 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 34 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 35 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 6 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 36 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 37 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 8 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 38 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 10 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 11 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 41 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 13 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 43 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 14 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 44 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 15 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 45 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 16 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 46 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 17 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 47 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 18 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 48 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 19 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 49 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 20 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 50 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 21 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 22 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 52 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 53 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 25 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 30 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 31 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGG 44 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGG 45 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 25 GGGGGGGGGGGGGGGGGGGGGG 46 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGG 47 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGG 48 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGG 49 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGG 50 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 30 GGGGGGGGGGGGGGGGGGGGGG 51 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 31 GGGGGGGGGGGGGGGGGGGGGG 52 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGG 53 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGG 54 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGG 56 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGG 57 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGG 58 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGG 59 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGG 60 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGG 61 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGG 62 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGG 63 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGG 64 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGG 65 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGG 66 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGG 67 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGG 68 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGG 69 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGG 70 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGG 71 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGG 72 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGG 73 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGG 74 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGG 75 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGG 76 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGG 77 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGG 78 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGG 79 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGG 80 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGG 81 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 61 GGGGGGGGGGGGGGGGGGGGGG 82 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGG 84 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGG 85 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 [197][TOP] >UniRef100_B6UB95 Glycine-rich RNA-binding protein 7 n=1 Tax=Zea mays RepID=B6UB95_MAIZE Length = 252 Score = 53.5 bits (127), Expect(2) = 6e-08 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GFRG Y GG + GGGGY GGGG + GGGGGY GGGGG Sbjct: 112 GFRGG----GGYGGGGYGGGGGYGGGGGGY-GGGGGYGGGGGGG 150 Score = 29.3 bits (64), Expect(2) = 6e-08 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 177 GGGGGGGGRGGG 212 GGGGGGGG GGG Sbjct: 144 GGGGGGGGYGGG 155 Score = 53.9 bits (128), Expect(2) = 1e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRR 181 GGY GGGGY GGGGY GGGGG + GG G R R Sbjct: 128 GGYGGGGGGYGGGGGYGGGGGGGGYGGGDYGGNRNR 163 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSG 230 RGGGG G GGG + T+G Sbjct: 163 RGGGGDYGVAGGGGGTFTAG 182 [198][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 47.8 bits (112), Expect(2) = 6e-08 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG G GG GGGGY GGGGG + GGGGG Sbjct: 86 RGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGG 117 Score = 35.0 bits (79), Expect(2) = 6e-08 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGG GG GGG R SG+ G + + Sbjct: 123 GGGGGGYGGGGGGGDRPSGARGWEDR 148 [199][TOP] >UniRef100_B4NCH1 GK25855 n=1 Tax=Drosophila willistoni RepID=B4NCH1_DROWI Length = 193 Score = 50.8 bits (120), Expect(2) = 6e-08 Identities = 22/35 (62%), Positives = 26/35 (74%), Gaps = 4/35 (11%) Frame = +2 Query: 74 GGYHNGGGGYN----GGGGYHNGGGGGYHNGGGGG 166 GG H GGGG++ GGGG+ +GGGGG H GGGGG Sbjct: 119 GGGHGGGGGWSSGGGGGGGWSSGGGGGGHGGGGGG 153 Score = 32.0 bits (71), Expect(2) = 6e-08 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSG 230 GGGGGGGG GGG + SG Sbjct: 173 GGGGGGGGHGGGGWQPSG 190 Score = 48.1 bits (113), Expect(2) = 2e-06 Identities = 20/33 (60%), Positives = 26/33 (78%), Gaps = 2/33 (6%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHN--GGGGGYHNGGGGG 166 GG+ GGGG+ GGGG+ + GGGGG+ +GGGGG Sbjct: 113 GGHGGGGGGHGGGGGWSSGGGGGGGWSSGGGGG 145 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG GG GGGGG+ +GGGGG Sbjct: 62 GGWSSGGGGGGGGWSSGGGGGGGWSSGGGGG 92 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGGG GGG +SG G Sbjct: 113 GGHGGGGGGHGGGGGWSSGGGG 134 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG 230 GGGGGG GG GGG G Sbjct: 166 GGGGGGHGGGGGGGGHGGG 184 [200][TOP] >UniRef100_Q6YNS1 Putative glycine-rich RNA-binding protein n=1 Tax=Prunus avium RepID=Q6YNS1_PRUAV Length = 178 Score = 50.1 bits (118), Expect(2) = 6e-08 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG + GGGGY GGGG GGGGGY GGGGG Sbjct: 106 GGGYGGGGGY-GGGGRREGGGGGYSRGGGGG 135 Score = 32.7 bits (73), Expect(2) = 6e-08 Identities = 17/30 (56%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = +3 Query: 171 RGGGGGG----GGGRGGGRSRTSGSPGLQG 248 RGGGGGG GGG GGG R G G +G Sbjct: 130 RGGGGGGYGSGGGGYGGGGRREGGYGGGEG 159 [201][TOP] >UniRef100_A9P8S6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9P8S6_POPTR Length = 170 Score = 49.7 bits (117), Expect(2) = 6e-08 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGGY+ GGG + GGG GY +GGGGG Sbjct: 110 GGRREGGGGYSRGGGGYGGGGSGYGSGGGGG 140 Score = 33.1 bits (74), Expect(2) = 6e-08 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPG 239 G GGGGGG GGGR R G G Sbjct: 134 GSGGGGGGYGGGRDRGYGDGG 154 [202][TOP] >UniRef100_A9ZAC4 Beta-galactosidase (Lactase) n=2 Tax=Yersinia pestis RepID=A9ZAC4_YERPE Length = 585 Score = 62.8 bits (151), Expect = 7e-08 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +1 Query: 772 SLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEW 930 SL +L RRDW NP +TQ +RL AHPPF E A+ DRPS Q ++LNG W Sbjct: 4 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 56 [203][TOP] >UniRef100_A9R0J8 Beta-galactosidase n=6 Tax=Yersinia pestis RepID=BGAL_YERPG Length = 1050 Score = 62.8 bits (151), Expect = 7e-08 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +1 Query: 772 SLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEW 930 SL +L RRDW NP +TQ +RL AHPPF E A+ DRPS Q ++LNG W Sbjct: 4 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 56 [204][TOP] >UniRef100_B2K6E6 Beta-galactosidase n=3 Tax=Yersinia pseudotuberculosis RepID=BGAL_YERPB Length = 1066 Score = 62.8 bits (151), Expect = 7e-08 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +1 Query: 772 SLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEW 930 SL +L RRDW NP +TQ +RL AHPPF E A+ DRPS Q ++LNG W Sbjct: 14 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 [205][TOP] >UniRef100_Q1C6T8 Beta-galactosidase n=8 Tax=Yersinia pestis RepID=BGAL_YERPA Length = 1060 Score = 62.8 bits (151), Expect = 7e-08 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +1 Query: 772 SLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEW 930 SL +L RRDW NP +TQ +RL AHPPF E A+ DRPS Q ++LNG W Sbjct: 14 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 [206][TOP] >UniRef100_A7FH78 Beta-galactosidase n=1 Tax=Yersinia pseudotuberculosis IP 31758 RepID=BGAL_YERP3 Length = 1066 Score = 62.8 bits (151), Expect = 7e-08 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +1 Query: 772 SLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEW 930 SL +L RRDW NP +TQ +RL AHPPF E A+ DRPS Q ++LNG W Sbjct: 14 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 [207][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 43.5 bits (101), Expect(2) = 7e-08 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPPL PPPPPL PPPP PPPL PP Sbjct: 99 PPPPPL--PPPPPLPPPPPPPPLPPPL--PP 125 Score = 39.3 bits (90), Expect(2) = 7e-08 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPL 170 P P PL PPP PPPPPPPPPL Sbjct: 81 PLPPPPPL--PPPPPLPPPPPPPPPL 104 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPPL PPPPP PPPPL PPPPL PP Sbjct: 89 PPPPPL--PPPPP---PPPPLPPPPPLPPPP 114 Score = 33.5 bits (75), Expect(2) = 2e-07 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 229 PLVLERPPPRPPPPPPPPP 173 P L PPP PPPPP PPP Sbjct: 79 PPPLPPPPPLPPPPPLPPP 97 [208][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 44.3 bits (103), Expect(2) = 8e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 216 SPPPPP---PPPPPPSPPPPPPPPPPPSPPPP 244 Score = 38.1 bits (87), Expect(2) = 8e-08 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPPPPPPPPP 173 C P + +V +PPP PPPPPPP P Sbjct: 194 CCPQNIVVEPQPPPPPPPPPPPSP 217 Score = 44.3 bits (103), Expect(2) = 2e-07 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 228 SPPPPP---PPPPPPSPPPPPPPPPPPSPPPP 256 Score = 36.6 bits (83), Expect(2) = 2e-07 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPP 173 PPP PPPPPPPPP Sbjct: 213 PPPSPPPPPPPPP 225 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPPP PPPP Sbjct: 235 PPPPPSPPPPPPP---PPPPSPPPPP 257 Score = 36.6 bits (83), Expect(2) = 1e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPP 173 PPP PPPPPPPPP Sbjct: 225 PPPSPPPPPPPPP 237 Score = 42.7 bits (99), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 223 PPPPPSPPPPPPP---PPPPSPPPPPPPPPP 250 Score = 34.7 bits (78), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPP P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSP 229 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 222 PPPPPPSPPPPPP---PPPPPSPPPPPPPPP 249 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPP PP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPP 230 Score = 41.6 bits (96), Expect(2) = 4e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 S PPPPP PPPPP PPPP PPPP PP Sbjct: 228 SPPPPPP---PPPPPS--PPPPPPPPPPPSPPP 255 Score = 35.0 bits (79), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPP 236 [209][TOP] >UniRef100_C9SP10 ATP-dependent RNA helicase DBP2 n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SP10_9PEZI Length = 577 Score = 52.8 bits (125), Expect(2) = 8e-08 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY GGGG + GGGGGY GGGGG Sbjct: 3 GGY--GGGGYGGGGGGYGGGGGGYGGGGGGG 31 Score = 29.6 bits (65), Expect(2) = 8e-08 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGG GGG G G Sbjct: 57 GGGGGYGGGYGGGGGYGGGGGG 78 Score = 52.8 bits (125), Expect(2) = 2e-07 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 74 GGYHNGGGGY-NGGGGYHNGGGGGYHNGGGGGEERRRRRRRR 196 GGY GGGGY GGGGY GGGGGY GG GG R R R Sbjct: 8 GGYGGGGGGYGGGGGGYGGGGGGGYGGGGRGGYGGGRNDRDR 49 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGS 233 GGGGG GGG GG R G+ Sbjct: 67 GGGGGYGGGGGGDRMSNLGA 86 [210][TOP] >UniRef100_A8W7L0 Putative RNA helicase n=1 Tax=Phytophthora infestans RepID=A8W7L0_PHYIN Length = 544 Score = 54.7 bits (130), Expect(2) = 8e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGY GGGGY+GGGG + GGGGGY GG GG Sbjct: 41 GGYGGGGGGYSGGGGGYGGGGGGYSGGGRGG 71 Score = 27.7 bits (60), Expect(2) = 8e-08 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 171 RGGGGGGGGGRGG 209 RGGGGGGG G GG Sbjct: 69 RGGGGGGGFGGGG 81 Score = 49.7 bits (117), Expect(2) = 5e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGG 163 RGG GGGGY GGGG ++GGGGGY GGGG Sbjct: 36 RGG---GGGGYGGGGGGYSGGGGGYGGGGGG 63 Score = 30.0 bits (66), Expect(2) = 5e-07 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 174 GGGGGG--GGGRGGGRSRTSGSPG 239 GGGGGG GGGRGGG G G Sbjct: 58 GGGGGGYSGGGRGGGGGGGFGGGG 81 [211][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 45.8 bits (107), Expect(2) = 8e-08 Identities = 23/44 (52%), Positives = 25/44 (56%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 PPPPP PPPPP PPPP PPPP PP R+P +P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 36.6 bits (83), Expect(2) = 8e-08 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP P PPPPPPP Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPP 266 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPPPPPP Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPP 274 Score = 39.3 bits (90), Expect(2) = 6e-07 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPP 88 SPPPPP PPPPP PPPP P PP Sbjct: 277 SPPPPPPPPPPPPP---PPPPPSPSPP 300 Score = 38.9 bits (89), Expect(2) = 8e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPP 272 Score = 36.6 bits (83), Expect(2) = 8e-06 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPP 91 S PPPPP PPPPP PPPP PP Sbjct: 277 SPPPPPPPPPPPPPP---PPPPSPSPP 300 [212][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 42.7 bits (99), Expect(2) = 8e-08 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPP PPPPP PPPP PPPP+ Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPI 75 Score = 39.7 bits (91), Expect(2) = 8e-08 Identities = 22/53 (41%), Positives = 27/53 (50%) Frame = -1 Query: 331 SSKRYSVRQRCLALETIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 SS R +RQ ++P F + G+P P V PP PPPPPPPPP Sbjct: 7 SSNRKQIRQP----PSVP-FLWEEKPGIPKKDWKPEVTAVNPPPPPPPPPPPP 54 [213][TOP] >UniRef100_Q9SL09 Putative uncharacterized protein At2g05580 n=1 Tax=Arabidopsis thaliana RepID=Q9SL09_ARATH Length = 302 Score = 48.1 bits (113), Expect(2) = 8e-08 Identities = 21/33 (63%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGG-GYHNGGGGG 166 +GG+ GGGG GGGG+ GGGG G H GGGGG Sbjct: 232 QGGHKGGGGGGQGGGGHKGGGGGQGGHKGGGGG 264 Score = 34.3 bits (77), Expect(2) = 8e-08 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGGGRGGG S G G Sbjct: 270 GGRGGGGGGRGGGGSGGGGGGG 291 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 21/33 (63%), Positives = 22/33 (66%), Gaps = 3/33 (9%) Frame = +2 Query: 74 GGYHNGGGGYNGGG---GYHNGGGGGYHNGGGG 163 GG GGGG+ GGG G H GGGGG H GGGG Sbjct: 239 GGGGQGGGGHKGGGGGQGGHKGGGGGGHVGGGG 271 Score = 32.0 bits (71), Expect(2) = 4e-06 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPG 239 RGGGG GGGG GGG R G G Sbjct: 279 RGGGGSGGGG-GGGSGRGGGGGG 300 [214][TOP] >UniRef100_B4IZJ4 GH14508 n=1 Tax=Drosophila grimshawi RepID=B4IZJ4_DROGR Length = 272 Score = 50.4 bits (119), Expect(2) = 8e-08 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +2 Query: 89 GGGGYNGGGGYHNGGGGGYHNGGGGG 166 GGGGY GGGGY GGGGG + GGGGG Sbjct: 66 GGGGYGGGGGYGGGGGGGGYGGGGGG 91 Score = 32.0 bits (71), Expect(2) = 8e-08 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 G GGGGGGG GGG S + G G QG+ Sbjct: 100 GYGGGGGGGYGGGDS-SGGHGGSQGQ 124 Score = 45.1 bits (105), Expect(2) = 7e-06 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = +2 Query: 68 YRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 Y GG GG G GGGGY GG GY GGGGG Sbjct: 76 YGGGGGGGGYGGGGGGGYGGGGDSGYGGGGGGG 108 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGG G GGG G G G Sbjct: 149 GGGGGGGYGGGGGGGGYGGGGGYGG 173 [215][TOP] >UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3D7B Length = 211 Score = 45.8 bits (107), Expect(2) = 8e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG GGGG GGGG GGGGG GGGGG Sbjct: 108 RGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGG 139 Score = 36.6 bits (83), Expect(2) = 8e-08 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGGR G G G+ Sbjct: 154 GGGGGGGGGGGGGRGDGGGGGGGGGR 179 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG +GGGG GGGGG GGGGG Sbjct: 54 GGGGGGGGGGDGGGGGGGGGGGGGDGGGGGG 84 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPGLQG 248 RGGGGGGGGG GGG G G G Sbjct: 108 RGGGGGGGGGGGGGGGGGGGGGGGDG 133 Score = 44.3 bits (103), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG +GGGG GGGG GGGGG GGGGG Sbjct: 91 GGGGSGGGGGGGGGGDGRGGGGGGGGGGGGG 121 Score = 35.8 bits (81), Expect(2) = 4e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG R G G Sbjct: 152 GGGGGGGGGGGGGGGRGDGGGG 173 Score = 44.7 bits (104), Expect(2) = 5e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG +GGGGG Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGGRGDGGGGG 174 Score = 35.0 bits (79), Expect(2) = 5e-07 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPV 257 GGGGGGGGGRGGG G G G V Sbjct: 170 GGGGGGGGGRGGG-----GGDGASGSGV 192 Score = 44.7 bits (104), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 62 GGDGGGGGGGGGGGGGDGGGGGGAAGGGGGG 92 Score = 34.3 bits (77), Expect(2) = 8e-07 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGGGGGG GGG G G Sbjct: 108 RGGGGGGGGGGGGGGGGGGGGGGG 131 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGDGGGGGG 53 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG +GGGGG GGGGG Sbjct: 115 GGGGGGGGGGGGGGGGGDGGGGGGGGGGGGG 145 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG +G G Sbjct: 69 GGGGGGGGGDGGGGGGAAGGGG 90 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G +G Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGGRG 168 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG +GGGGG GGGGG Sbjct: 30 GGGGGGGGGGGGGGGGGDGGGGGGGGGGGGG 60 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 116 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGG 146 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 55 GGGGGGGGGDGGGGGGGGGGGGGDG 79 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G G G+ Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGR 167 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 31 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGG 61 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GG GGGGGG GGG R G G Sbjct: 93 GGSGGGGGGGGGGDGRGGGGGG 114 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG +GGGG GGGGG GGGGG Sbjct: 122 GGGGGGGGGGDGGGGGGGGGGGGGGGGGGGG 152 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGGGDGGGGGGG 54 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG +GGGGG GGGGG Sbjct: 61 GGGDGGGGGGGGGGGGGDGGGGGGAAGGGGG 91 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 48 GGGGGGGGGGGGGGGGDGGGGG 69 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 116 GGGGGGGGGGGGGGGGDGGGGG 137 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 153 GGGGGGGGGGGGGGRGDGGGGG 174 Score = 44.3 bits (103), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG +GGGG GGGG GGGGG GGGGG Sbjct: 128 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 32 GGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG 62 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 117 GGGGGGGGGGGGGGGDGGGGGGGGGGGGGGG 147 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGG GRGGG G G Sbjct: 99 GGGGGGGDGRGGGGGGGGGGGG 120 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGG 160 Score = 32.7 bits (73), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 150 GGGGGGGGGGGGGGGGGRGDGG 171 Score = 42.7 bits (99), Expect(2) = 7e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGE 169 GG +GGGG GGGG GGGGG GGGGG+ Sbjct: 18 GGVGSGGGGGGGGGG--GGGGGGGGGGGGGGD 47 Score = 42.7 bits (99), Expect(2) = 7e-06 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +2 Query: 77 GYHNGGGGYNGGGGYHNGGGGGYHNGGGGGE 169 G GGGG GGGG +GGGGG GGGGG+ Sbjct: 48 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGD 78 Score = 33.1 bits (74), Expect(2) = 7e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 49 GGGGGGGGGGGGGGGDGGGGGG 70 Score = 33.1 bits (74), Expect(2) = 7e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 113 GGGGGGGGGGGGGGGGGGGDGG 134 Score = 44.3 bits (103), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 129 GGGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGG GGGGG GGGGG Sbjct: 92 GGGSGGGGGGGGGGDGRGGGGGGGGGGGGGG 122 Score = 33.1 bits (74), Expect(2) = 9e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 115 GGGGGGGGGGGGGGGGGDGGGG 136 Score = 31.2 bits (69), Expect(2) = 9e-06 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG G G G G +G Sbjct: 156 GGGGGGGGGGGRGDGGGGGGGGGRG 180 [216][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 43.1 bits (100), Expect(2) = 8e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 39.3 bits (90), Expect(2) = 8e-08 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPPPPPPPPP 173 C P P PPP PPPPPPPPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPP 43 Score = 43.1 bits (100), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.0 bits (84), Expect(2) = 4e-07 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 232 DPLVLERPPPRPPPPPPPPP 173 DP PPP PPPPPPPPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPP 34 Score = 43.1 bits (100), Expect(2) = 5e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 36.6 bits (83), Expect(2) = 5e-07 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 238 PGDPLVLERPPPRPPPPPPPPP 173 P P PPP PPPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPP 37 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 220 LERPPPRPPPPPPPPP 173 ++ PPP PPPPPPPP Sbjct: 14 VDPPPPHCPPPPPPPP 29 [217][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 45.1 bits (105), Expect(2) = 8e-08 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 PPPPP PPPPP PPPP PPPP PPR Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 99 Score = 37.4 bits (85), Expect(2) = 8e-08 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPP 75 [218][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 43.1 bits (100), Expect(2) = 8e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 39.3 bits (90), Expect(2) = 8e-08 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 244 CSPGDPLVLERPPPRPPPPPPPPP 173 C P P PPP PPPPPPPPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 37.4 bits (85), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPP 43 Score = 43.1 bits (100), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 37.0 bits (84), Expect(2) = 4e-07 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 232 DPLVLERPPPRPPPPPPPPP 173 DP PPP PPPPPPPPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPP 34 Score = 43.1 bits (100), Expect(2) = 5e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 36.6 bits (83), Expect(2) = 5e-07 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 238 PGDPLVLERPPPRPPPPPPPPP 173 P P PPP PPPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPP 37 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 220 LERPPPRPPPPPPPPP 173 ++ PPP PPPPPPPP Sbjct: 14 VDPPPPHCPPPPPPPP 29 [219][TOP] >UniRef100_Q95UX2 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX2_DROVI Length = 165 Score = 52.4 bits (124), Expect(2) = 8e-08 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +2 Query: 65 RYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRRRRR 190 R RGG GGGG GGGG GGGGG GGGGG +R R R Sbjct: 64 RARGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSR 105 Score = 30.0 bits (66), Expect(2) = 8e-08 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSG 230 RGGGGGGG GGG + G Sbjct: 105 RGGGGGGGQNSGGGNNSQRG 124 [220][TOP] >UniRef100_Q6D736 Beta-galactosidase n=1 Tax=Pectobacterium atrosepticum RepID=BGAL_ERWCT Length = 1040 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/54 (53%), Positives = 32/54 (59%) Frame = +1 Query: 772 SLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 +L +L RRDW NP T RL AHPPF A D PSQ+LR LNGEWK Sbjct: 15 TLREILARRDWENPACTNYQRLPAHPPFNSWRNVAAAHQDEPSQRLRRLNGEWK 68 [221][TOP] >UniRef100_B7Q9F8 E3 ubiquitin ligase, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q9F8_IXOSC Length = 112 Score = 49.3 bits (116), Expect(2) = 9e-08 Identities = 25/46 (54%), Positives = 26/46 (56%) Frame = +2 Query: 29 SYGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 SYG + AR GG GGGG GGGG GGGGG GGGGG Sbjct: 38 SYGRHDKDVHVARLGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 33.1 bits (74), Expect(2) = 9e-08 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGG 96 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 61 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 78 GGGGGGGGGGGGGGGGGGGGGG 99 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 79 GGGGGGGGGGGGGGGGGGGGGG 100 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 80 GGGGGGGGGGGGGGGGGGGGGG 101 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 81 GGGGGGGGGGGGGGGGGGGGGG 102 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGG 103 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGG 104 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGG 105 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGG 106 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGG 107 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGG 108 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGG 109 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGG 110 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGG 111 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGG 112 [222][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 42.4 bits (98), Expect(2) = 9e-08 Identities = 19/27 (70%), Positives = 19/27 (70%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPP PPPPP PPPP PPPPL Sbjct: 27 PPPPPPPPPPPPP---PPPPPPPPPPL 50 Score = 40.0 bits (92), Expect(2) = 9e-08 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 Query: 229 PLVLERPPPRPPPPPPPPP 173 PL PPPRPPPPPPPPP Sbjct: 17 PLPPPPPPPRPPPPPPPPP 35 [223][TOP] >UniRef100_UPI0001797D87 PREDICTED: diaphanous homolog 2 (Drosophila) n=1 Tax=Equus caballus RepID=UPI0001797D87 Length = 1092 Score = 45.8 bits (107), Expect(2) = 1e-07 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -1 Query: 256 TGLPCSPGDPLVLERPPPRPPPPPPPPPL 170 +G+PC P P++ PP PPPPPPPPPL Sbjct: 547 SGIPCPPPPPVLPGGGPPPPPPPPPPPPL 575 Score = 36.2 bits (82), Expect(2) = 1e-07 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 14/41 (34%) Frame = -2 Query: 165 PPPPPLW*PPPPP--------------LW*PPPPL*PPPPL 85 PPPPPL PPPPP L+ PPP PPPPL Sbjct: 570 PPPPPLQGPPPPPPPLPGMIGVQRPPPLFGVPPP--PPPPL 608 [224][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 46.2 bits (108), Expect(2) = 1e-07 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG GGGG GGGG GGGGG GGGGG Sbjct: 46 RGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G+ G Sbjct: 103 GGGGGGGGGGGGGGGGVGGGGGVGG 127 Score = 45.4 bits (106), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 110 GGGGGGGGGVGGGGGVGGGGGGGGGGGGGGG 140 Score = 45.4 bits (106), Expect(2) = 3e-07 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGE 169 GG GGGG GGGG GGGGG GGGGG+ Sbjct: 194 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGD 225 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGVGGGGGGG 172 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 150 GGGGGGGGGGGGGGGVGGGGGGGGGGGGGGG 180 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 156 GGGGGGGGGVGGGGGGGGGGGGGGGGGGGGG 186 Score = 44.7 bits (104), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 163 GGVGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG R G G Sbjct: 195 GGGGGGGGGGGGGGGRGGGGGG 216 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGGR G G Sbjct: 197 GGGGGGGGGGGGGRGGGGGGGG 218 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGGRGGG G G Sbjct: 201 GGGGGGGGGRGGGGGGGGGGGG 222 Score = 35.8 bits (81), Expect(2) = 3e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGGR G G Sbjct: 216 GGGGGGGGGDGGGRGGGGGGGG 237 Score = 35.0 bits (79), Expect(2) = 3e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G+ G Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGVGG 167 Score = 35.0 bits (79), Expect(2) = 3e-07 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPG 239 RGGGGGGGGG GGG G G Sbjct: 229 RGGGGGGGGGGGGGGDGGGGGGG 251 Score = 44.3 bits (103), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 345 GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 375 Score = 35.8 bits (81), Expect(2) = 4e-07 Identities = 20/41 (48%), Positives = 21/41 (51%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCLERVKDGMVSSA 296 GGGGGGGGG GGG G G G E+ G VS A Sbjct: 416 GGGGGGGGGGGGGGGGGGGGGGGGGVGQEPEQTWQGWVSDA 456 Score = 44.7 bits (104), Expect(2) = 5e-07 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG +GGGGG Sbjct: 65 GGGGGGGGGGGGGGGSGGGGGGGGGSGGGGG 95 Score = 35.0 bits (79), Expect(2) = 5e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G+ G Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGVGG 121 Score = 44.3 bits (103), Expect(2) = 6e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 48 GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 43.9 bits (102), Expect(2) = 6e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 380 Score = 35.4 bits (80), Expect(2) = 6e-07 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCLERVKDGMVSSAKHL 305 GGGGGGGGG GGG G G + + V D + +H+ Sbjct: 421 GGGGGGGGGGGGGGGGGGGGVGQEPEQTWQGWVSDAFYTFYEHM 464 Score = 35.0 bits (79), Expect(2) = 6e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG GS G Sbjct: 71 GGGGGGGGGSGGGGGGGGGSGG 92 Score = 44.7 bits (104), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 123 GGVGGGGGGGGGGGGGGGGGGGGGGGGGGGG 153 Score = 44.7 bits (104), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 216 Score = 34.3 bits (77), Expect(2) = 8e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G +G Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGRG 211 Score = 34.3 bits (77), Expect(2) = 8e-07 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGGGGGG GGG G G Sbjct: 229 RGGGGGGGGGGGGGGDGGGGGGGG 252 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 289 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 292 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG GS G Sbjct: 328 GGGGGGGGGGGGGGGGGGGSGG 349 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG SG G Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGG 351 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG S G G Sbjct: 333 GGGGGGGGGGGGGGSGGGGGGG 354 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 81 GGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 111 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 116 GGGVGGGGGVGGGGGGGGGGGGGGGGGGGGG 146 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEER 175 GG GGGG GGGG GGGGG GGGGG R Sbjct: 177 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 210 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 260 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 290 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG + G G Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGG 352 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 149 GGGGGGGGGGGGGGGGVGGGGG 170 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G G G+ Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGR 210 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 R GGGGGGGGG GGG G G Sbjct: 210 RGGGGGGGGGGGGGGDGGGRGGGG 233 Score = 44.7 bits (104), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG +GGGGG GGGGG Sbjct: 227 GGRGGGGGGGGGGGGGGDGGGGGGGGGGGGG 257 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG +GGGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGSGGGGG 85 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 156 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 253 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 283 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 254 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 284 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGRGG 212 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSG 348 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGSGG 349 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 81 GGGGGGGGGSGGGGGGGGGGGG 102 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGG 270 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGSGGGGGG 86 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 87 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG +GGGG GGGG GGGGG GGGGG Sbjct: 86 GGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 87 GGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 88 GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 217 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG +GGGG GGGGG GGGGG Sbjct: 234 GGGGGGGGGGDGGGGGGGGGGGGGGGGGGGG 264 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG +GGGG GGGG GGGGG GGGGG Sbjct: 240 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGGG 270 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 241 GGGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 271 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG +GGGGG Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGSGGGGG 352 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGSGGGGGG 353 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 354 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG +GGGGG GGGGG Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGG 360 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGG 361 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGGGGGGG 362 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG +GGGG GGGGG GGGGG Sbjct: 337 GGGGGGGGGGSGGGGGGGGGGGGGGGGGGGG 367 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 368 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG +GGGG GGGG GGGGG GGGGG Sbjct: 343 GGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 373 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 344 GGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 374 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 291 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 293 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 297 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 194 GGGGGGGGGGGGGGGGRGGGGG 215 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGG 353 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 334 GGGGGGGGGGGGGSGGGGGGGG 355 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGG 359 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGG 112 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGG 113 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGG 147 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGG 148 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGG 149 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG G G R G G Sbjct: 214 GGGGGGGGGGGDGGGRGGGGGG 235 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGG 277 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGG 283 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGG 284 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGG 369 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGG 370 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGG 371 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGG 373 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGG 374 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGG 375 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 359 GGGGGGGGGGGGGGGGGGGGGG 380 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGG 381 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 365 GGGGGGGGGGGGGGGGGGGGGG 386 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 366 GGGGGGGGGGGGGGGGGGGGGG 387 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 176 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 215 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 193 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 223 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 235 GGGGGGGGGDGGGGGGGGGGGGGGGGGGGGG 265 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 242 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 272 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 245 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 275 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 246 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 276 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 277 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 248 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 278 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 279 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 280 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 251 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 281 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 252 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 282 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 255 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 285 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 286 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 258 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 288 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 294 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 295 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 296 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 298 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 299 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 300 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 301 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 302 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 303 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 306 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 308 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 309 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 280 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 281 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 311 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 312 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 283 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 313 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 284 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 314 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 285 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 289 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 290 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 291 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 292 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 293 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 295 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 296 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 338 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 309 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 339 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 340 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 341 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 342 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 313 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 343 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 314 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 344 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 345 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 346 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 378 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 379 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 381 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 382 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 383 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 384 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 385 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 386 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 387 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 358 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 388 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 359 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 389 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 390 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 361 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 391 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 392 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 363 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 393 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 364 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 394 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 365 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 395 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 366 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 396 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 367 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 397 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 368 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 398 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 399 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 371 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 401 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 402 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 373 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 403 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 404 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 375 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 405 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 376 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 406 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 377 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 407 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 408 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 379 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 409 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 380 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 410 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 381 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 411 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 382 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 412 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 383 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 413 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 384 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 414 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 415 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 386 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 416 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 387 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 417 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 388 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 418 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 389 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 419 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 390 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 420 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GG G GGGG GGGGG GGGGG Sbjct: 43 GGGRGGGSGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG S G G Sbjct: 66 GGGGGGGGGGGGGGSGGGGGGG 87 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGG 187 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGG 188 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGG 189 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGG 190 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGG 191 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGG 192 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 172 GGGGGGGGGGGGGGGGGGGGGG 193 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG G G Sbjct: 220 GGGGGDGGGRGGGGGGGGGGGG 241 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 235 GGGGGGGGGDGGGGGGGGGGGG 256 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 245 GGGGGGGGGGGGGGGGGGGGGG 266 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 246 GGGGGGGGGGGGGGGGGGGGGG 267 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGG 268 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 248 GGGGGGGGGGGGGGGGGGGGGG 269 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGG 271 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGG 278 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGG 285 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGG 288 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGG 289 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGG 290 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGG 291 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGG 292 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGG 293 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGG 294 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGG 295 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGG 298 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGG 299 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 280 GGGGGGGGGGGGGGGGGGGGGG 301 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGG 307 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGG 308 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGG 309 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 290 GGGGGGGGGGGGGGGGGGGGGG 311 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 291 GGGGGGGGGGGGGGGGGGGGGG 312 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 292 GGGGGGGGGGGGGGGGGGGGGG 313 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 293 GGGGGGGGGGGGGGGGGGGGGG 314 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGG 315 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 295 GGGGGGGGGGGGGGGGGGGGGG 316 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 296 GGGGGGGGGGGGGGGGGGGGGG 317 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGG 318 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGG 319 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGG 320 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGG 321 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGG 322 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGG 323 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGG 324 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGG 325 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGG 326 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGG 327 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGG 328 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGG 329 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 309 GGGGGGGGGGGGGGGGGGGGGG 330 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGG 331 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGG 332 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGG 333 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 313 GGGGGGGGGGGGGGGGGGGGGG 334 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 314 GGGGGGGGGGGGGGGGGGGGGG 335 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGG 336 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGG 337 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 317 GGGGGGGGGGGGGGGGGGGGGG 338 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGG 339 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGG 340 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGG 341 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGG 342 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGG 343 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGG 344 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGG 372 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGG 376 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGG 377 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGG 378 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 358 GGGGGGGGGGGGGGGGGGGGGG 379 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 361 GGGGGGGGGGGGGGGGGGGGGG 382 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGG 383 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 363 GGGGGGGGGGGGGGGGGGGGGG 384 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 364 GGGGGGGGGGGGGGGGGGGGGG 385 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 367 GGGGGGGGGGGGGGGGGGGGGG 388 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 368 GGGGGGGGGGGGGGGGGGGGGG 389 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGG 390 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGG 391 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 371 GGGGGGGGGGGGGGGGGGGGGG 392 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGG 393 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 373 GGGGGGGGGGGGGGGGGGGGGG 394 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGG 395 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 375 GGGGGGGGGGGGGGGGGGGGGG 396 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 376 GGGGGGGGGGGGGGGGGGGGGG 397 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 377 GGGGGGGGGGGGGGGGGGGGGG 398 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGG 399 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 379 GGGGGGGGGGGGGGGGGGGGGG 400 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 380 GGGGGGGGGGGGGGGGGGGGGG 401 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 381 GGGGGGGGGGGGGGGGGGGGGG 402 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 382 GGGGGGGGGGGGGGGGGGGGGG 403 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 383 GGGGGGGGGGGGGGGGGGGGGG 404 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 384 GGGGGGGGGGGGGGGGGGGGGG 405 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGG 406 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 386 GGGGGGGGGGGGGGGGGGGGGG 407 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 387 GGGGGGGGGGGGGGGGGGGGGG 408 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 388 GGGGGGGGGGGGGGGGGGGGGG 409 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 389 GGGGGGGGGGGGGGGGGGGGGG 410 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 390 GGGGGGGGGGGGGGGGGGGGGG 411 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 391 GGGGGGGGGGGGGGGGGGGGGG 412 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 392 GGGGGGGGGGGGGGGGGGGGGG 413 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 393 GGGGGGGGGGGGGGGGGGGGGG 414 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 394 GGGGGGGGGGGGGGGGGGGGGG 415 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 395 GGGGGGGGGGGGGGGGGGGGGG 416 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 396 GGGGGGGGGGGGGGGGGGGGGG 417 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 397 GGGGGGGGGGGGGGGGGGGGGG 418 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 398 GGGGGGGGGGGGGGGGGGGGGG 419 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 399 GGGGGGGGGGGGGGGGGGGGGG 420 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 400 GGGGGGGGGGGGGGGGGGGGGG 421 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 401 GGGGGGGGGGGGGGGGGGGGGG 422 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 402 GGGGGGGGGGGGGGGGGGGGGG 423 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 403 GGGGGGGGGGGGGGGGGGGGGG 424 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 404 GGGGGGGGGGGGGGGGGGGGGG 425 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 405 GGGGGGGGGGGGGGGGGGGGGG 426 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 406 GGGGGGGGGGGGGGGGGGGGGG 427 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 407 GGGGGGGGGGGGGGGGGGGGGG 428 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 408 GGGGGGGGGGGGGGGGGGGGGG 429 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 409 GGGGGGGGGGGGGGGGGGGGGG 430 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 410 GGGGGGGGGGGGGGGGGGGGGG 431 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 411 GGGGGGGGGGGGGGGGGGGGGG 432 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 412 GGGGGGGGGGGGGGGGGGGGGG 433 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 413 GGGGGGGGGGGGGGGGGGGGGG 434 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 415 GGGGGGGGGGGGGGGGGGGGGG 436 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGVGGGGGVGGGGGGG 132 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 122 GGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 152 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGVGGGGGG 171 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 149 GGGGGGGGGGGGGGGGVGGGGGGGGGGGGGG 179 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 162 GGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 192 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGG 150 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGG 194 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGG 195 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGG 196 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGG 205 Score = 32.7 bits (73), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 193 GGGGGGGGGGGGGGGGGRGGGG 214 Score = 32.7 bits (73), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 196 GGGGGGGGGGGGGGRGGGGGGG 217 Score = 43.1 bits (100), Expect(2) = 5e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG GGGG GGG GGGGG GGGGG Sbjct: 229 RGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGG 260 Score = 42.0 bits (97), Expect(2) = 5e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG G GG GGGG GGGGG GGGGG Sbjct: 44 GGRGGGSGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 34.3 bits (77), Expect(2) = 5e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 67 GGGGGGGGGGGGGSGGGGGGGGGSG 91 Score = 33.1 bits (74), Expect(2) = 5e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 252 GGGGGGGGGGGGGGGGGGGGGG 273 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG 124 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 121 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG 151 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG 170 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 148 GGGGGGGGGGGGGGGGGVGGGGGGGGGGGGG 178 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 155 GGGGGGGGGGVGGGGGGGGGGGGGGGGGGGG 185 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 161 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG 191 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGE 169 GG GGGG G GG GGGGG GGGGG+ Sbjct: 213 GGGGGGGGGGGGDGGGRGGGGGGGGGGGGGGD 244 Score = 41.6 bits (96), Expect(2) = 6e-06 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGG GGGG GGGGG GGGGG Sbjct: 42 GGGGRGGGSGGGGGGGGGGGGGGGGGGGGGG 72 Score = 34.3 bits (77), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG + G G Sbjct: 64 GGGGGGGGGGGGGGGGSGGGGG 85 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGG 151 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 176 GGGGGGGGGGGGGGGGGGGGGG 197 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 177 GGGGGGGGGGGGGGGGGGGGGG 198 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGG 199 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGG 200 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGG 204 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 251 GGGGGGGGGGGGGGGGGGGGGG 272 Score = 42.4 bits (98), Expect(2) = 8e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 109 GGGGGGGGGGVGGGGGVGGGGGGGGGGGGGG 139 Score = 40.8 bits (94), Expect(2) = 8e-06 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 RGG +G GG +GGGG G GGG GGGGG Sbjct: 30 RGGGCSGCGGGSGGGGRGGGSGGGGGGGGGGG 61 Score = 34.7 bits (78), Expect(2) = 8e-06 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG GS G Sbjct: 61 GGGGGGGGGGGGGGGGGGGSGG 82 Score = 33.1 bits (74), Expect(2) = 8e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGG 152 [225][TOP] >UniRef100_Q18880 Protein C56A3.1, partially confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q18880_CAEEL Length = 393 Score = 45.4 bits (106), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 93 GGCGGGGGGCGGGGGCGGGGGGGCGGGGGGG 123 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKPVCL 263 GGG GGGGG GGG + GS G PV L Sbjct: 121 GGGCGGGGGGGGGGYASGGSGGFASAPVSL 150 [226][TOP] >UniRef100_UPI0000DB7202 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB7202 Length = 344 Score = 53.9 bits (128), Expect(2) = 1e-07 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 74 GGYHNGGGGYNGGG-GYHNGGGGGYHNGGGGG 166 GGY GGGGY+GGG GY GGGGGY G GGG Sbjct: 225 GGYSGGGGGYSGGGNGYSGGGGGGYSGGNGGG 256 Score = 28.1 bits (61), Expect(2) = 1e-07 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 177 GGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GGG + G G G Sbjct: 276 GGGGGGYSGGGGGGYSGGGNGYSG 299 Score = 50.4 bits (119), Expect(2) = 5e-07 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG G GGY+GGGG ++GGG GY GGGGG Sbjct: 218 GGSFGGSGGYSGGGGGYSGGGNGYSGGGGGG 248 Score = 29.3 bits (64), Expect(2) = 5e-07 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GG GGG S G G Sbjct: 244 GGGGGYSGGNGGGYSGGGNGGGYSG 268 Score = 50.8 bits (120), Expect(2) = 6e-07 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 4/35 (11%) Frame = +2 Query: 74 GGYHNGG--GGYNGG--GGYHNGGGGGYHNGGGGG 166 GGY GG GGY+GG GGY GGGGGY GGGGG Sbjct: 255 GGYSGGGNGGGYSGGNGGGYSGGGGGGYSGGGGGG 289 Score = 28.5 bits (62), Expect(2) = 6e-07 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTS 227 GGGGG GG GGG+S S Sbjct: 321 GGGGGYSGGGGGGQSYAS 338 Score = 48.9 bits (115), Expect(2) = 4e-06 Identities = 21/33 (63%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = +2 Query: 74 GGYHNGGGGYN--GGGGYHNGGGGGYHNGGGGG 166 GGY GG GY+ GGGGY G GGGY GG GG Sbjct: 232 GGYSGGGNGYSGGGGGGYSGGNGGGYSGGGNGG 264 Score = 27.7 bits (60), Expect(2) = 4e-06 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 174 GGG--GGGGGGRGGGRSRTSGSPG 239 GGG GGGGGG GG + SG G Sbjct: 279 GGGYSGGGGGGYSGGGNGYSGGGG 302 Score = 48.5 bits (114), Expect(2) = 6e-06 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 74 GGYHNG-GGGYNGGG---GYHNGGGGGYHNGGGGG 166 GGY G GGGY+GGG GY G GGGY GGGGG Sbjct: 247 GGYSGGNGGGYSGGGNGGGYSGGNGGGYSGGGGGG 281 Score = 27.3 bits (59), Expect(2) = 6e-06 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 G GGGGGG GG SG G Sbjct: 296 GYSGGGGGGYSGGNGGYSGGNG 317 [227][TOP] >UniRef100_P22509 rRNA 2'-O-methyltransferase fibrillarin n=1 Tax=Rattus norvegicus RepID=FBRL_RAT Length = 327 Score = 47.0 bits (110), Expect(2) = 1e-07 Identities = 22/45 (48%), Positives = 26/45 (57%) Frame = +2 Query: 32 YGFRGRRYR*ARYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 +G RG R RGG+ G GG+ GGG GGGGG+ GGGG Sbjct: 18 FGDRGGRGGGRGGRGGFGGGRGGFGGGGRGRGGGGGGFRGRGGGG 62 Score = 35.0 bits (79), Expect(2) = 1e-07 Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +3 Query: 171 RGGGGGGGGG--RGGGRSRTSGSPGLQGKPVCLERVKDGMVSSAKH 302 RGGGGG GGG GGGR R G G +G + K+ MV +H Sbjct: 58 RGGGGGRGGGFQSGGGRGRGGGRGGKRGN----QSGKNVMVEPHRH 99 [228][TOP] >UniRef100_UPI0001B58635 hypothetical protein StAA4_25414 n=1 Tax=Streptomyces sp. AA4 RepID=UPI0001B58635 Length = 326 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP+ PPPPP+ PPPP+ PPP+ PP Sbjct: 254 PPPPPVTAPPPPPVSPPPPPVTQPPPVSSPP 284 Score = 34.7 bits (78), Expect(2) = 1e-07 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 235 GDPLVLERPPPRPPPPPPPPP 173 GD + PPP PPPPPPP P Sbjct: 232 GDSNTPKPPPPPPPPPPPPTP 252 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPP--L*PPPPL**PP 73 PPPPP PPPPP+ PPPP PPPP+ PP Sbjct: 246 PPPPPTPPPPPPPVTAPPPPPVSPPPPPVTQPP 278 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 271 TLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 T+ ++G P P + P+PPPPPPPPP Sbjct: 215 TVHVNSGTTTPPPTPGGGDSNTPKPPPPPPPPP 247 [229][TOP] >UniRef100_A0NCZ0 AGAP001055-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A0NCZ0_ANOGA Length = 208 Score = 45.4 bits (106), Expect(2) = 1e-07 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG ++GGGG GGGG GGGGG GGGGG Sbjct: 18 GGGNSGGGGGGGGGGGGGGGGGGGGGGGGGG 48 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G PG Sbjct: 78 GGGGGGGGGGGGGGGGGGGGPG 99 Score = 44.7 bits (104), Expect(2) = 5e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 19 GGNSGGGGGGGGGGGGGGGGGGGGGGGGGGG 49 Score = 35.0 bits (79), Expect(2) = 5e-07 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKP 254 GGGGGGGGG GGG G G G P Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGGP 98 Score = 43.9 bits (102), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 35.0 bits (79), Expect(2) = 8e-07 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRT 224 GGGGGGGGG GGG+ RT Sbjct: 118 GGGGGGGGGGGGGQIRT 134 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = +2 Query: 65 RYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 R GG N GGG GGGG GGGGG GGGGG Sbjct: 14 RVVGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGG 47 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGK 251 GGGGGGGGG GGG G G +G+ Sbjct: 84 GGGGGGGGGGGGGGPGGGGWGGWRGR 109 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 53 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 25 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGPG 99 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 76 GGGGGGGGGGGGGGGGGGGGGGPGG 100 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGGGGG GGG G G G Sbjct: 81 GGGGGGGGGGGGGGGGGPGGGGWGG 105 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 30 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 31 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 43.9 bits (102), Expect(2) = 3e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGG 69 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGG 70 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGG 71 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGG 72 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGG 73 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGG 74 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGG 75 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGG 76 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGG 77 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGG 78 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGG 79 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGG 80 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGG 81 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 61 GGGGGGGGGGGGGGGGGGGGGG 82 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGG 84 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGG 85 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGG 88 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGG 89 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGG 91 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGGGGGG GGG G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGG 92 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 32.3 bits (72), Expect(2) = 5e-06 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGG GGGG GG R R +G G Sbjct: 94 GGGGPGGGGWGGWRGRGAGGGG 115 Score = 43.9 bits (102), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 43.9 bits (102), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 43.9 bits (102), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 43.9 bits (102), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 43.9 bits (102), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 43.9 bits (102), Expect(2) = 9e-06 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG GGGG GGGG GGGGG GGGGG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 31.6 bits (70), Expect(2) = 9e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGGGGGGG GGG Sbjct: 112 GGGGGGGGGGGGG 124 Score = 31.6 bits (70), Expect(2) = 9e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGGGGGGG GGG Sbjct: 113 GGGGGGGGGGGGG 125 Score = 31.6 bits (70), Expect(2) = 9e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGGGGGGG GGG Sbjct: 114 GGGGGGGGGGGGG 126 Score = 31.6 bits (70), Expect(2) = 9e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGGGGGGG GGG Sbjct: 115 GGGGGGGGGGGGG 127 Score = 31.6 bits (70), Expect(2) = 9e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGGGGGGG GGG Sbjct: 116 GGGGGGGGGGGGG 128 Score = 31.6 bits (70), Expect(2) = 9e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGGGGGGG GGG Sbjct: 117 GGGGGGGGGGGGG 129 [230][TOP] >UniRef100_B3MW45 GF22329 n=1 Tax=Drosophila ananassae RepID=B3MW45_DROAN Length = 207 Score = 51.2 bits (121), Expect(2) = 1e-07 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 68 YRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 Y GG GGGGY GGGG H GGGGG G GGG Sbjct: 45 YGGGGGQGGGGYGGGGGKHGGGGGGGQGGYGGG 77 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +2 Query: 71 RGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 +GGY GGGG GGGGY GGGGG H GGGGG Sbjct: 42 QGGY--GGGGGQGGGGY--GGGGGKHGGGGGG 69 Score = 34.3 bits (77), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGGG GG GGG + G G QG Sbjct: 65 GGGGGGQGGYGGGGGKHGGGGGGQG 89 Score = 30.8 bits (68), Expect(2) = 1e-07 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GG GGG+ G G QG Sbjct: 75 GGGGGKHGGGGGGQGGYGGGGGGQG 99 Score = 48.1 bits (113), Expect(2) = 2e-06 Identities = 23/39 (58%), Positives = 25/39 (64%), Gaps = 7/39 (17%) Frame = +2 Query: 74 GGYHNGGGG-----YNGGGGYHNGGGGGY--HNGGGGGE 169 GG H GGGG Y GGGG H GGGGG + GGGGG+ Sbjct: 60 GGKHGGGGGGGQGGYGGGGGKHGGGGGGQGGYGGGGGGQ 98 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Frame = +3 Query: 174 GGGGGG----GGGRGGGRSRTSGSPG 239 GGGGGG GGG GGG +G+ G Sbjct: 92 GGGGGGQGGYGGGGGGGSKSLAGNRG 117 Score = 46.2 bits (108), Expect(2) = 4e-06 Identities = 21/35 (60%), Positives = 23/35 (65%), Gaps = 3/35 (8%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHN---GGGGGYHNGGGGGE 169 GGY GGG + GGGG GGGGG H GGGGG+ Sbjct: 54 GGYGGGGGKHGGGGGGGQGGYGGGGGKHGGGGGGQ 88 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPG 239 + GGGGGG GG GGG G G Sbjct: 80 KHGGGGGGQGGYGGGGGGQGGYGG 103 [231][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 21/36 (58%), Positives = 21/36 (58%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAY 58 PPPPP PPPPP PPPP PPPP PP Y Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPGY 119 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 226 LVLERPPPRPPPPPPPPP 173 ++L PPP PPPPPPPPP Sbjct: 68 VILTPPPPPPPPPPPPPP 85 [232][TOP] >UniRef100_Q1XG61 Putative glycine-rich RNA binding protein n=1 Tax=Cryptomeria japonica RepID=Q1XG61_CRYJA Length = 181 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGGGYHNGGG--GGYHNGGGGGEERRR 181 A+ RGG GGGG GGGGY GGG GGY GG GG E RR Sbjct: 84 AQARGG---GGGGGGGGGGYRGGGGGSGGYGGGGSGGYESRR 122 Score = 32.7 bits (73), Expect(2) = 1e-07 Identities = 16/28 (57%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +3 Query: 162 EERRGGGGGGGGG--RGGGRSRTSGSPG 239 E RR GGGG GGG GGGR R+ G Sbjct: 119 ESRRSGGGGSGGGGYSGGGRERSERGYG 146 [233][TOP] >UniRef100_Q8LPB1 Glycine-rich RNA-binding protein n=1 Tax=Physcomitrella patens RepID=Q8LPB1_PHYPA Length = 178 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = +2 Query: 74 GGYHN--GGGGYNGGGGYHNGGGGGYHNGGGG 163 GGY+N GGGG GGGGY GGGGGY GGGG Sbjct: 94 GGYNNRQGGGGGYGGGGYGGGGGGGYGAGGGG 125 Score = 32.0 bits (71), Expect(2) = 1e-07 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 165 ERRGGGGGG-GGGRGGGRSRTSGSPG 239 +R GGGGGG GG RGGG + G G Sbjct: 134 DREGGGGGGYGGSRGGGGYGSGGGGG 159 [234][TOP] >UniRef100_Q6ASX7 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ASX7_ORYSJ Length = 162 Score = 48.1 bits (113), Expect(2) = 1e-07 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGGGYHNG--GGGGYHNGGGGGEERR 178 +R GG GGGGY GGGG + G GGGGY GGGGG RR Sbjct: 86 SRRSGG---GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRR 123 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG GS G Sbjct: 128 GGGGGYGGGRGGGGGGYGGSRG 149 [235][TOP] >UniRef100_O22384 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22384_ORYSA Length = 162 Score = 48.1 bits (113), Expect(2) = 1e-07 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +2 Query: 62 ARYRGGYHNGGGGYNGGGGYHNG--GGGGYHNGGGGGEERR 178 +R GG GGGGY GGGG + G GGGGY GGGGG RR Sbjct: 86 SRRSGG---GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRR 123 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG GS G Sbjct: 128 GGGGGYGGGRGGGGGGYGGSRG 149 [236][TOP] >UniRef100_UPI0001745B20 RNA-binding region RNP-1 n=1 Tax=Verrucomicrobium spinosum DSM 4136 RepID=UPI0001745B20 Length = 150 Score = 51.6 bits (122), Expect(2) = 1e-07 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 74 GGYHNGGGG---YNGGGGYHNGGGGGYHNGGGGGEERR 178 GGY GGGG GGGGY GGGGGY GGGG +RR Sbjct: 93 GGYSGGGGGGGRKGGGGGYGGGGGGGYGGGGGGRGDRR 130 Score = 30.4 bits (67), Expect(2) = 1e-07 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +3 Query: 165 ERRGGGGGGGGGRGGG 212 +RR GGGGGG G GGG Sbjct: 128 DRRSGGGGGGYGGGGG 143 [237][TOP] >UniRef100_B4JKF1 GH12063 n=1 Tax=Drosophila grimshawi RepID=B4JKF1_DROGR Length = 143 Score = 46.2 bits (108), Expect(2) = 1e-07 Identities = 20/34 (58%), Positives = 22/34 (64%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEER 175 GGY GGGG GGGG H GG GG GG GG ++ Sbjct: 29 GGYGGGGGGGYGGGGGHGGGAGGGKGGGHGGWQK 62 Score = 35.8 bits (81), Expect(2) = 1e-07 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +3 Query: 168 RRGGGGGGGGGRGGGRSRTSGSPGLQG 248 ++GGGGGGGGG GGG + G G G Sbjct: 61 QKGGGGGGGGGGGGGWQKGGGGGGGYG 87 Score = 43.1 bits (100), Expect(2) = 6e-06 Identities = 19/32 (59%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGG-GGYHNGGGGG 166 GG + GGGG+ GG G GGG GG+ GGGGG Sbjct: 36 GGGYGGGGGHGGGAGGGKGGGHGGWQKGGGGG 67 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 165 ERRGGGGGGGGGRGGGRSRTSGSPGLQG 248 ++ GGGGGGGGG GG + G G G Sbjct: 61 QKGGGGGGGGGGGGGWQKGGGGGGGYGG 88 [238][TOP] >UniRef100_C6NAI9 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Pectobacterium wasabiae WPP163 RepID=C6NAI9_9ENTR Length = 1043 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +1 Query: 772 SLAVVLQRRDWXNPGVTQLNRLAAHPPFAQLAYSEEARTDRPSQQLRSLNGEWK 933 +L +L RRDW NP T RL AHPPF A+ D PSQ+LR +NGEWK Sbjct: 15 TLQEILARRDWENPACTNYQRLPAHPPFNSWRSITAAQQDEPSQRLRRMNGEWK 68 [239][TOP] >UniRef100_Q7Y087 GBR5 n=1 Tax=Panax ginseng RepID=Q7Y087_PANGI Length = 123 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 4/37 (10%) Frame = +2 Query: 68 YRGGYHNGGGGYNGGGGYHNG----GGGGYHNGGGGG 166 Y GG ++GGGGY+GGGGYH G GGGGYH GGG G Sbjct: 55 YGGGGYHGGGGYHGGGGYHGGGGYHGGGGYHGGGGHG 91 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSR 221 GGGG GGGG G R Sbjct: 86 GGGGHGGGGCSHGYCR 101 [240][TOP] >UniRef100_B4PLK3 GE24060 n=1 Tax=Drosophila yakuba RepID=B4PLK3_DROYA Length = 116 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 86 NGGGGYNGGGGYHNGGGGGYHNGGGGGEERR 178 NGG G GGGGY NGGGGGY+ GGGGG RR Sbjct: 46 NGGRGGGGGGGY-NGGGGGYNGGGGGGGGRR 75 Score = 32.0 bits (71), Expect(2) = 1e-07 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSG 230 GGGGGGGGG GGG G Sbjct: 90 GGGGGGGGGYGGGDGYDDG 108 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%), Gaps = 8/39 (20%) Frame = +2 Query: 74 GGYHNGGGGYNGGGG--------YHNGGGGGYHNGGGGG 166 GGY+ GGGGYNGGGG Y G GY NGGGGG Sbjct: 55 GGYNGGGGGYNGGGGGGGGRRPVYSGNFGPGYSNGGGGG 93 Score = 28.1 bits (61), Expect(2) = 2e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 Query: 174 GGGGGGGGGRGGG 212 GGGGGGGGG GG Sbjct: 89 GGGGGGGGGGYGG 101 [241][TOP] >UniRef100_A9URA4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9URA4_MONBE Length = 1593 Score = 42.4 bits (98), Expect(2) = 1e-07 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -1 Query: 277 SFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 S +++ H L +P + VL PPP PPPPPPPPP Sbjct: 979 SSSINTHPPLTSTPSE--VLPSPPPAPPPPPPPPP 1011 Score = 39.3 bits (90), Expect(2) = 1e-07 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPP 88 +PPPPP PPPP + PPPL PPPP Sbjct: 1033 APPPPP---PPPPGIPGAPPPLPPPPP 1056 Score = 38.9 bits (89), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P + PPP PPPPPPPPP Sbjct: 1036 PPPPPPPGIPGAPPPLPPPPPPPPP 1060 Score = 38.9 bits (89), Expect(2) = 2e-06 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPP + PPPL PPPP Sbjct: 1052 PPPPP---PPPPGIPGAPPPLPPPPP 1074 [242][TOP] >UniRef100_UPI0001757FBF PREDICTED: similar to T19B10.5 n=1 Tax=Tribolium castaneum RepID=UPI0001757FBF Length = 1588 Score = 52.0 bits (123), Expect(2) = 1e-07 Identities = 22/33 (66%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGG--GGGYHNGGGGG 166 GG H+GGGG+ GGGG+H GG GGGY G GGG Sbjct: 1533 GGGHHGGGGFGGGGGHHGGGGFGGGYGGGHGGG 1565 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGG GGG G G Sbjct: 1563 GGGGGFGGGFGGGHGGGGGHHG 1584 Score = 48.5 bits (114), Expect(2) = 6e-07 Identities = 24/47 (51%), Positives = 28/47 (59%), Gaps = 14/47 (29%) Frame = +2 Query: 68 YRGGY--HNGGGGYNGGGGY------------HNGGGGGYHNGGGGG 166 + GG+ H+GGGGY GGGG H+GGGGGY GGGGG Sbjct: 1368 FGGGHDDHHGGGGYGGGGGGGFGGGFGGGHDDHHGGGGGYGGGGGGG 1414 Score = 30.8 bits (68), Expect(2) = 6e-07 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GGG GGG G G G Sbjct: 1410 GGGGGFGGGFGGGHDDHHGGGGYGG 1434 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 5/36 (13%) Frame = +2 Query: 74 GGYHNGGGGYNGGGG-----YHNGGGGGYHNGGGGG 166 GG H GGGG+ GG G +H+GGGGG+ G GGG Sbjct: 1252 GGGHGGGGGFGGGFGGGHDDHHHGGGGGFGGGFGGG 1287 Score = 32.7 bits (73), Expect(2) = 1e-06 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 162 EERRGGGGGGGGGRGGGRSRTSGSPGLQG 248 ++ GGGG GGGG GGG G G G Sbjct: 1293 DDHHGGGGFGGGGFGGGHDDHHGGGGFGG 1321 Score = 46.6 bits (109), Expect(2) = 4e-06 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 8/41 (19%) Frame = +2 Query: 68 YRGGY--HNGGGGYNGGGGY------HNGGGGGYHNGGGGG 166 + GG+ H+GGGG+ GGGG+ H+GGGGG+ G GGG Sbjct: 1327 FGGGHDDHHGGGGFGGGGGFGGGHDDHHGGGGGFGGGFGGG 1367 Score = 46.6 bits (109), Expect(2) = 4e-06 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = +2 Query: 68 YRGGY--HNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 + GG+ H+GGGGY GGGG GGG H+GGGGG Sbjct: 1444 FGGGHDDHHGGGGYGGGGGGGFGGGHDDHHGGGGG 1478 Score = 30.0 bits (66), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQG 248 GGGGG GGG GGG G G G Sbjct: 1384 GGGGGFGGGFGGGHDDHHGGGGGYG 1408 Score = 30.0 bits (66), Expect(2) = 4e-06 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Frame = +3 Query: 162 EERRGGGGGG-----GGGRGGGRSRTSGSPGLQG 248 ++ GGGGGG GGG GGG G G G Sbjct: 1470 DDHHGGGGGGFGGGFGGGFGGGHDDHHGGGGFGG 1503 [243][TOP] >UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLU7_RICCO Length = 1550 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 24/53 (45%), Positives = 29/53 (54%) Frame = -1 Query: 316 SVRQRCLALETIPSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPPLLSSS 158 ++ C +L+TIP PC P P PPP PPPPPPPPPL SS+ Sbjct: 673 AISPTCTSLKTIP----------PCPPPAP---PPPPPSPPPPPPPPPLSSST 712 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 20/44 (45%), Positives = 22/44 (50%), Gaps = 12/44 (27%) Frame = -2 Query: 180 LLLSSPPPPPLW*PPPPPL------------W*PPPPL*PPPPL 85 +L +PPPPP PPPPPL PP P PPPPL Sbjct: 717 ILGKAPPPPPP--PPPPPLSSRQNIEIIPYHASPPAPPPPPPPL 758 Score = 40.8 bits (94), Expect(2) = 6e-07 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL 85 PPPPPL PPPPL PPP PPP L Sbjct: 912 PPPPPLRATPPPPLQGSPPPPPPPPQL 938 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = -1 Query: 280 PSFTLSKHTGLP----CSPGDPLVLERPPPRPPPPPPPPPLLSSS 158 P+ S G P +P P PPP PPPPPPPPP L ++ Sbjct: 876 PTTPSSSARGTPPPPRAAPPPPPSRAAPPPPPPPPPPPPPPLRAT 920 Score = 39.7 bits (91), Expect(2) = 3e-06 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -1 Query: 229 PLVLERPPPRPPPPPPPPPLLSSSSTI 149 P + PP PPPPPPPPP L ++ST+ Sbjct: 786 PASVSSAPPLPPPPPPPPPPLVNASTV 812 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 20/36 (55%), Positives = 21/36 (58%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRA 61 +PPPP PPPP PPPP PPPP PP RA Sbjct: 886 TPPPPRAAPPPPPSRAAPPPPPPPPPPP--PPPLRA 919 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P+ PPRPPPPPPPPP Sbjct: 826 PPPPPPPMGGTMLPPRPPPPPPPPP 850 Score = 37.4 bits (85), Expect(2) = 3e-06 Identities = 22/52 (42%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW------*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 ++PPPPP PPPP+ PPPP PPPP PP Y P P Sbjct: 822 TAPPPPP----PPPPMGGTMLPPRPPPPPPPPPP---PPSYPYQGVHSPPPP 866 [244][TOP] >UniRef100_UPI0001B7A53E UPI0001B7A53E related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7A53E Length = 1391 Score = 49.7 bits (117), Expect(2) = 1e-07 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 74 GGYHNGGGGYNGGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGG+ GGG GGGGG+ GGGGG Sbjct: 1222 GGFGSGGGGFGSGGGGFGGGGGGFSGGGGGG 1252 Score = 32.0 bits (71), Expect(2) = 1e-07 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPG 239 GGGGG GGGRGGG G G Sbjct: 1249 GGGGGFGGGRGGGGGGGFGGSG 1270 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 8/51 (15%) Frame = +2 Query: 35 GFRGRRYR*ARYRGGYHNGG--------GGYNGGGGYHNGGGGGYHNGGGG 163 G+ G Y Y GGY +GG GG GGG+++GGGGG+ +GGGG Sbjct: 1180 GYGGGGYGGGGYGGGYGSGGFGGGFGSGGGGGFGGGFNSGGGGGFGSGGGG 1230 Score = 30.8 bits (68), Expect(2) = 2e-06 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 Query: 171 RGGGGGGGGGRGGGRSRTSGSPGLQG 248 RGGGGGGG G GG G G+ G Sbjct: 1258 RGGGGGGGFGGSGGFGSGGGGYGVGG 1283 Score = 46.6 bits (109), Expect(2) = 8e-06 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 74 GGYHNGGGGYN-GGGGYHNGGGGGYHNGGGGG 166 GG+ +GGGGY GGGGY GGG G + GG GG Sbjct: 1270 GGFGSGGGGYGVGGGGYGGGGGSGGYGGGSGG 1301 Score = 28.9 bits (63), Expect(2) = 8e-06 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 174 GGGGGGGGGRGGGRSRTSGSPGLQGKP 254 GG GGG GG GGG G G P Sbjct: 1293 GGYGGGSGGYGGGGGGYGGGEGYNMSP 1319 [245][TOP] >UniRef100_Q9GRW7 Protein no-on-transient A n=1 Tax=Drosophila virilis RepID=NONA_DROVI Length = 697 Score = 48.9 bits (115), Expect(2) = 1e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +2 Query: 65 RYRGGYHNGGGGYNGGGGYHNGGGGGYHNGGGGGEERRRRRR 190 R RGG GGGG GGGG GGGGG GGGGG +R RR Sbjct: 193 RARGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNPDRR 232 Score = 32.7 bits (73), Expect(2) = 1e-07 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 165 ERRGGGGGGGGGRGGGRSRTSG 230 +RRGGGGGGG GGG + G Sbjct: 230 DRRGGGGGGGQNSGGGNNSQRG 251 [246][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 22/46 (47%), Positives = 25/46 (54%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRPRNPYD 28 PPPPP PPPPP PPPP PPPP P + + P +P D Sbjct: 252 PPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSPCD 297 Score = 37.7 bits (86), Expect(2) = 1e-07 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P SP P PPP PPPPPPPPP Sbjct: 232 PSSPS-PSPRPPPPPMPPPPPPPPP 255 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP+ PPPPP PPPP PPPP PP Sbjct: 241 PPPPPMPPPPPPP---PPPPPPPPPPPSPPP 268 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P S P P PRPPPPP PPP Sbjct: 225 PPSASSPPSSPSPSPRPPPPPMPPP 249 Score = 39.3 bits (90), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P+ PPP PPPPPPPPP Sbjct: 239 PRPPPPPMPPPPPPPPPPPPPPPPP 263 Score = 38.5 bits (88), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = -2 Query: 171 SSPPPPPLW*PPPPPLW*PPPPL*PPPPL 85 S PPPPP PPPPPL P PP PP+ Sbjct: 265 SPPPPPPPPPPPPPPLLPPLPPFPAKPPM 293 [247][TOP] >UniRef100_B9RS81 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RS81_RICCO Length = 516 Score = 42.7 bits (99), Expect(2) = 1e-07 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = -2 Query: 174 LSSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 L PPPPP + PPPPP + PPP PPP PP Sbjct: 448 LPPPPPPPFYSPPPPPTYQSPPP--SPPPCVNPP 479 Score = 38.9 bits (89), Expect(2) = 1e-07 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -1 Query: 280 PSFTLSKHTGLPCSPGDPLVLERPPPRPPPPPPPPP 173 PS LS P SP P PP PPPPPPPPP Sbjct: 408 PSPPLSSPPPPPFSPPPPPSPPLSPPPPPPPPPPPP 443 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 23/47 (48%), Positives = 24/47 (51%) Frame = -2 Query: 174 LSSPPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRYRAYRYRRPRNP 34 LS PPPPP PPPPP P P PPPP PP Y+ P P Sbjct: 430 LSPPPPPP---PPPPPPSPSPLPPPPPPPFYSPPPPPTYQSPPPSPP 473 Score = 35.4 bits (80), Expect(2) = 3e-06 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 241 SPGDPLVLERPPPRPPPPPPPPPL 170 +P PL PPP PPPPP PPL Sbjct: 407 NPSPPLSSPPPPPFSPPPPPSPPL 430 Score = 39.3 bits (90), Expect(2) = 8e-06 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -2 Query: 171 SSPPPPPLW*PP--PPPLW*PPPPL*PPPPL**PPRYRAYRYRRP 43 S PPPP PP PPP PPPP PPP L PP Y + P Sbjct: 458 SPPPPPTYQSPPPSPPPCVNPPPPPSPPPCLEQPPPAPTYNHIFP 502 Score = 36.2 bits (82), Expect(2) = 8e-06 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPPL 170 P P PL PPP PPPPP P PL Sbjct: 423 PPPPSPPLSPPPPPPPPPPPPSPSPL 448 [248][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 43.9 bits (102), Expect(2) = 1e-07 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -2 Query: 168 SPPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 SPPPPP PPPPP PPPP PPPP PP Sbjct: 242 SPPPPPPPPPPPPP---PPPPPSPPPPSPNPP 270 Score = 37.7 bits (86), Expect(2) = 1e-07 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 229 PLVLERPPPRPPPPPPPPP 173 P+ PPP PPPPPPPPP Sbjct: 219 PVASPSPPPPPPPPPPPPP 237 Score = 43.5 bits (101), Expect(2) = 5e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 235 PPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 36.2 bits (82), Expect(2) = 5e-07 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 211 PPPRPPPPPPPPP 173 PPP PPPPPPPPP Sbjct: 226 PPPPPPPPPPPPP 238 Score = 43.5 bits (101), Expect(2) = 8e-07 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PP 73 PPPPP PPPPP PPPP PPPP PP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 35.4 bits (80), Expect(2) = 8e-07 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 5/30 (16%) Frame = -1 Query: 247 PCSPGDPLVLERP-----PPRPPPPPPPPP 173 P S P +RP PP PPPPPPPPP Sbjct: 207 PVSAPPPPFRDRPVASPSPPPPPPPPPPPP 236 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPP 88 PPPPP PPPPP PPP PPPP Sbjct: 247 PPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 37.7 bits (86), Expect(2) = 3e-06 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P P P PPP PPPPPPPPP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPP 251 [249][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 44.7 bits (104), Expect(2) = 1e-07 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPRY 67 PPPPP PPPPP PPPP PPPP PP + Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPFILPPPF 306 Score = 37.0 bits (84), Expect(2) = 1e-07 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 247 PCSPGDPLVLERPPPRPPPPPPPPP 173 P PGDP P PPPPPPPPP Sbjct: 255 PPPPGDPFQEITGPGPPPPPPPPPP 279 [250][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = -2 Query: 165 PPPPPLW*PPPPPLW*PPPPL*PPPPL**PPR 70 PPPPP PPPPP PPPP PPPP PP+ Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 45 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 220 LERPPPRPPPPPPPPP 173 +E PPP PPPPPPPPP Sbjct: 1 MEPPPPPPPPPPPPPP 16