[UP]
[1][TOP] >UniRef100_Q9C669 Putative uncharacterized protein F28B23.9 n=1 Tax=Arabidopsis thaliana RepID=Q9C669_ARATH Length = 443 Score = 94.4 bits (233), Expect(2) = 7e-21 Identities = 47/80 (58%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPYVYKS PPYVYK P PPPY PPYVYK P PPP Sbjct: 205 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 264 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 265 YVYSSPPPPPYVYKSPPPPP 284 Score = 29.6 bits (65), Expect(2) = 7e-21 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPPYVY+SP Sbjct: 169 PPPPPPYVYQSP 180 Score = 95.9 bits (237), Expect(2) = 2e-20 Identities = 45/70 (64%), Positives = 46/70 (65%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYES---PP 33 YVY P PPPYVYKS PPYVY PP PPPY PPYVY P PPPYVY+S PP Sbjct: 145 YVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPP 204 Query: 32 YVYKPPTPPP 3 YVY P PPP Sbjct: 205 YVYSSPPPPP 214 Score = 95.9 bits (237), Expect(2) = 2e-20 Identities = 47/80 (58%), Positives = 48/80 (60%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY PP PPPYVY+S PPYVYK P PPPY PPYVYK P PPP Sbjct: 165 YVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 224 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 225 YVYSSPPPPPYVYKSPPPPP 244 Score = 26.6 bits (57), Expect(2) = 2e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 100 PPPPPYVYKSP 110 Score = 26.6 bits (57), Expect(2) = 2e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 120 PPPPPYVYKSP 130 Score = 94.4 bits (233), Expect(2) = 8e-20 Identities = 45/70 (64%), Positives = 45/70 (64%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYES---PP 33 YVY P PPPYVYKS PPYVY P PPPY PPYVY P PPPYVY S PP Sbjct: 95 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 154 Query: 32 YVYKPPTPPP 3 YVYK P PPP Sbjct: 155 YVYKSPPPPP 164 Score = 26.2 bits (56), Expect(2) = 8e-20 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY SP Sbjct: 70 PPPPPYVYSSP 80 Score = 99.0 bits (245), Expect = 1e-19 Identities = 44/76 (57%), Positives = 49/76 (64%), Gaps = 8/76 (10%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYE 42 P++ + YVY P+PPPYVYK PPY+Y P PPPY PPYVY P PPPYVY Sbjct: 39 PYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYS 98 Query: 41 S---PPYVYKPPTPPP 3 S PPYVYK P PPP Sbjct: 99 SPPPPPYVYKSPPPPP 114 Score = 92.8 bits (229), Expect(2) = 2e-19 Identities = 44/70 (62%), Positives = 45/70 (64%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYE---SPP 33 YVY P PPPYVYKS PPYVY P PPPY PPYVYK P PPPYVY PP Sbjct: 115 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Query: 32 YVYKPPTPPP 3 YVY+ P PPP Sbjct: 175 YVYQSPPPPP 184 Score = 92.4 bits (228), Expect(2) = 2e-19 Identities = 44/70 (62%), Positives = 44/70 (62%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYES---PP 33 YVY P PPPYVYKS PPYVY P PPPY PPYVY P PPPYVY S PP Sbjct: 245 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 304 Query: 32 YVYKPPTPPP 3 YVY P PPP Sbjct: 305 YVYSSPPPPP 314 Score = 92.4 bits (228), Expect(2) = 2e-19 Identities = 44/70 (62%), Positives = 45/70 (64%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYES---PP 33 YVY P PPPYVYKS PPYVY P PPPY PPYVY P PPPYVY+S PP Sbjct: 265 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP 324 Query: 32 YVYKPPTPPP 3 YVY P PPP Sbjct: 325 YVYTSPPPPP 334 Score = 26.6 bits (57), Expect(2) = 2e-19 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 210 PPPPPYVYKSP 220 Score = 26.6 bits (57), Expect(2) = 2e-19 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 230 PPPPPYVYKSP 240 Score = 26.2 bits (56), Expect(2) = 2e-19 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY SP Sbjct: 80 PPPPPYVYNSP 90 Score = 90.9 bits (224), Expect(2) = 1e-18 Identities = 43/70 (61%), Positives = 44/70 (62%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYES---PP 33 YVY P PPPYVY S PPYVY P PPPY PPYVY P PPPYVY+S PP Sbjct: 75 YVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 134 Query: 32 YVYKPPTPPP 3 YVY P PPP Sbjct: 135 YVYSSPPPPP 144 Score = 25.4 bits (54), Expect(2) = 1e-18 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P+PPPYVY+ P Sbjct: 53 PSPPPYVYKPP 63 Score = 86.7 bits (213), Expect(2) = 1e-17 Identities = 42/65 (64%), Positives = 42/65 (64%), Gaps = 6/65 (9%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPPPYESPPYVYKPPTPPPYVYES---PPYVYKP 18 YVY P PPPYVY S PPYVY P P PPYVYK P PPPYVY S PPYVYK Sbjct: 285 YVYSSPPPPPYVYSSPPPPPYVYSSPPP-----PPYVYKSPPPPPYVYTSPPPPPYVYKS 339 Query: 17 PTPPP 3 P PPP Sbjct: 340 PPPPP 344 Score = 26.6 bits (57), Expect(2) = 1e-17 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 250 PPPPPYVYKSP 260 Score = 85.9 bits (211), Expect(2) = 2e-17 Identities = 45/75 (60%), Positives = 47/75 (62%), Gaps = 16/75 (21%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPPPY-----ESPPYV--YKPPTPPPYVYESPPY 30 YVY P PPPYVYKS PPYVY P PPPY PPYV Y PP P PYVY+ PPY Sbjct: 305 YVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPP-PAPYVYKPPPY 363 Query: 29 VYKPP------TPPP 3 VYKPP +PPP Sbjct: 364 VYKPPPYVYNYSPPP 378 Score = 26.6 bits (57), Expect(2) = 2e-17 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 270 PPPPPYVYKSP 280 Score = 80.5 bits (197), Expect(2) = 8e-16 Identities = 46/99 (46%), Positives = 50/99 (50%), Gaps = 40/99 (40%) Frame = -3 Query: 179 YVYKPPTPPPYV-----------YKSPPYVYKPP------TPPP----YESP-------- 87 YVYK P PPPYV YK PPYVYKPP +PPP Y+ P Sbjct: 335 YVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVYKPPPYVYSYSP 394 Query: 86 ---PYVYKP--------PTPPPYVYESPPYVYKPPTPPP 3 PYVYKP P P PYVY+ PPYVY P+PPP Sbjct: 395 PPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPP 433 Score = 26.6 bits (57), Expect(2) = 8e-16 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 310 PPPPPYVYKSP 320 Score = 84.3 bits (207), Expect = 4e-15 Identities = 42/68 (61%), Positives = 45/68 (66%), Gaps = 11/68 (16%) Frame = -3 Query: 173 YKP-PTP----PPYVYKSPP-YVYKPPTPPP--YESPPYVYKPPTPPPYVYES---PPYV 27 Y P PTP PPYVY SPP YVY P+PPP Y+ PPY+Y P PPPYVY S PPYV Sbjct: 27 YSPTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYV 86 Query: 26 YKPPTPPP 3 Y P PPP Sbjct: 87 YNSPPPPP 94 Score = 69.7 bits (169), Expect(2) = 1e-12 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPT--------PPPYVYKSPPYVYK---PPTPPPYESPPYVYKPPTPPPYVYESPP 33 YVYKPP P PYVYK PPYVY PP P Y+ PPYVY P+PPPY Sbjct: 381 YVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPPY------ 434 Query: 32 YVYKPPTPP 6 Y P+PP Sbjct: 435 --YSSPSPP 441 Score = 26.6 bits (57), Expect(2) = 1e-12 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 330 PPPPPYVYKSP 340 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 27/51 (52%), Positives = 29/51 (56%), Gaps = 8/51 (15%) Frame = -3 Query: 179 YVYKPPT--------PPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPY 51 YVYKPP P PYVYK PPYVY P+PPPY Y P+PP Y Sbjct: 399 YVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPPY------YSSPSPPLY 443 Score = 22.3 bits (46), Expect(2) = 2e-07 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY+ P Sbjct: 360 PPPYVYKPP 368 [2][TOP] >UniRef100_Q9C668 Putative uncharacterized protein F28B23.10 n=1 Tax=Arabidopsis thaliana RepID=Q9C668_ARATH Length = 478 Score = 97.1 bits (240), Expect(2) = 3e-20 Identities = 47/78 (60%), Positives = 50/78 (64%), Gaps = 18/78 (23%) Frame = -3 Query: 182 SYVYKPPT-------PPPYVYKS---PPYVYKPPTPPPY-----ESPPYVYKPPTPPPYV 48 SYVYKPPT PPPYVY S PPY+YK P PPPY PPY+YK P PPPYV Sbjct: 37 SYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYV 96 Query: 47 YES---PPYVYKPPTPPP 3 Y S PPY+YK P PPP Sbjct: 97 YSSPPPPPYIYKSPPPPP 114 Score = 25.0 bits (53), Expect(2) = 3e-20 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PP YVY+ P Sbjct: 32 PPSPPSYVYKPP 43 Score = 95.1 bits (235), Expect(2) = 3e-20 Identities = 47/80 (58%), Positives = 48/80 (60%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPYVYKS PPYVYK P PPPY PPYVYK P PPP Sbjct: 375 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 434 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P+PPP Sbjct: 435 YVYSSPPPPPYVYKSPSPPP 454 Score = 26.6 bits (57), Expect(2) = 3e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 340 PPPPPYVYKSP 350 Score = 94.4 bits (233), Expect(2) = 6e-20 Identities = 47/80 (58%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPYVYKS PPYVYK P PPPY PPYVYK P PPP Sbjct: 135 YVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 194 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 195 YVYSSPPPPPYVYKSPPPPP 214 Score = 94.4 bits (233), Expect(2) = 6e-20 Identities = 47/80 (58%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPYVYKS PPYVYK P PPPY PPYVYK P PPP Sbjct: 175 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 234 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 235 YVYSSPPPPPYVYKSPPPPP 254 Score = 94.4 bits (233), Expect(2) = 6e-20 Identities = 47/80 (58%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPYVYKS PPYVYK P PPPY PPYVYK P PPP Sbjct: 215 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 274 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 275 YVYSSPPPPPYVYKSPPPPP 294 Score = 94.4 bits (233), Expect(2) = 6e-20 Identities = 47/80 (58%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPYVYKS PPYVYK P PPPY PPYVYK P PPP Sbjct: 255 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 314 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 315 YVYSSPPPPPYVYKSPPPPP 334 Score = 94.4 bits (233), Expect(2) = 6e-20 Identities = 47/80 (58%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPYVYKS PPYVYK P PPPY PPYVYK P PPP Sbjct: 295 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 354 Query: 53 YVYESP---PYVYKPPTPPP 3 YVY SP PYVYK P PPP Sbjct: 355 YVYSSPPPSPYVYKSPPPPP 374 Score = 94.4 bits (233), Expect(2) = 6e-20 Identities = 47/80 (58%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSP-------------PYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPYVYKSP PYVYK P PPPY PPYVYK P PPP Sbjct: 335 YVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 394 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 395 YVYSSPPPPPYVYKSPPPPP 414 Score = 26.6 bits (57), Expect(2) = 6e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 120 PPPPPYVYKSP 130 Score = 26.6 bits (57), Expect(2) = 6e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 140 PPPPPYVYKSP 150 Score = 26.6 bits (57), Expect(2) = 6e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 180 PPPPPYVYKSP 190 Score = 26.6 bits (57), Expect(2) = 6e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 220 PPPPPYVYKSP 230 Score = 26.6 bits (57), Expect(2) = 6e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 260 PPPPPYVYKSP 270 Score = 26.6 bits (57), Expect(2) = 6e-20 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 300 PPPPPYVYKSP 310 Score = 94.0 bits (232), Expect(2) = 1e-19 Identities = 46/80 (57%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPY+YKS PPYVYK P PPPY PPYVYK P PPP Sbjct: 95 YVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPP 154 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 155 YVYSSPPPPPYVYKSPPPPP 174 Score = 26.2 bits (56), Expect(2) = 1e-19 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY SP Sbjct: 50 PPPPPYVYSSP 60 Score = 91.7 bits (226), Expect(2) = 4e-19 Identities = 44/71 (61%), Positives = 47/71 (66%), Gaps = 12/71 (16%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPY-----ESPPYVYKPPTPPPYVYESPP--- 33 YVYK P PPPYVY SPP YVYK P PPPY PPYVYK P+PPPYVY+SPP Sbjct: 405 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Query: 32 -YVYKPPTPPP 3 Y Y +PPP Sbjct: 465 SYSYSYSSPPP 475 Score = 26.6 bits (57), Expect(2) = 4e-19 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 380 PPPPPYVYKSP 390 Score = 93.2 bits (230), Expect = 8e-18 Identities = 44/80 (55%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPPY-----ESPPYVYKPPTPPP 54 YVY P PPPY+YKS PPY+YK P PPPY PPY+YK P PPP Sbjct: 55 YVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPP 114 Query: 53 YVYES---PPYVYKPPTPPP 3 YVY S PPYVYK P PPP Sbjct: 115 YVYSSPPPPPYVYKSPPPPP 134 Score = 92.8 bits (229), Expect = 1e-17 Identities = 39/67 (58%), Positives = 44/67 (65%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYES---PPYVY 24 Y Y PP+PP YVYK P ++Y P PPPY PPY+YK P PPPYVY S PPY+Y Sbjct: 28 YTYSPPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIY 87 Query: 23 KPPTPPP 3 K P PPP Sbjct: 88 KSPPPPP 94 Score = 65.1 bits (157), Expect(2) = 3e-11 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 9/54 (16%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPY--ESPP----YVYKPPTPPPYVY 45 YVYK P PPPYVY SPP YVYK P+PPPY +SPP Y Y +PPP +Y Sbjct: 425 YVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPPIY 478 Score = 26.6 bits (57), Expect(2) = 3e-11 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 400 PPPPPYVYKSP 410 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/52 (51%), Positives = 33/52 (63%), Gaps = 5/52 (9%) Frame = -3 Query: 143 YKSPPYVYKPPTPPP--YESPPYVYKPPTPPPYVYES---PPYVYKPPTPPP 3 + S Y Y PP+PP Y+ P ++Y P PPPYVY S PPY+YK P PPP Sbjct: 23 HTSAQYTYSPPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPP 74 [3][TOP] >UniRef100_Q9STN0 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9STN0_ARATH Length = 437 Score = 87.4 bits (215), Expect(2) = 3e-17 Identities = 39/66 (59%), Positives = 43/66 (65%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYV 27 P++ + Y Y PP P PYVYKSPPYVY P P Y PPY Y PP P PYVY+SPPYV Sbjct: 172 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPYAYSPP-PSPYVYKSPPYV 229 Query: 26 YKPPTP 9 Y P P Sbjct: 230 YSSPPP 235 Score = 24.3 bits (51), Expect(2) = 3e-17 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPPYVY SP Sbjct: 138 SPPPYVYSSP 147 Score = 81.3 bits (199), Expect(2) = 5e-17 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 16/82 (19%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYK------ 72 P++ + Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY Sbjct: 37 PYVYSSPPPYTYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 95 Query: 71 -PPTPPPYVYESPPYVYKPPTP 9 P P PYVY+SPPYVY P P Sbjct: 96 YSPPPSPYVYKSPPYVYSSPPP 117 Score = 29.6 bits (65), Expect(2) = 5e-17 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PPPYVY SP Sbjct: 32 PPSPPPYVYSSP 43 Score = 87.0 bits (214), Expect(2) = 7e-17 Identities = 43/78 (55%), Positives = 47/78 (60%), Gaps = 10/78 (12%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP-------TPPPYV 48 P++ + Y Y PP P PYVYKSPPYVY P P Y PPY Y PP PPPYV Sbjct: 347 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYV 405 Query: 47 YES-PPYVYKPP--TPPP 3 Y S PPYVY PP +PPP Sbjct: 406 YSSPPPYVYNPPPSSPPP 423 Score = 23.5 bits (49), Expect(2) = 7e-17 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 312 PPPSPYVYKSP 322 Score = 84.0 bits (206), Expect(2) = 6e-16 Identities = 40/77 (51%), Positives = 46/77 (59%), Gaps = 9/77 (11%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYKPPTPPP 54 P++ + Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY +PPP Sbjct: 323 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYS--SPPP 379 Query: 53 YVYESPPYVYKPPTPPP 3 Y Y PPY Y PP P P Sbjct: 380 YTYSPPPYAYSPPPPCP 396 Score = 23.5 bits (49), Expect(2) = 6e-16 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 288 PPPSPYVYKSP 298 Score = 83.6 bits (205), Expect(2) = 8e-16 Identities = 41/74 (55%), Positives = 46/74 (62%), Gaps = 8/74 (10%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPP------TPPP--YESPPYVYKPPTPPPY 51 P++ + Y Y PP P PYVYKSPPYVY P +PPP Y PPY Y PP P PY Sbjct: 109 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPYAYSPP-PSPY 166 Query: 50 VYESPPYVYKPPTP 9 VY+SPPYVY P P Sbjct: 167 VYKSPPYVYSSPPP 180 Score = 23.5 bits (49), Expect(2) = 8e-16 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 74 PPPSPYVYKSP 84 Score = 82.8 bits (203), Expect(2) = 1e-15 Identities = 40/82 (48%), Positives = 46/82 (56%), Gaps = 15/82 (18%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYKPP---- 66 P++ + Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY P Sbjct: 85 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYV 143 Query: 65 --TPPPYVYESPPYVYKPPTPP 6 +PPPY Y PPY Y PP P Sbjct: 144 YSSPPPYAYSPPPYAYSPPPSP 165 Score = 23.5 bits (49), Expect(2) = 1e-15 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 50 PPPSPYVYKSP 60 Score = 81.3 bits (199), Expect(2) = 4e-15 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 16/82 (19%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYK------ 72 P++ + Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY Sbjct: 227 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 285 Query: 71 -PPTPPPYVYESPPYVYKPPTP 9 P P PYVY+SPPYVY P P Sbjct: 286 YSPPPSPYVYKSPPYVYSSPPP 307 Score = 81.3 bits (199), Expect(2) = 4e-15 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 16/82 (19%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYK------ 72 P++ + Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY Sbjct: 251 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 309 Query: 71 -PPTPPPYVYESPPYVYKPPTP 9 P P PYVY+SPPYVY P P Sbjct: 310 YSPPPSPYVYKSPPYVYSSPPP 331 Score = 81.3 bits (199), Expect(2) = 4e-15 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 16/82 (19%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYK------ 72 P++ + Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY Sbjct: 275 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 333 Query: 71 -PPTPPPYVYESPPYVYKPPTP 9 P P PYVY+SPPYVY P P Sbjct: 334 YSPPPSPYVYKSPPYVYSSPPP 355 Score = 81.3 bits (199), Expect(2) = 4e-15 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 16/82 (19%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYK------ 72 P++ + Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY Sbjct: 299 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 357 Query: 71 -PPTPPPYVYESPPYVYKPPTP 9 P P PYVY+SPPYVY P P Sbjct: 358 YSPPPSPYVYKSPPYVYSSPPP 379 Score = 23.5 bits (49), Expect(2) = 4e-15 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 185 PPPSPYVYKSP 195 Score = 23.5 bits (49), Expect(2) = 4e-15 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 216 PPPSPYVYKSP 226 Score = 23.5 bits (49), Expect(2) = 4e-15 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 240 PPPSPYVYKSP 250 Score = 23.5 bits (49), Expect(2) = 4e-15 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 264 PPPSPYVYKSP 274 Score = 80.9 bits (198), Expect(2) = 5e-15 Identities = 38/67 (56%), Positives = 41/67 (61%), Gaps = 9/67 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYKPPTPPPYVYESPPYV 27 Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY +PPPY Y PPY Sbjct: 157 YAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYS--SPPPYAYSPPPYA 213 Query: 26 YKPPTPP 6 Y PP P Sbjct: 214 YSPPPSP 220 Score = 23.5 bits (49), Expect(2) = 5e-15 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 122 PPPSPYVYKSP 132 Score = 80.1 bits (196), Expect(2) = 8e-15 Identities = 40/73 (54%), Positives = 43/73 (58%), Gaps = 16/73 (21%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYK-------PPTPPPYV 48 Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY P P PYV Sbjct: 212 YAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYV 270 Query: 47 YESPPYVYKPPTP 9 Y+SPPYVY P P Sbjct: 271 YKSPPYVYSSPPP 283 Score = 23.5 bits (49), Expect(2) = 8e-15 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 161 PPPSPYVYKSP 171 Score = 82.4 bits (202), Expect = 1e-14 Identities = 39/66 (59%), Positives = 43/66 (65%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-PPYVYK-PPTPPPYESPPYVYK-------PPTPPPYVYESPPYV 27 Y Y PP+PPPYVY S PPY Y PP+P Y+SPPYVY P P PYVY+SPPYV Sbjct: 28 YPYSPPSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYV 87 Query: 26 YKPPTP 9 Y P P Sbjct: 88 YSSPPP 93 Score = 81.3 bits (199), Expect(2) = 2e-14 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 16/82 (19%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYK---------PPTPPPYESPPYVYK------ 72 P++ + Y Y PP P PYVYKSPPYVY PP+P Y+SPPYVY Sbjct: 61 PYVYSSPPPYAYSPP-PSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 119 Query: 71 -PPTPPPYVYESPPYVYKPPTP 9 P P PYVY+SPPYVY P P Sbjct: 120 YSPPPSPYVYKSPPYVYSSPPP 141 Score = 20.8 bits (42), Expect(2) = 2e-14 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPPY Y P Sbjct: 42 SPPPYTYSPP 51 Score = 77.8 bits (190), Expect(2) = 4e-14 Identities = 42/78 (53%), Positives = 46/78 (58%), Gaps = 21/78 (26%) Frame = -3 Query: 179 YVYKPP-----TPPPYVYKS-PPYVYKPP----TPPP----YESPPYVYK-------PPT 63 YVYK P +PPPYVY S PPY Y PP +PPP Y+SPPYVY P Sbjct: 127 YVYKSPPYVYSSPPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 186 Query: 62 PPPYVYESPPYVYKPPTP 9 P PYVY+SPPYVY P P Sbjct: 187 PSPYVYKSPPYVYSSPPP 204 Score = 23.5 bits (49), Expect(2) = 4e-14 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 98 PPPSPYVYKSP 108 Score = 78.6 bits (192), Expect(2) = 1e-13 Identities = 38/70 (54%), Positives = 41/70 (58%), Gaps = 13/70 (18%) Frame = -3 Query: 179 YVYKPP-----TPPPYVYKSPPYVYKPPTPP-PYESPPYVYK-------PPTPPPYVYES 39 YVYK P +PPPY Y PPY Y PP P Y+SPPYVY P P PYVY+S Sbjct: 190 YVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKS 249 Query: 38 PPYVYKPPTP 9 PPYVY P P Sbjct: 250 PPYVYSSPPP 259 Score = 20.8 bits (42), Expect(2) = 1e-13 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPPY Y P Sbjct: 146 SPPPYAYSPP 155 Score = 62.8 bits (151), Expect(2) = 1e-09 Identities = 32/60 (53%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP--TPPPYVYESPPYVYKPPTPP 6 Y Y PP P P VYK PPYVY P PPYVY PP +PPP SP Y Y P PP Sbjct: 387 YAYSPPPPCPDVYKPPPYVYSSP-------PPYVYNPPPSSPPP----SPSYSYSSPPPP 435 Score = 23.5 bits (49), Expect(2) = 1e-09 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 336 PPPSPYVYKSP 346 Score = 58.2 bits (139), Expect(2) = 2e-08 Identities = 32/70 (45%), Positives = 35/70 (50%), Gaps = 21/70 (30%) Frame = -3 Query: 179 YVYKPP-----TPPPYVYKSPPYVYKPPTPPP--YESPPYVY--------------KPPT 63 YVYK P +PPPY Y PPY Y PP P P Y+ PPYVY PP+ Sbjct: 365 YVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPS 424 Query: 62 PPPYVYESPP 33 P Y Y SPP Sbjct: 425 -PSYSYSSPP 433 Score = 23.5 bits (49), Expect(2) = 2e-08 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY+SP Sbjct: 360 PPPSPYVYKSP 370 [4][TOP] >UniRef100_Q9STN1 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9STN1_ARATH Length = 350 Score = 87.0 bits (214), Expect(2) = 1e-16 Identities = 44/81 (54%), Positives = 46/81 (56%), Gaps = 22/81 (27%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-------------YVYK-PPTPPPY-----ESPPYVYKPPTPP 57 YVY PP P PYVYKSPP YVY PP PPPY PPYVYK P PP Sbjct: 40 YVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPP 99 Query: 56 PYVYESPP---YVYKPPTPPP 3 P+VY SPP Y+Y P PPP Sbjct: 100 PFVYSSPPPPTYIYNSPPPPP 120 Score = 22.7 bits (47), Expect(2) = 1e-16 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 216 PTPPPYVYESPL 181 P P PYVY PL Sbjct: 35 PPPQPYVYSPPL 46 Score = 83.2 bits (204), Expect(2) = 2e-16 Identities = 41/71 (57%), Positives = 46/71 (64%), Gaps = 12/71 (16%) Frame = -3 Query: 179 YVYK-PPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYESPP-- 33 YVY PP PPPY+Y SPP YVYK P PPP Y SPP Y+Y P PPPYVY+S P Sbjct: 70 YVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRI 129 Query: 32 -YVYKPPTPPP 3 ++Y P PPP Sbjct: 130 TFIYSSPPPPP 140 Score = 26.2 bits (56), Expect(2) = 2e-16 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P PYVY+SP Sbjct: 44 PPLPSPYVYKSP 55 Score = 78.2 bits (191), Expect(2) = 1e-15 Identities = 38/81 (46%), Positives = 45/81 (55%), Gaps = 21/81 (25%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPP---YVYKPPTPPPY---ESP--PYVYKPPTPPPYVYES---- 39 +Y+Y P PPPYVYKS P ++Y P PPPY +P P++Y P PPPYVY S Sbjct: 110 TYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRV 169 Query: 38 ---------PPYVYKPPTPPP 3 PPYVY P PPP Sbjct: 170 LFIYSSPPPPPYVYNSPPPPP 190 Score = 28.5 bits (62), Expect(2) = 1e-15 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPPY+Y SP Sbjct: 75 PPPPPPYIYNSP 86 Score = 75.5 bits (184), Expect(2) = 3e-14 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSP---PYVYKPPTPPPY---ESP--PYVYKPPTPPPYVYESP---P 33 YVY P PPPYVY+S P++Y P PPPY +P P++Y P PPPYVY S P Sbjct: 181 YVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVP 240 Query: 32 YVYKPPTPPP 3 ++Y P PPP Sbjct: 241 FIYSSPPPPP 250 Score = 26.2 bits (56), Expect(2) = 3e-14 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY SP Sbjct: 176 PPPPPYVYNSP 186 Score = 76.6 bits (187), Expect(2) = 4e-14 Identities = 36/81 (44%), Positives = 43/81 (53%), Gaps = 21/81 (25%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPP---YVYKPPTPPPY---------------ESPPYVYKPPTPP 57 +++Y P PPPYVY S P ++Y P PPPY PPYVY P PP Sbjct: 130 TFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPP 189 Query: 56 PYVYESP---PYVYKPPTPPP 3 PYVYES P++Y P PPP Sbjct: 190 PYVYESVPRIPFIYSSPPPPP 210 Score = 24.6 bits (52), Expect(2) = 4e-14 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP+VY SP Sbjct: 96 PPPPPFVYSSP 106 Score = 79.0 bits (193), Expect = 2e-13 Identities = 41/71 (57%), Positives = 43/71 (60%), Gaps = 14/71 (19%) Frame = -3 Query: 173 YKPPTPPP--YVYKSP---PYVYKPPTPPPY-----ESPPYVY-KPPTPPPYVYES---P 36 Y P +PPP YVY P PYVYK P P PY PPYVY PP PPPY+Y S P Sbjct: 30 YSPQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRP 89 Query: 35 PYVYKPPTPPP 3 PYVYK P PPP Sbjct: 90 PYVYKSPPPPP 100 Score = 71.2 bits (173), Expect(2) = 3e-12 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSP---PYVYKPPTPPPY---ESP--PYVYKPPTPPPYVYESP---P 33 ++Y P PPPYVYKS P++Y P PPPY +P P++Y PPPYVY S P Sbjct: 241 FIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVP 300 Query: 32 YVYKPPTPPP 3 ++Y P PPP Sbjct: 301 FIYSSPPPPP 310 Score = 23.5 bits (49), Expect(2) = 3e-12 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 216 PTPPPYVYES 187 P PPPYVY S Sbjct: 206 PPPPPYVYNS 215 Score = 68.9 bits (167), Expect(2) = 4e-12 Identities = 31/70 (44%), Positives = 39/70 (55%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSP---PYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYESP---P 33 ++Y P PPPYVY S P++Y P PPPY P++Y P PPPYVY S P Sbjct: 221 FIYSSPPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIP 280 Query: 32 YVYKPPTPPP 3 ++Y PPP Sbjct: 281 FIYSSLPPPP 290 Score = 25.4 bits (54), Expect(2) = 4e-12 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 216 PTPPPYVYES 187 P PPPYVYES Sbjct: 186 PPPPPYVYES 195 Score = 64.3 bits (155), Expect(2) = 3e-10 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 11/68 (16%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPY---ESP--PYVYKPPTPPPYVYESP---P 33 ++Y P PPPYVY S P ++Y PPPY +P P++Y P PPPYVY S P Sbjct: 261 FIYSSPPPPPYVYNSAPRIPFIYSSLPPPPYVYNSAPRVPFIYSSPPPPPYVYNSAPRIP 320 Query: 32 YVYKPPTP 9 ++Y P P Sbjct: 321 FIYSSPPP 328 Score = 23.9 bits (50), Expect(2) = 3e-10 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 216 PTPPPYVYES 187 P PPPYVY+S Sbjct: 246 PPPPPYVYKS 255 [5][TOP] >UniRef100_Q43682 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata RepID=Q43682_VIGUN Length = 280 Score = 83.2 bits (204), Expect(2) = 2e-16 Identities = 47/84 (55%), Positives = 48/84 (57%), Gaps = 26/84 (30%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYK-PPTPPPY 51 YVYK P PP PYVYKSPP YVYK P PP P PPYVYK PP PPPY Sbjct: 74 YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPPPY 133 Query: 50 VYES---------PPYVYKPPTPP 6 VY+S PPYVYK P PP Sbjct: 134 VYKSPPPPSPSPPPPYVYKSPPPP 157 Score = 26.2 bits (56), Expect(2) = 2e-16 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 36 PSPPPPYVYKSP 47 Score = 82.8 bits (203), Expect(2) = 2e-16 Identities = 46/84 (54%), Positives = 48/84 (57%), Gaps = 26/84 (30%) Frame = -3 Query: 179 YVYK-PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PPTPPPY 51 YVYK PP PPPYVYKS PPYVYK PP P P PPYVYK P PPPY Sbjct: 122 YVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPY 181 Query: 50 VYES---------PPYVYKPPTPP 6 +Y+S PPYVYK P PP Sbjct: 182 IYKSPPPPSPSPPPPYVYKSPPPP 205 Score = 26.2 bits (56), Expect(2) = 2e-16 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 84 PSPPPPYVYKSP 95 Score = 80.9 bits (198), Expect(2) = 8e-16 Identities = 47/90 (52%), Positives = 48/90 (53%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYK------PP 66 YVYK P PP PYVYKSPP YVYK P PP P PPYVYK P Sbjct: 42 YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 101 Query: 65 TPPPYVYES---------PPYVYKPPTPPP 3 PPPYVY+S PPYVYK P PPP Sbjct: 102 PPPPYVYKSPPPPSPSPPPPYVYKSPPPPP 131 Score = 77.8 bits (190), Expect(2) = 8e-16 Identities = 45/89 (50%), Positives = 47/89 (52%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYK------PP 66 YVYK P PP PYVYKSPP YVYK P PP P PPY+YK P Sbjct: 133 YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPS 192 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPYVY+S PPYVYK P PP Sbjct: 193 PPPPYVYKSPPPPSPSPPPPYVYKSPPPP 221 Score = 29.3 bits (64), Expect(2) = 8e-16 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPPYVY+SP Sbjct: 127 PPPPPPYVYKSP 138 Score = 26.2 bits (56), Expect(2) = 8e-16 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 4 PSPPPPYVYKSP 15 Score = 80.1 bits (196), Expect(2) = 1e-15 Identities = 46/84 (54%), Positives = 47/84 (55%), Gaps = 26/84 (30%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 YVYK P PP PYVYKS PPYVYK PP P P PPYVYK P Sbjct: 58 YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 117 Query: 65 TPPPYVYES----PPYVYKPPTPP 6 PPPYVY+S PPYVYK P PP Sbjct: 118 PPPPYVYKSPPPPPPYVYKSPPPP 141 Score = 26.2 bits (56), Expect(2) = 1e-15 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 20 PSPPPPYVYKSP 31 Score = 79.7 bits (195), Expect(2) = 2e-15 Identities = 45/84 (53%), Positives = 47/84 (55%), Gaps = 26/84 (30%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP----YVYKPPTPP-PYESPPYVYK------PPTPPPY 51 YVYK P PP PYVYKSPP YVYK P PP P PPYVYK P PPPY Sbjct: 106 YVYKSPPPPSPSPPPPYVYKSPPPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPY 165 Query: 50 VYES---------PPYVYKPPTPP 6 VY+S PPY+YK P PP Sbjct: 166 VYKSPPPPSPSPPPPYIYKSPPPP 189 Score = 26.2 bits (56), Expect(2) = 2e-15 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 68 PSPPPPYVYKSP 79 Score = 77.8 bits (190), Expect(2) = 6e-15 Identities = 45/89 (50%), Positives = 47/89 (52%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 YVYK P PP PYVYKS PPY+YK PP P P PPYVYK P Sbjct: 149 YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPS 208 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPYVY+S PPYVYK P PP Sbjct: 209 PPPPYVYKSPPPPSPSPPPPYVYKSPPPP 237 Score = 77.8 bits (190), Expect(2) = 6e-15 Identities = 45/89 (50%), Positives = 47/89 (52%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYK------PP 66 YVYK P PP PY+YKSPP YVYK P PP P PPYVYK P Sbjct: 165 YVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 224 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPYVY+S PPYVYK P PP Sbjct: 225 PPPPYVYKSPPPPSPSPPPPYVYKSPPPP 253 Score = 77.8 bits (190), Expect(2) = 6e-15 Identities = 45/89 (50%), Positives = 47/89 (52%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 Y+YK P PP PYVYKS PPYVYK PP P P PPYVYK P Sbjct: 181 YIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 240 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPYVY+S PPYVYK P PP Sbjct: 241 PPPPYVYKSPPPPSPSPPPPYVYKSPPPP 269 Score = 26.2 bits (56), Expect(2) = 6e-15 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 100 PSPPPPYVYKSP 111 Score = 26.2 bits (56), Expect(2) = 6e-15 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 116 PSPPPPYVYKSP 127 Score = 26.2 bits (56), Expect(2) = 6e-15 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 143 PSPPPPYVYKSP 154 Score = 75.9 bits (185), Expect(2) = 2e-14 Identities = 45/88 (51%), Positives = 46/88 (52%), Gaps = 30/88 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYESPPYVYKPPTPP---- 57 YVYK P PP PYVYKSPP YVYK P PPP PYVYK P PP Sbjct: 90 YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPP----PYVYKSPPPPSPSP 145 Query: 56 --PYVYES---------PPYVYKPPTPP 6 PYVY+S PPYVYK P PP Sbjct: 146 PPPYVYKSPPPPSPSPPPPYVYKSPPPP 173 Score = 26.2 bits (56), Expect(2) = 2e-14 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 52 PSPPPPYVYKSP 63 Score = 78.2 bits (191), Expect = 3e-13 Identities = 46/89 (51%), Positives = 47/89 (52%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYK------PP 66 YVYK P PP PYVYKSPP YVYK P PP P PPYVYK P Sbjct: 10 YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 69 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPYVY+S PPYVYK P PP Sbjct: 70 PPPPYVYKSPPPPSPSPPPPYVYKSPPPP 98 Score = 78.2 bits (191), Expect = 3e-13 Identities = 46/89 (51%), Positives = 47/89 (52%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 YVYK P PP PYVYKS PPYVYK PP P P PPYVYK P Sbjct: 26 YVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 85 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPYVY+S PPYVYK P PP Sbjct: 86 PPPPYVYKSPPPPSPSPPPPYVYKSPPPP 114 Score = 75.9 bits (185), Expect = 1e-12 Identities = 42/79 (53%), Positives = 43/79 (54%), Gaps = 25/79 (31%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PPTPPPYVYES- 39 P PPPYVYKS PPYVYK PP P P PPYVYK P PPPYVY+S Sbjct: 4 PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSP 63 Query: 38 --------PPYVYKPPTPP 6 PPYVYK P PP Sbjct: 64 PPPSPSPPPPYVYKSPPPP 82 Score = 67.8 bits (164), Expect = 4e-10 Identities = 37/70 (52%), Positives = 39/70 (55%), Gaps = 16/70 (22%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYK------PPTPPPYVYES---------P 36 PP+P P PPYVYK PP P P PPYVYK P PPPYVY+S P Sbjct: 1 PPSPSP----PPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPP 56 Query: 35 PYVYKPPTPP 6 PYVYK P PP Sbjct: 57 PYVYKSPPPP 66 Score = 61.6 bits (148), Expect(2) = 4e-10 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 6/58 (10%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVYK P PP PYVYKSPP PP+P P PPYVYK P PPP PPYVY Sbjct: 229 YVYKSPPPPSPSPPPPYVYKSPP----PPSPSP--PPPYVYKSP-PPPSPSPPPPYVY 279 Score = 26.2 bits (56), Expect(2) = 4e-10 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 191 PSPPPPYVYKSP 202 [6][TOP] >UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019859A1 Length = 377 Score = 80.9 bits (198), Expect(2) = 4e-16 Identities = 43/84 (51%), Positives = 46/84 (54%), Gaps = 25/84 (29%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-------------PPYVYKPPTPPP----YESPP---YVYKPPTP 60 Y YK P PPPY YKS PPY YK P PPP Y+SPP Y YK P P Sbjct: 278 YKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPP 337 Query: 59 PPYVYESPP-----YVYKPPTPPP 3 PPY+Y+SPP Y YK P PPP Sbjct: 338 PPYMYKSPPPPPPVYKYKSPPPPP 361 Score = 26.9 bits (58), Expect(2) = 4e-16 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPPY Y+SP Sbjct: 248 PPPPPPYKYKSP 259 Score = 76.3 bits (186), Expect(2) = 1e-13 Identities = 41/71 (57%), Positives = 41/71 (57%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP-----YVYK-PPTPPPYESPP----YVYKPPTPPPYVY---ESP 36 VY PP PPY YKSPP Y YK PP PPP SPP Y YK P PPP VY P Sbjct: 66 VYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHP 125 Query: 35 PYVYKPPTPPP 3 PY YK P PPP Sbjct: 126 PYKYKSPPPPP 136 Score = 23.5 bits (49), Expect(2) = 1e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 49 PPPPPVYKYKSP 60 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 39/70 (55%), Positives = 41/70 (58%), Gaps = 15/70 (21%) Frame = -3 Query: 167 PPTPPPYVYKSPP-----YVYKPPTPP--PYE-----SPPYVYKPPTPPPYVYES---PP 33 PP PPPY YKSPP Y YK P PP PY+ PPY YK P PPP Y+S PP Sbjct: 248 PPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPP 307 Query: 32 YVYKPPTPPP 3 Y YK P PPP Sbjct: 308 YKYKSPPPPP 317 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 43/74 (58%), Positives = 45/74 (60%), Gaps = 15/74 (20%) Frame = -3 Query: 179 YVYKPPTPP--PYVYKS---PPYVYKPPTPPP--YES---PPYVYKPPTPPP--YVYESP 36 Y YK P PP PY YKS PPY YK P PPP Y+S PPY YK P PPP Y Y+SP Sbjct: 266 YKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSP 325 Query: 35 P---YVYKPPTPPP 3 P Y YK P PPP Sbjct: 326 PPPVYKYKSPPPPP 339 Score = 23.5 bits (49), Expect(2) = 2e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 227 PPPPPVYKYKSP 238 Score = 23.5 bits (49), Expect(2) = 2e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 260 PPPPPVYKYKSP 271 Score = 74.7 bits (182), Expect(2) = 3e-13 Identities = 42/79 (53%), Positives = 44/79 (55%), Gaps = 16/79 (20%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYK---SPPYVYK-PPTPPPYES----PPYVYKPPTPPP--YVYE 42 +H Y YK P PPP VY PPY YK PP PPP S PPY YK P PPP Y Y+ Sbjct: 123 HHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYK 182 Query: 41 SP------PYVYKPPTPPP 3 SP PY YK P PPP Sbjct: 183 SPPPPHKKPYKYKSPPPPP 201 Score = 23.5 bits (49), Expect(2) = 3e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 81 PPPPPVYKYKSP 92 Score = 73.2 bits (178), Expect(2) = 1e-12 Identities = 41/79 (51%), Positives = 41/79 (51%), Gaps = 21/79 (26%) Frame = -3 Query: 176 VYKPPTPPPYVYKS-------------PPYVYK-PPTPPPYES----PPYVYKPPTPPPY 51 VY PP PPY YKS PPY YK PP PPP S PPY YK P PPP Sbjct: 98 VYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 157 Query: 50 VY---ESPPYVYKPPTPPP 3 VY PPY YK P PPP Sbjct: 158 VYSPPHHPPYKYKSPPPPP 176 Score = 23.1 bits (48), Expect(2) = 1e-12 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPY Y+SP Sbjct: 69 PPHHPPYKYKSP 80 Score = 73.6 bits (179), Expect(2) = 2e-12 Identities = 43/86 (50%), Positives = 44/86 (51%), Gaps = 23/86 (26%) Frame = -3 Query: 191 NHHSYVYKPPTPPP--YVYKS-------------PPYVYK-PPTPPPYES----PPYVYK 72 +H Y YK P PPP Y YKS PPY YK PP PPP S PPY YK Sbjct: 71 HHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYK 130 Query: 71 PPTPPPYVY---ESPPYVYKPPTPPP 3 P PPP VY PPY YK P PPP Sbjct: 131 SPPPPPPVYSPPHHPPYKYKSPPPPP 156 Score = 22.3 bits (46), Expect(2) = 2e-12 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y+SP Sbjct: 40 PPPYYYKSP 48 Score = 72.4 bits (176), Expect(2) = 2e-12 Identities = 41/88 (46%), Positives = 43/88 (48%), Gaps = 25/88 (28%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYK---SPPYVYKPPTPPP----YESP------PYVYKPPTPPPY 51 +H Y YK P PPP VY PPY YK P PPP Y+SP PY YK P PPPY Sbjct: 143 HHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPY 202 Query: 50 VYES------------PPYVYKPPTPPP 3 S PPY YK P PPP Sbjct: 203 NLPSGTSADEYEYKSPPPYKYKSPPPPP 230 Score = 72.0 bits (175), Expect(2) = 2e-12 Identities = 39/71 (54%), Positives = 41/71 (57%), Gaps = 12/71 (16%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKS---PPYVYKPPTPPPYESPPYVYKPPTPPPYVYE-------SP 36 Y YK P PPP Y YKS PP V+ PP PP PPY YK P PPP VY+ SP Sbjct: 221 YKYKSPPPPPPVYKYKSPPPPPPVHSPPPPP----PPYKYKSPPPPPPVYKYKSPPPPSP 276 Query: 35 PYVYKPPTPPP 3 PY YK P PPP Sbjct: 277 PYKYKSPPPPP 287 Score = 23.5 bits (49), Expect(2) = 2e-12 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 173 PPPPPVYKYKSP 184 Score = 23.1 bits (48), Expect(2) = 2e-12 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPY Y+SP Sbjct: 101 PPHHPPYKYKSP 112 Score = 70.5 bits (171), Expect(2) = 3e-12 Identities = 39/69 (56%), Positives = 42/69 (60%), Gaps = 10/69 (14%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKS-PPYVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-----Y 30 Y YK P PPP Y YKS PP VYK +PPP PPY+YK P PPP Y Y+SPP Y Sbjct: 308 YKYKSPPPPPPVYKYKSPPPPVYKYKSPPP---PPYMYKSPPPPPPVYKYKSPPPPPPKY 364 Query: 29 VYKPPTPPP 3 Y P PPP Sbjct: 365 YYSSPPPPP 373 Score = 24.3 bits (51), Expect(2) = 3e-12 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y+SP Sbjct: 283 PPPPPYKYKSP 293 Score = 68.6 bits (166), Expect(2) = 5e-11 Identities = 38/75 (50%), Positives = 41/75 (54%), Gaps = 16/75 (21%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYV--YK----PPTPPPYE-------SPPYVYKPPTPPPYVYES 39 Y YK P PPP V+ PP YK PP PP Y+ SPPY YK P PPPY Y+S Sbjct: 233 YKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKS 292 Query: 38 ---PPYVYKPPTPPP 3 PP YK P PPP Sbjct: 293 PPPPPLQYKSPPPPP 307 Score = 22.3 bits (46), Expect(2) = 5e-11 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPPY Y+SP Sbjct: 217 SPPPYKYKSP 226 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 35/62 (56%), Positives = 36/62 (58%), Gaps = 5/62 (8%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPPYVYKPP 15 Y YK P PP Y YKSPP Y+YK P PPP P Y YK P PPP Y Y SPP PP Sbjct: 320 YKYKSPPPPVYKYKSPPPPPYMYKSPPPPP---PVYKYKSPPPPPPKYYYSSPP----PP 372 Query: 14 TP 9 P Sbjct: 373 PP 374 Score = 24.3 bits (51), Expect(2) = 1e-10 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y+SP Sbjct: 303 PPPPPYKYKSP 313 Score = 69.3 bits (168), Expect = 1e-10 Identities = 41/85 (48%), Positives = 43/85 (50%), Gaps = 25/85 (29%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPP-----YVYK-PPTPPPYESPP----YVYKPPTPPPYVYE--- 42 +Y Y P PPPY YKSPP Y YK PP PPP SPP Y YK P PPP VY+ Sbjct: 33 NYHYSSP-PPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKS 91 Query: 41 ------------SPPYVYKPPTPPP 3 PPY YK P PPP Sbjct: 92 PPPPPPVYSPPHHPPYKYKSPPPPP 116 Score = 65.9 bits (159), Expect(2) = 2e-10 Identities = 42/102 (41%), Positives = 44/102 (43%), Gaps = 39/102 (38%) Frame = -3 Query: 191 NHHSYVYKPPTPPP--YVYKSPP------YVYKPPTPPPYE--------------SPPYV 78 +H Y YK P PPP Y YKSPP Y YK P PPPY PPY Sbjct: 163 HHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYK 222 Query: 77 YKPPTPPPYVYE--------------SPPYVYK---PPTPPP 3 YK P PPP VY+ PP YK PP PPP Sbjct: 223 YKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPP 264 Score = 23.1 bits (48), Expect(2) = 2e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPY Y+SP Sbjct: 121 PPHHPPYKYKSP 132 Score = 58.9 bits (141), Expect(2) = 1e-08 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 6/51 (11%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-----YVYKPPTPPPYESPPYVYK-PPTPPPYVY 45 Y YK P PPPY+YKSPP Y YK P PPP P Y Y PP PPP+ Y Sbjct: 330 YKYKSPPPPPYMYKSPPPPPPVYKYKSPPPPP---PKYYYSSPPPPPPHHY 377 Score = 23.5 bits (49), Expect(2) = 1e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 314 PPPPPVYKYKSP 325 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 14/67 (20%) Frame = -3 Query: 161 TPPPYVYKS--PPYVYKPPTPPP----YES---PPYVYKPPTPPPYVYESPP-----YVY 24 T Y Y S PPY YK P PPP Y+S PP VY PP PPY Y+SPP Y Y Sbjct: 30 TSANYHYSSPPPPYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKY 89 Query: 23 KPPTPPP 3 K P PPP Sbjct: 90 KSPPPPP 96 [7][TOP] >UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO Length = 217 Score = 83.6 bits (205), Expect(2) = 8e-16 Identities = 40/78 (51%), Positives = 47/78 (60%), Gaps = 20/78 (25%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP-----YVYKPPTPPP--YESPPYVYKPPTPPPYVYESP------ 36 ++K P PPPYVYKSPP Y YK P PPP ++ PPY+YK P PPP +Y+SP Sbjct: 63 IHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYK 122 Query: 35 -------PYVYKPPTPPP 3 PYVYK P PPP Sbjct: 123 SPPPPKNPYVYKSPPPPP 140 Score = 23.5 bits (49), Expect(2) = 8e-16 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 46 PPPPPVYKYKSP 57 Score = 80.1 bits (196), Expect(2) = 1e-15 Identities = 41/81 (50%), Positives = 45/81 (55%), Gaps = 22/81 (27%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP--YESP-------------PYVYKPPTPPPYVY 45 Y YK P PPP V+K PPY+YK P PPP Y+SP PYVYK P PPP VY Sbjct: 84 YKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSPPPPVYKSPPPPKNPYVYKSPPPPPPVY 143 Query: 44 -------ESPPYVYKPPTPPP 3 + PYVYK P PPP Sbjct: 144 KYLHHLHQKKPYVYKSPPPPP 164 Score = 26.6 bits (57), Expect(2) = 1e-15 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY+SP Sbjct: 67 PPPPPYVYKSP 77 Score = 79.7 bits (195), Expect(2) = 1e-14 Identities = 41/94 (43%), Positives = 48/94 (51%), Gaps = 35/94 (37%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSP-------------PYVYKPPTPPP---------YESPPYVYKPP 66 Y+YK P PPP +YKSP PYVYK P PPP ++ PYVYK P Sbjct: 101 YIYKSPPPPPPIYKSPPPPVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSP 160 Query: 65 TPPPYVYESP-------------PYVYKPPTPPP 3 PPP+V++SP PYVYK P PPP Sbjct: 161 PPPPFVHKSPPPPVYKSPPPPKKPYVYKSPPPPP 194 Score = 23.5 bits (49), Expect(2) = 1e-14 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 78 PPPPPVYKYKSP 89 Score = 77.0 bits (188), Expect = 6e-13 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYK-PPTPPPYVYESPPYVYKPPT 12 Y YK P PPP ++KSPP YVYK P PPP P Y YK PP PPP V++ PPY+YK P Sbjct: 52 YKYKSPPPPPPIHKSPPPPPYVYKSPPPPP---PVYKYKSPPPPPP-VHKYPPYIYKSPP 107 Query: 11 PPP 3 PPP Sbjct: 108 PPP 110 Score = 73.9 bits (180), Expect(2) = 9e-13 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 5/63 (7%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-PPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP----YVYKPP 15 YVYK P PPP+V+KS PP VYK P PP PYVYK P PPP +++SPP Y Y P Sbjct: 155 YVYKSPPPPPFVHKSPPPPVYKSPPPP---KKPYVYKSPPPPPPIHKSPPPPYHYYYSSP 211 Query: 14 TPP 6 PP Sbjct: 212 PPP 214 Score = 22.7 bits (47), Expect(2) = 9e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PYVY+SP Sbjct: 125 PPPKNPYVYKSP 136 Score = 65.5 bits (158), Expect = 2e-09 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 3/62 (4%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYES---PPYVYKPPTP 9 Y Y P PPPY Y SPP P PPP Y YK P PPP +++S PPYVYK P P Sbjct: 25 YKYSSP-PPPYHYSSPPPPVHSPPPPPV----YKYKSPPPPPPIHKSPPPPPYVYKSPPP 79 Query: 8 PP 3 PP Sbjct: 80 PP 81 [8][TOP] >UniRef100_B9H7Q5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H7Q5_POPTR Length = 173 Score = 78.6 bits (192), Expect(2) = 3e-15 Identities = 41/76 (53%), Positives = 43/76 (56%), Gaps = 15/76 (19%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSP-----PYVYKPPTPPPYESP-----PYVYKPPTPPPYVYE-- 42 H Y YK P PPP V+KSP PY YK P PPP SP PY YK P PPP VY+ Sbjct: 67 HPYKYKSPPPPPPVHKSPPPPKKPYKYKSPPPPPVHSPPPPSHPYKYKSPPPPPPVYKYK 126 Query: 41 ---SPPYVYKPPTPPP 3 PP VYK P PPP Sbjct: 127 SPPPPPPVYKSPPPPP 142 Score = 26.6 bits (57), Expect(2) = 3e-15 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPPY Y+SP Sbjct: 42 PPPPPPYHYKSP 53 Score = 68.9 bits (167), Expect = 2e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 8/63 (12%) Frame = -3 Query: 167 PPTPPPYVYKSPPY---VYKPPTPPPYESPPYVYKPPTPPPYVYESP-----PYVYKPPT 12 PP PPPY YKSPP V+ PP PPP+ PY YK P PPP V++SP PY YK P Sbjct: 42 PPPPPPYHYKSPPPPPPVHSPP-PPPH---PYKYKSPPPPPPVHKSPPPPKKPYKYKSPP 97 Query: 11 PPP 3 PPP Sbjct: 98 PPP 100 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/57 (52%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = -3 Query: 161 TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESP----PYVYKPPTPPP 3 T Y Y SPP K P PPP PPY YK P PPP V+ P PY YK P PPP Sbjct: 25 TTANYEYSSPPPPKKSPPPPP---PPYHYKSPPPPPPVHSPPPPPHPYKYKSPPPPP 78 [9][TOP] >UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris RepID=Q09083_PHAVU Length = 580 Score = 80.1 bits (196), Expect(2) = 6e-15 Identities = 39/66 (59%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y YK P PP Y YKSPP YK P+PPP Y SPP Y YK P PP Y Y+SPP YK Sbjct: 474 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYK 533 Query: 20 PPTPPP 3 P+PPP Sbjct: 534 YPSPPP 539 Score = 23.9 bits (50), Expect(2) = 6e-15 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 459 PPPPPYKYSSP 469 Score = 80.1 bits (196), Expect(2) = 8e-15 Identities = 39/66 (59%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y YK P PP Y YKSPP YK P+PPP Y SPP Y YK P PP Y Y+SPP YK Sbjct: 435 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYK 494 Query: 20 PPTPPP 3 P+PPP Sbjct: 495 YPSPPP 500 Score = 23.5 bits (49), Expect(2) = 8e-15 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 410 PPPPPYKYPSP 420 Score = 77.8 bits (190), Expect(2) = 3e-14 Identities = 38/66 (57%), Positives = 41/66 (62%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y YK P PP Y Y SPP YK P+PPP Y SPP Y YK P PP Y Y+SPP YK Sbjct: 347 YKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYK 406 Query: 20 PPTPPP 3 P+PPP Sbjct: 407 YPSPPP 412 Score = 23.9 bits (50), Expect(2) = 3e-14 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 302 PPPPPYKYSSP 312 Score = 73.9 bits (180), Expect(2) = 5e-13 Identities = 39/76 (51%), Positives = 42/76 (55%), Gaps = 17/76 (22%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP--YVYKPPTPPPYE--SPP-------------YVYKPPTPPPY 51 Y YK P PP Y YKSPP Y Y P PPPY+ SPP Y YK P PP Y Sbjct: 386 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVY 445 Query: 50 VYESPPYVYKPPTPPP 3 Y+SPP YK P+PPP Sbjct: 446 KYKSPPPPYKYPSPPP 461 Score = 23.5 bits (49), Expect(2) = 5e-13 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 371 PPPPPYKYPSP 381 Score = 73.9 bits (180), Expect(2) = 1e-12 Identities = 38/67 (56%), Positives = 39/67 (58%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPPYVY 24 Y Y P PP Y YKSPP Y YK P PP Y SPP Y YK P PP Y Y SPP Y Sbjct: 307 YKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPY 366 Query: 23 KPPTPPP 3 K P+PPP Sbjct: 367 KYPSPPP 373 Score = 21.9 bits (45), Expect(2) = 1e-12 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 263 PPPYYYHSP 271 Score = 70.5 bits (171), Expect(2) = 4e-12 Identities = 35/68 (51%), Positives = 37/68 (54%), Gaps = 10/68 (14%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP----------Y 30 Y YK P PP Y YKSPP YK P+PPP P Y YK P PP Y Y SPP Y Sbjct: 513 YKYKSPPPPVYKYKSPPPPYKYPSPPP---PVYKYKSPPPPVYKYNSPPPPVHSPPPPHY 569 Query: 29 VYKPPTPP 6 +Y P PP Sbjct: 570 IYASPPPP 577 Score = 23.9 bits (50), Expect(2) = 4e-12 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 498 PPPPPYKYSSP 508 Score = 72.4 bits (176), Expect(2) = 7e-12 Identities = 37/67 (55%), Positives = 39/67 (58%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE----SPPYVYKPPTPPPYVYES-PPYVY 24 Y Y P PPPY Y SPP Y YK P PP Y+ PPY Y P PPPY Y S PP VY Sbjct: 366 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVY 425 Query: 23 KPPTPPP 3 K +PPP Sbjct: 426 KYNSPPP 432 Score = 21.2 bits (43), Expect(2) = 7e-12 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 363 PPPYKYPSP 371 Score = 70.1 bits (170), Expect(2) = 2e-11 Identities = 38/67 (56%), Positives = 41/67 (61%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP--YVYKPPTPPPYE--SPP---YVYKPPTPPPYVYES-PPYVY 24 Y Y P PP Y YKSPP Y Y P PPPY+ SPP Y YK P PP Y Y+S PP VY Sbjct: 278 YKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVY 337 Query: 23 KPPTPPP 3 K +PPP Sbjct: 338 KYNSPPP 344 Score = 21.9 bits (45), Expect(2) = 2e-11 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 231 PPPYYYHSP 239 Score = 70.1 bits (170), Expect(2) = 3e-11 Identities = 36/67 (53%), Positives = 39/67 (58%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE----SPPYVYKPPTPPPYVYES-PPYVY 24 Y Y P PPPY Y SPP Y YK P PP Y+ PPY Y P PP Y Y+S PP VY Sbjct: 493 YKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPVYKYKSPPPPVY 552 Query: 23 KPPTPPP 3 K +PPP Sbjct: 553 KYNSPPP 559 Score = 21.2 bits (43), Expect(2) = 3e-11 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 451 PPPYKYPSP 459 Score = 69.7 bits (169), Expect(2) = 4e-11 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE-----SPPYVYKPPTPPPYVYESPP--- 33 Y Y P PP Y YKSPP Y YK P PPPY+ PPY Y P PP Y Y+SPP Sbjct: 425 YKYNSPPPPVYKYKSPPPPVYKYKSP-PPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPV 483 Query: 32 YVYKPPTPP 6 Y YK P PP Sbjct: 484 YKYKSPPPP 492 Score = 21.2 bits (43), Expect(2) = 4e-11 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 402 PPPYKYPSP 410 Score = 69.7 bits (169), Expect(2) = 6e-11 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE-----SPPYVYKPPTPPPYVYESPP--- 33 Y Y P PP Y YKSPP Y YK P PPPY+ PPY Y P PP Y Y+SPP Sbjct: 464 YKYSSPPPPVYKYKSPPPPVYKYKSP-PPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPV 522 Query: 32 YVYKPPTPP 6 Y YK P PP Sbjct: 523 YKYKSPPPP 531 Score = 20.8 bits (42), Expect(2) = 6e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 430 PPPPVYKYKSP 440 Score = 67.8 bits (164), Expect(2) = 1e-10 Identities = 36/75 (48%), Positives = 38/75 (50%), Gaps = 17/75 (22%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSP-----PYVYKPPTPPPYE----SPPYVYKPPTPPPYVYE 42 Y + PP P PPY Y SP PY Y P PP Y+ PPY Y P PPPY Y Sbjct: 251 YYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYS 310 Query: 41 SPP---YVYKPPTPP 6 SPP Y YK P PP Sbjct: 311 SPPPPVYKYKSPPPP 325 Score = 21.9 bits (45), Expect(2) = 1e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 215 PPPYYYHSP 223 Score = 68.6 bits (166), Expect(2) = 1e-10 Identities = 37/69 (53%), Positives = 38/69 (55%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE-----SPPYVYKPPTPPPYVYESPP--- 33 Y Y P PP Y YKSPP Y YK P PPPY+ PPY Y P PP Y Y SPP Sbjct: 376 YKYPSPPPPVYKYKSPPPPVYKYKSP-PPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPV 434 Query: 32 YVYKPPTPP 6 Y YK P PP Sbjct: 435 YKYKSPPPP 443 Score = 68.6 bits (166), Expect(2) = 1e-10 Identities = 38/78 (48%), Positives = 39/78 (50%), Gaps = 20/78 (25%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-------------YVYKPPTPPPYE----SPPYVYKPPTPPPY 51 Y YK P PPPY Y SPP Y YK P PP Y+ PPY Y P PPPY Sbjct: 445 YKYKSP-PPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPY 503 Query: 50 VYESPP---YVYKPPTPP 6 Y SPP Y YK P PP Sbjct: 504 KYSSPPPPVYKYKSPPPP 521 Score = 20.8 bits (42), Expect(2) = 1e-10 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 342 PPPPVYKYKSP 352 Score = 20.8 bits (42), Expect(2) = 1e-10 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 440 PPPPVYKYKSP 450 Score = 67.0 bits (162), Expect(2) = 2e-10 Identities = 38/69 (55%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---PPYVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPP--- 33 Y YK P PPPY Y S PPY Y P PP Y+SPP Y YK P PP Y Y SPP Sbjct: 288 YKYKSP-PPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPV 346 Query: 32 YVYKPPTPP 6 Y YK P PP Sbjct: 347 YKYKSPPPP 355 Score = 21.9 bits (45), Expect(2) = 2e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 247 PPPYYYHSP 255 Score = 65.1 bits (157), Expect(2) = 6e-10 Identities = 34/70 (48%), Positives = 38/70 (54%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYV-YKPPTPPPYESPP-----YVYKPPTPPPYVYESPP 33 Y + PP P PPY Y SPP + PP P Y SPP Y Y P PP Y Y+SPP Sbjct: 235 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPP 294 Query: 32 YVYKPPTPPP 3 YK P+PPP Sbjct: 295 PPYKYPSPPP 304 Score = 21.9 bits (45), Expect(2) = 6e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 199 PPPYYYHSP 207 Score = 64.7 bits (156), Expect(2) = 2e-09 Identities = 38/78 (48%), Positives = 41/78 (52%), Gaps = 18/78 (23%) Frame = -3 Query: 185 HSYVYKPP------TPPPYVYK--SPP---YVYKPPTPPPYE----SPPYVYKPPTPPPY 51 + Y PP +PPP VYK SPP Y YK P PP Y+ PPY Y P PPPY Sbjct: 405 YKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPY 464 Query: 50 VYESPP---YVYKPPTPP 6 Y SPP Y YK P PP Sbjct: 465 KYSSPPPPVYKYKSPPPP 482 Score = 20.8 bits (42), Expect(2) = 2e-09 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 381 PPPPVYKYKSP 391 Score = 57.0 bits (136), Expect(2) = 2e-08 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 59 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 118 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 119 PPPYYYHSPPPPKHSPPPP 137 Score = 24.6 bits (52), Expect(2) = 2e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P PY Y+SP Sbjct: 36 PPPPKPYYYQSP 47 Score = 58.5 bits (140), Expect(2) = 5e-08 Identities = 34/84 (40%), Positives = 37/84 (44%), Gaps = 26/84 (30%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 203 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 262 Query: 62 PPPYVYESP-----PYVYKPPTPP 6 PPPY Y SP PY Y P PP Sbjct: 263 PPPYYYHSPPPPKNPYKYSSPPPP 286 Score = 21.9 bits (45), Expect(2) = 5e-08 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 167 PPPYYYHSP 175 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/77 (41%), Positives = 37/77 (48%), Gaps = 18/77 (23%) Frame = -3 Query: 182 SYVYKPPTPPP--YVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----TPP 57 +Y+Y P PPP Y Y+SPP Y Y P PP + PP Y + PP PP Sbjct: 29 NYIYSSPPPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPP 88 Query: 56 PYVYESPPYVYKPPTPP 6 PY Y SPP P PP Sbjct: 89 PYYYHSPPPPKHSPPPP 105 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 75 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 134 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 135 PPPYYYHSPPPPKHSPPPP 153 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 91 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 150 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 151 PPPYYYHSPPPPKHSPPPP 169 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 107 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 166 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 167 PPPYYYHSPPPPKHSPPPP 185 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 123 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 182 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 183 PPPYYYHSPPPPKHSPPPP 201 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 139 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 198 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 199 PPPYYYHSPPPPKHSPPPP 217 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 155 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 214 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 215 PPPYYYHSPPPPKHSPPPP 233 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 171 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 230 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 231 PPPYYYHSPPPPKHSPPPP 249 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 187 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 246 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 247 PPPYYYHSPPPPKHSPPPP 265 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 55 PPPYYYHSP 63 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 71 PPPYYYHSP 79 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 87 PPPYYYHSP 95 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 103 PPPYYYHSP 111 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 119 PPPYYYHSP 127 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 135 PPPYYYHSP 143 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 151 PPPYYYHSP 159 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 183 PPPYYYHSP 191 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/79 (40%), Positives = 34/79 (43%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 43 YYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 102 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 103 PPPYYYHSPPPPKHSPPPP 121 Score = 52.0 bits (123), Expect(2) = 7e-06 Identities = 28/55 (50%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 Y Y P PP Y YKSPP Y Y P PPP SPP PP Y+Y SPP Y Sbjct: 532 YKYPSPPPPVYKYKSPPPPVYKYNSP-PPPVHSPP-------PPHYIYASPPPPY 578 Score = 21.2 bits (43), Expect(2) = 7e-06 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 490 PPPYKYPSP 498 [10][TOP] >UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO Length = 225 Score = 79.7 bits (195), Expect(2) = 6e-15 Identities = 43/89 (48%), Positives = 46/89 (51%), Gaps = 27/89 (30%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPP----------------------YVYKPPTPPPYESPPYVY 75 H Y YK P PPP VYKSPP Y YK P PPP PPYVY Sbjct: 78 HKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVY 137 Query: 74 KPPTPPPYVYE----SPPYVYK-PPTPPP 3 K P PPP V++ SPP VYK PP+PPP Sbjct: 138 KSPPPPPSVHKYPPPSPPPVYKSPPSPPP 166 Score = 24.3 bits (51), Expect(2) = 6e-15 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y+SP Sbjct: 63 PPPPPYKYKSP 73 Score = 78.2 bits (191), Expect(2) = 2e-13 Identities = 39/66 (59%), Positives = 42/66 (63%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYKPPTPPPYVYESP------PYVYK 21 YK P PPP VYKSPP Y YK P PPP++ PY YK P PPP VY+SP PY YK Sbjct: 50 YKSPPPPPPVYKSPPPPPYKYKSPPPPPHK--PYKYKSPPPPPPVYKSPPPPPHKPYKYK 107 Query: 20 PPTPPP 3 P PPP Sbjct: 108 SPPPPP 113 Score = 76.3 bits (186), Expect(2) = 2e-13 Identities = 44/86 (51%), Positives = 46/86 (53%), Gaps = 28/86 (32%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP------YVYKPPTPPP--YESPP------YVYKPPTPP------ 57 VYK P PPPY YKSPP Y YK P PPP Y+SPP Y YK P PP Sbjct: 59 VYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHK 118 Query: 56 PYVYES--------PPYVYKPPTPPP 3 PY Y+S PPYVYK P PPP Sbjct: 119 PYKYKSPPPPPVYKPPYVYKSPPPPP 144 Score = 22.7 bits (47), Expect(2) = 2e-13 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 53 PPPPPPVYKSP 63 Score = 20.8 bits (42), Expect(2) = 2e-13 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP Y+SP Sbjct: 43 PPPPPPFYKSP 53 Score = 71.2 bits (173), Expect(2) = 6e-12 Identities = 40/69 (57%), Positives = 41/69 (59%), Gaps = 7/69 (10%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPY------ESPPYVYK-PPTPPPYVYESPPY 30 H Y YK P PPP VYK PPYVYK P PPP SPP VYK PP+PPP PY Sbjct: 117 HKPYKYKSPPPPP-VYK-PPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPP----KKPY 170 Query: 29 VYKPPTPPP 3 YK P PPP Sbjct: 171 KYKSPPPPP 179 Score = 22.7 bits (47), Expect(2) = 6e-12 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 86 PPPPPPVYKSP 96 Score = 73.6 bits (179), Expect = 7e-12 Identities = 40/79 (50%), Positives = 45/79 (56%), Gaps = 18/79 (22%) Frame = -3 Query: 185 HSYVYKPPTPP----PYVYKSPP-----YVYKPPTPPPYES---PPYVYKPPTPPPYVYE 42 ++Y Y P PP PY YKSPP + Y PP PP Y+S PP VYK P PPPY Y+ Sbjct: 12 NNYHYSSPPPPHYSPPYHYKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYK 71 Query: 41 SP------PYVYKPPTPPP 3 SP PY YK P PPP Sbjct: 72 SPPPPPHKPYKYKSPPPPP 90 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 38/71 (53%), Positives = 43/71 (60%), Gaps = 12/71 (16%) Frame = -3 Query: 179 YVYKPPTPPPYVYK----SPPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESP------- 36 YVYK P PPP V+K SPP VYK PP+PPP PY YK P PPP +++SP Sbjct: 135 YVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPP--KKPYKYKSPPPPP-IHKSPLPSPPKK 191 Query: 35 PYVYKPPTPPP 3 PY YK P P P Sbjct: 192 PYKYKYPPPTP 202 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 10/15 (66%), Positives = 11/15 (73%), Gaps = 3/15 (20%) Frame = -2 Query: 219 PPTP---PPYVYESP 184 PP P PPYVY+SP Sbjct: 126 PPPPVYKPPYVYKSP 140 Score = 69.3 bits (168), Expect = 1e-10 Identities = 42/78 (53%), Positives = 46/78 (58%), Gaps = 16/78 (20%) Frame = -3 Query: 188 HHS--YVYKPPTPPPYVYK---SPPYVYKPPTPPP--YES---PPYVYKPPTPP---PYV 48 H+S Y YK P PPP V+K PP YK P PPP Y+S PPY YK P PP PY Sbjct: 23 HYSPPYHYKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYK 82 Query: 47 YES---PPYVYKPPTPPP 3 Y+S PP VYK P PPP Sbjct: 83 YKSPPPPPPVYKSPPPPP 100 Score = 64.7 bits (156), Expect(2) = 8e-10 Identities = 39/76 (51%), Positives = 44/76 (57%), Gaps = 19/76 (25%) Frame = -3 Query: 173 YKPPTPPPYVYKSPP-------YVYKPPTPPP-YESP-------PYVYKPPTPPPYVYES 39 Y PP+PPP VYKSPP Y YK P PPP ++SP PY YK P P P VY+S Sbjct: 149 YPPPSPPP-VYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPPKKPYKYKYPPPTP-VYKS 206 Query: 38 PP----YVYKPPTPPP 3 PP Y+Y P PPP Sbjct: 207 PPPPHHYLYTSPPPPP 222 Score = 21.9 bits (45), Expect(2) = 8e-10 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 2/14 (14%) Frame = -2 Query: 219 PPTPP--PYVYESP 184 PP PP PY Y+SP Sbjct: 96 PPPPPHKPYKYKSP 109 [11][TOP] >UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN Length = 432 Score = 79.7 bits (195), Expect(2) = 1e-14 Identities = 39/66 (59%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y YK P PP Y YKSPP YK P+PPP Y SPP Y YK P PP Y Y+SPP YK Sbjct: 258 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYK 317 Query: 20 PPTPPP 3 P+PPP Sbjct: 318 YPSPPP 323 Score = 79.7 bits (195), Expect(2) = 1e-14 Identities = 39/66 (59%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y YK P PP Y YKSPP YK P+PPP Y SPP Y YK P PP Y Y+SPP YK Sbjct: 297 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYK 356 Query: 20 PPTPPP 3 P+PPP Sbjct: 357 YPSPPP 362 Score = 23.5 bits (49), Expect(2) = 1e-14 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 243 PPPPPYKYPSP 253 Score = 23.5 bits (49), Expect(2) = 1e-14 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 282 PPPPPYKYPSP 292 Score = 79.3 bits (194), Expect(2) = 1e-14 Identities = 36/59 (61%), Positives = 39/59 (66%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y YK P PP Y YKSPP YK P+PPP PPY Y P PP Y Y+SPP YK P+PPP Sbjct: 336 YKYKSPPPPVYKYKSPPPPYKYPSPPP---PPYKYPSPPPPVYKYKSPPPPYKYPSPPP 391 Score = 23.5 bits (49), Expect(2) = 1e-14 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 321 PPPPPYKYPSP 331 Score = 77.4 bits (189), Expect(2) = 1e-13 Identities = 38/66 (57%), Positives = 41/66 (62%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y Y P PP Y YKSPP YK P+PPP Y SPP Y YK P PP Y Y+SPP YK Sbjct: 219 YKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYK 278 Query: 20 PPTPPP 3 P+PPP Sbjct: 279 YPSPPP 284 Score = 22.3 bits (46), Expect(2) = 1e-13 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y+SP Sbjct: 203 PPPYYYKSP 211 Score = 67.4 bits (163), Expect(2) = 4e-11 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 7/65 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP--YVYKPPTPPPYE---SPPYVYKPPTPPPYVYESPP--YVYK 21 Y Y P PP Y YKSPP Y Y P PPPY+ PP VYK +PPP V+ PP Y+Y Sbjct: 365 YKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPPPPHYIYA 424 Query: 20 PPTPP 6 P PP Sbjct: 425 SPPPP 429 Score = 23.5 bits (49), Expect(2) = 4e-11 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 360 PPPPPYKYPSP 370 Score = 68.2 bits (165), Expect(2) = 8e-11 Identities = 35/73 (47%), Positives = 39/73 (53%), Gaps = 14/73 (19%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPPYVYKPPTPPPYVYE 42 Y + PP P PPY Y SPP Y YK P PPP + PY Y P PP Y Y+ Sbjct: 175 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSPPPPPKK--PYKYPSPPPPVYKYK 232 Query: 41 SPPYVYKPPTPPP 3 SPP YK P+PPP Sbjct: 233 SPPPPYKYPSPPP 245 Score = 21.9 bits (45), Expect(2) = 8e-11 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 139 PPPYYYHSP 147 Score = 68.2 bits (165), Expect(2) = 1e-10 Identities = 35/62 (56%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKPPT 12 Y Y P PPPY Y SPP VYK +PP PPY Y P PPPY Y SPP Y YK P Sbjct: 355 YKYPSPPPPPYKYPSPPPPVYKYKSPP----PPYKYPSPPPPPYKYPSPPPPVYKYKSPP 410 Query: 11 PP 6 PP Sbjct: 411 PP 412 Score = 67.4 bits (163), Expect(2) = 1e-10 Identities = 39/76 (51%), Positives = 42/76 (55%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP----YVYKPPTPPP----YESPPYVYK--PPTPPPYVY 45 Y + PP P PPY YKSPP YK P+PPP Y+SPP YK P PPPY Y Sbjct: 191 YYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKY 250 Query: 44 ESPP---YVYKPPTPP 6 SPP Y YK P PP Sbjct: 251 PSPPPPVYKYKSPPPP 266 Score = 21.9 bits (45), Expect(2) = 1e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 155 PPPYYYHSP 163 Score = 21.2 bits (43), Expect(2) = 1e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 313 PPPYKYPSP 321 Score = 67.0 bits (162), Expect(2) = 3e-10 Identities = 36/70 (51%), Positives = 38/70 (54%), Gaps = 10/70 (14%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYE----SPPYVYKPPTPPPYVYESPP-- 33 + Y PP PPY Y SPP Y YK P PP Y+ PPY Y P PPPY Y SPP Sbjct: 238 YKYPSPPP--PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPP 295 Query: 32 -YVYKPPTPP 6 Y YK P PP Sbjct: 296 VYKYKSPPPP 305 Score = 67.0 bits (162), Expect(2) = 3e-10 Identities = 36/70 (51%), Positives = 38/70 (54%), Gaps = 10/70 (14%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYE----SPPYVYKPPTPPPYVYESPP-- 33 + Y PP PPY Y SPP Y YK P PP Y+ PPY Y P PPPY Y SPP Sbjct: 316 YKYPSPPP--PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPP 373 Query: 32 -YVYKPPTPP 6 Y YK P PP Sbjct: 374 VYKYKSPPPP 383 Score = 21.2 bits (43), Expect(2) = 3e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 235 PPPYKYPSP 243 Score = 21.2 bits (43), Expect(2) = 3e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 274 PPPYKYPSP 282 Score = 62.0 bits (149), Expect(2) = 5e-09 Identities = 36/89 (40%), Positives = 39/89 (43%), Gaps = 30/89 (33%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPPTP---- 60 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP P Sbjct: 127 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 186 Query: 59 -PPYVYESPP---------YVYKPPTPPP 3 PPY Y SPP Y YK P PPP Sbjct: 187 PPPYYYHSPPPPKHSPPPPYYYKSPPPPP 215 Score = 21.9 bits (45), Expect(2) = 5e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 91 PPPYYYHSP 99 Score = 60.5 bits (145), Expect(2) = 1e-08 Identities = 35/84 (41%), Positives = 40/84 (47%), Gaps = 25/84 (29%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPPTP---- 60 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP P Sbjct: 143 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 202 Query: 59 -PPYVYESPP----YVYKPPTPPP 3 PPY Y+SPP YK P+PPP Sbjct: 203 PPPYYYKSPPPPPKKPYKYPSPPP 226 Score = 21.9 bits (45), Expect(2) = 1e-08 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 107 PPPYYYHSP 115 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 47 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 106 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 107 PPPYYYHSPPPPKHSPPPP 125 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 63 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 122 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 123 PPPYYYHSPPPPKHSPPPP 141 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 79 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 138 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 139 PPPYYYHSPPPPKHSPPPP 157 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 43 PPPYYYHSP 51 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 59 PPPYYYHSP 67 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 75 PPPYYYHSP 83 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/66 (43%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPP--YVYKPPTP-----PPYVYESPPYVY 24 +Y+Y P PPP PPY Y P PP + PP Y + PP P PPY Y SPP Sbjct: 29 NYIYSSP-PPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPK 87 Query: 23 KPPTPP 6 P PP Sbjct: 88 HSPPPP 93 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 95 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 154 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 155 PPPYYYHSPPPPKHSPPPP 173 Score = 55.1 bits (131), Expect(2) = 9e-07 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 Y Y P PPPY Y SPP Y YK P PPP SPP PP Y+Y SPP Y Sbjct: 384 YKYPSPPPPPYKYPSPPPPVYKYKSP-PPPVHSPP-------PPHYIYASPPPPY 430 Score = 21.2 bits (43), Expect(2) = 9e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 352 PPPYKYPSP 360 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/73 (41%), Positives = 32/73 (43%), Gaps = 15/73 (20%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP----------YVYKPPTPPPYESPPYVYKPPTPPPYVY 45 Y + PP P PPY Y SPP Y + PP P PPY Y P PPP Sbjct: 111 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSP-PPPKHS 169 Query: 44 ESPPYVYKPPTPP 6 PPY Y P PP Sbjct: 170 PPPPYYYHSPPPP 182 [12][TOP] >UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max RepID=Q39864_SOYBN Length = 199 Score = 79.7 bits (195), Expect(2) = 1e-14 Identities = 39/66 (59%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y YK P PP Y YKSPP YK P+PPP Y SPP Y YK P PP Y Y+SPP YK Sbjct: 45 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYK 104 Query: 20 PPTPPP 3 P+PPP Sbjct: 105 YPSPPP 110 Score = 23.5 bits (49), Expect(2) = 1e-14 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 30 PPPPPYKYPSP 40 Score = 77.8 bits (190), Expect(2) = 4e-14 Identities = 38/66 (57%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y YK P PP Y YKSPP YK P+PPP Y SPP Y YK P PP Y Y+SPP +K Sbjct: 84 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHK 143 Query: 20 PPTPPP 3 P+PPP Sbjct: 144 YPSPPP 149 Score = 23.5 bits (49), Expect(2) = 4e-14 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 69 PPPPPYKYPSP 79 Score = 77.4 bits (189), Expect(2) = 5e-14 Identities = 35/59 (59%), Positives = 39/59 (66%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y YK P PP Y YKSPP +K P+PPP PPY Y P PP Y Y+SPP YK P+PPP Sbjct: 123 YKYKSPPPPVYKYKSPPPPHKYPSPPP---PPYKYPSPPPPVYKYKSPPPPYKYPSPPP 178 Score = 23.5 bits (49), Expect(2) = 5e-14 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 108 PPPPPYKYPSP 118 Score = 77.4 bits (189), Expect = 5e-13 Identities = 38/66 (57%), Positives = 41/66 (62%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPPYVYK 21 Y Y P PP Y YKSPP YK P+PPP Y SPP Y YK P PP Y Y+SPP YK Sbjct: 6 YKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYK 65 Query: 20 PPTPPP 3 P+PPP Sbjct: 66 YPSPPP 71 Score = 68.9 bits (167), Expect(2) = 8e-11 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE-----SPPYVYKPPTPPPYVYESPP--- 33 Y Y P PP Y YKSPP Y YK P PPPY+ PPY Y P PP Y Y+SPP Sbjct: 74 YKYPSPPPPVYKYKSPPPPVYKYKSP-PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 132 Query: 32 YVYKPPTPP 6 Y YK P PP Sbjct: 133 YKYKSPPPP 141 Score = 21.2 bits (43), Expect(2) = 8e-11 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 61 PPPYKYPSP 69 Score = 67.0 bits (162), Expect(2) = 3e-10 Identities = 36/70 (51%), Positives = 38/70 (54%), Gaps = 10/70 (14%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYE----SPPYVYKPPTPPPYVYESPP-- 33 + Y PP PPY Y SPP Y YK P PP Y+ PPY Y P PPPY Y SPP Sbjct: 25 YKYPSPPP--PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPP 82 Query: 32 -YVYKPPTPP 6 Y YK P PP Sbjct: 83 VYKYKSPPPP 92 Score = 21.2 bits (43), Expect(2) = 3e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 22 PPPYKYPSP 30 Score = 66.2 bits (160), Expect(2) = 5e-10 Identities = 34/60 (56%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKPPTPP 6 Y P PPPY Y SPP VYK +PP PPY Y P PPPY Y SPP Y YK P PP Sbjct: 144 YPSPPPPPYKYPSPPPPVYKYKSPP----PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 199 Score = 21.2 bits (43), Expect(2) = 5e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 100 PPPYKYPSP 108 Score = 65.1 bits (157), Expect(2) = 1e-09 Identities = 35/70 (50%), Positives = 38/70 (54%), Gaps = 10/70 (14%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYE----SPPYVYKPPTPPPYVYESPP-- 33 + Y PP PPY Y SPP Y YK P PP Y+ PP+ Y P PPPY Y SPP Sbjct: 103 YKYPSPPP--PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPP 160 Query: 32 -YVYKPPTPP 6 Y YK P PP Sbjct: 161 VYKYKSPPPP 170 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 79 PPPPVYKYKSP 89 Score = 63.5 bits (153), Expect(2) = 4e-09 Identities = 32/60 (53%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPP--YVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP 33 PH + YK P+PPP Y YKSPP YK P+PPP PPY Y P PP Y Y+SPP Sbjct: 141 PHKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPP---PPYKYPSPPPPVYKYKSPP 197 Score = 20.8 bits (42), Expect(2) = 4e-09 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 118 PPPPVYKYKSP 128 [13][TOP] >UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY Length = 311 Score = 78.6 bits (192), Expect(2) = 2e-14 Identities = 42/67 (62%), Positives = 44/67 (65%), Gaps = 9/67 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYES-PPYV 27 Y YK P PPP VYKSPP Y YK P PPP Y+SPP Y YK P PPP VY+S PP V Sbjct: 232 YKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPV 291 Query: 26 YKPPTPP 6 YK P PP Sbjct: 292 YKSPPPP 298 Score = 23.5 bits (49), Expect(2) = 2e-14 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 216 PPPPPVYKYKSP 227 Score = 78.2 bits (191), Expect(2) = 5e-14 Identities = 41/72 (56%), Positives = 45/72 (62%), Gaps = 13/72 (18%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPP- 33 Y YK P PPP +YKSPP Y +K P PPP Y+SPP Y YK P PPP VY+SPP Sbjct: 190 YKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPP 249 Query: 32 --YVYKPPTPPP 3 Y YK P PPP Sbjct: 250 PIYKYKSPPPPP 261 Score = 22.7 bits (47), Expect(2) = 5e-14 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 145 PPPPPPVYKSP 155 Score = 77.0 bits (188), Expect(2) = 2e-13 Identities = 43/73 (58%), Positives = 45/73 (61%), Gaps = 15/73 (20%) Frame = -3 Query: 176 VYK----PPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYESPP 33 VYK PP PP Y YKSPP Y YK P PPP Y+SPP Y YK P PPP VY+SPP Sbjct: 209 VYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPP 268 Query: 32 ---YVYKPPTPPP 3 Y YK P PPP Sbjct: 269 PPVYKYKSPPPPP 281 Score = 21.6 bits (44), Expect(2) = 2e-13 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP +Y+SP Sbjct: 195 PPPPPPMYKSP 205 Score = 77.4 bits (189), Expect(2) = 3e-13 Identities = 40/70 (57%), Positives = 42/70 (60%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE-----SPPYVYKPPTPPPYVYESPP--- 33 Y YK P PPP VYKSPP Y YK P PP Y+ PP VYK P PP Y Y+SPP Sbjct: 80 YKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPV 139 Query: 32 YVYKPPTPPP 3 Y YK P PPP Sbjct: 140 YKYKSPPPPP 149 Score = 20.8 bits (42), Expect(2) = 3e-13 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 45 PPPPVYKYKSP 55 Score = 75.1 bits (183), Expect(2) = 4e-13 Identities = 39/63 (61%), Positives = 41/63 (65%), Gaps = 4/63 (6%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-PPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKPPT 12 Y YK P PPP VYKS PP VYK +PPP P Y YK P PPP VY+SPP Y YK P Sbjct: 110 YKYKSPPPPPPVYKSPPPPVYKYKSPPP---PVYKYKSPPPPPPVYKSPPPPVYKYKSPP 166 Query: 11 PPP 3 PPP Sbjct: 167 PPP 169 Score = 75.1 bits (183), Expect(2) = 4e-13 Identities = 40/68 (58%), Positives = 43/68 (63%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYESPP---Y 30 VYK P PP Y YKSPP Y YK P PPP Y+SPP Y YK P PPP V++SPP Y Sbjct: 121 VYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIY 180 Query: 29 VYKPPTPP 6 YK P PP Sbjct: 181 KYKSPPPP 188 Score = 22.7 bits (47), Expect(2) = 4e-13 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 85 PPPPPPVYKSP 95 Score = 22.7 bits (47), Expect(2) = 4e-13 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 115 PPPPPPVYKSP 125 Score = 75.1 bits (183), Expect(2) = 2e-12 Identities = 41/80 (51%), Positives = 45/80 (56%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPP------------YESPP---YVYKPPTPPP 54 Y YK P PPP VYKSPP Y YK P PPP Y+SPP Y YK P PPP Sbjct: 140 YKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPP 199 Query: 53 YVYESPP---YVYKPPTPPP 3 +Y+SPP Y +K P PPP Sbjct: 200 PMYKSPPPPVYKHKSPPPPP 219 Score = 20.8 bits (42), Expect(2) = 2e-12 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 95 PPPPVYKYKSP 105 Score = 72.0 bits (175), Expect = 2e-11 Identities = 37/70 (52%), Positives = 41/70 (58%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE-----SPPYVYKPPTPPPYVYESPP--- 33 Y YK P PP +Y+SPP Y YK P PP Y+ PP VYK P PP Y Y+SPP Sbjct: 50 YKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPV 109 Query: 32 YVYKPPTPPP 3 Y YK P PPP Sbjct: 110 YKYKSPPPPP 119 Score = 72.0 bits (175), Expect = 2e-11 Identities = 38/68 (55%), Positives = 42/68 (61%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYES---PPY 30 +Y+ P PP Y YKSPP Y YK P PPP Y+SPP Y YK P PP Y Y+S PP Sbjct: 61 IYRSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPP 120 Query: 29 VYKPPTPP 6 VYK P PP Sbjct: 121 VYKSPPPP 128 Score = 70.9 bits (172), Expect(2) = 3e-11 Identities = 42/82 (51%), Positives = 45/82 (54%), Gaps = 23/82 (28%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-------------YVYKPPTPPP--YES-PPYVYK----PPTP 60 Y YK P PPP V+KSPP Y YK P PPP Y+S PP VYK PP P Sbjct: 160 YKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPP 219 Query: 59 PPYVYESPP---YVYKPPTPPP 3 P Y Y+SPP Y YK P PPP Sbjct: 220 PVYKYKSPPPPVYKYKSPPPPP 241 Score = 20.8 bits (42), Expect(2) = 3e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 125 PPPPVYKYKSP 135 Score = 68.2 bits (165), Expect(2) = 5e-11 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y YK P PPP VYKSPP VYK +PPP PP VYK P PP Y PPY Y +PPP Sbjct: 252 YKYKSPPPPPPVYKSPPPPVYKYKSPPP---PPPVYKSPPPPVYKSPPPPYHYYYTSPPP 308 Score = 22.7 bits (47), Expect(2) = 5e-11 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 237 PPPPPPVYKSP 247 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 40/72 (55%), Positives = 44/72 (61%), Gaps = 14/72 (19%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYE---SPPY 30 V+K P PP Y YKSPP Y YK P PPP Y+SPP Y +K P PPP VY+ PP Sbjct: 171 VHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPP 230 Query: 29 VYK---PPTPPP 3 VYK PP PPP Sbjct: 231 VYKYKSPPPPPP 242 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 135 PPPPVYKYKSP 145 Score = 65.9 bits (159), Expect = 1e-09 Identities = 39/88 (44%), Positives = 43/88 (48%), Gaps = 21/88 (23%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPP---YVYKPPTPP------------PYESPP---Y 81 P C ++ Y PP YVY SPP Y YK P PP Y+SPP Y Sbjct: 21 PLECKANYYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVY 80 Query: 80 VYKPPTPPPYVYESPP---YVYKPPTPP 6 YK P PPP VY+SPP Y YK P PP Sbjct: 81 KYKSPPPPPPVYKSPPPPVYKYKSPPPP 108 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPTPPPYESPP--YVYKPPTPPPYVY 45 VYK P PP Y YKSPP VYK P PP Y+SPP Y Y +PPP Y Sbjct: 263 VYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPPPYHYYYTSPPPPHY 311 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 257 PPPPPPVYKSP 267 [14][TOP] >UniRef100_Q9FSG0 Extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG0_NICSY Length = 161 Score = 78.6 bits (192), Expect(2) = 2e-14 Identities = 42/67 (62%), Positives = 44/67 (65%), Gaps = 9/67 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYES-PPYV 27 Y YK P PPP VYKSPP Y YK P PPP Y+SPP Y YK P PPP VY+S PP V Sbjct: 82 YKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPV 141 Query: 26 YKPPTPP 6 YK P PP Sbjct: 142 YKSPPPP 148 Score = 23.5 bits (49), Expect(2) = 2e-14 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 66 PPPPPVYKYKSP 77 Score = 77.8 bits (190), Expect = 3e-13 Identities = 41/72 (56%), Positives = 44/72 (61%), Gaps = 13/72 (18%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPP----YESPP---YVYKPPTPPPYVYESPP- 33 YVY P PP Y YKSPP Y +K P PPP Y+SPP Y YK P PPP VY+SPP Sbjct: 40 YVYSSPPPPVYKYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPP 99 Query: 32 --YVYKPPTPPP 3 Y YK P PPP Sbjct: 100 PIYKYKSPPPPP 111 Score = 77.0 bits (188), Expect(2) = 4e-13 Identities = 43/73 (58%), Positives = 45/73 (61%), Gaps = 15/73 (20%) Frame = -3 Query: 176 VYK----PPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYESPP 33 VYK PP PP Y YKSPP Y YK P PPP Y+SPP Y YK P PPP VY+SPP Sbjct: 59 VYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPP 118 Query: 32 ---YVYKPPTPPP 3 Y YK P PPP Sbjct: 119 PPVYKYKSPPPPP 131 Score = 20.8 bits (42), Expect(2) = 4e-13 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 45 PPPPVYKYKSP 55 Score = 68.2 bits (165), Expect(2) = 5e-11 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y YK P PPP VYKSPP VYK +PPP PP VYK P PP Y PPY Y +PPP Sbjct: 102 YKYKSPPPPPPVYKSPPPPVYKYKSPPP---PPPVYKSPPPPVYKSPPPPYHYYYTSPPP 158 Score = 22.7 bits (47), Expect(2) = 5e-11 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 87 PPPPPPVYKSP 97 Score = 63.5 bits (153), Expect = 7e-09 Identities = 34/74 (45%), Positives = 39/74 (52%), Gaps = 6/74 (8%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYKPPTPPPYVYESP 36 P C ++ Y PP YVY SPP Y YK P PP Y+ + PP PP Y Y+SP Sbjct: 21 PLECKANYYYSSPPPPTKKYVYSSPPPPVYKYKSPPPPVYK---HKSPPPPPPVYKYKSP 77 Query: 35 P---YVYKPPTPPP 3 P Y YK P PPP Sbjct: 78 PPPVYKYKSPPPPP 91 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPTPPPYESPP--YVYKPPTPPPYVY 45 VYK P PP Y YKSPP VYK P PP Y+SPP Y Y +PPP Y Sbjct: 113 VYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPPPYHYYYTSPPPPHY 161 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 107 PPPPPPVYKSP 117 [15][TOP] >UniRef100_Q39866 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max RepID=Q39866_SOYBN Length = 118 Score = 75.9 bits (185), Expect(2) = 2e-14 Identities = 41/74 (55%), Positives = 42/74 (56%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 YVYK P PP PY+YKSPP YVYK P PP P PPYVYK P PPP Sbjct: 7 YVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSP-PPPSP 65 Query: 47 YESPPYVYKPPTPP 6 PPYVYK P PP Sbjct: 66 SPPPPYVYKSPPPP 79 Score = 26.2 bits (56), Expect(2) = 2e-14 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 1 PSPPPPYVYKSP 12 Score = 73.9 bits (180), Expect(2) = 1e-13 Identities = 43/89 (48%), Positives = 45/89 (50%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPP--- 57 Y+YK P PP PYVYKSPP YVYK P PP P PPYVYK P PP Sbjct: 23 YIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPS 82 Query: 56 ---PYVYES---------PPYVYKPPTPP 6 PY Y+S PPY YK P PP Sbjct: 83 PPSPYYYKSPPPPSPSPPPPYYYKSPPPP 111 Score = 25.8 bits (55), Expect(2) = 1e-13 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y+SP Sbjct: 17 PSPPPPYIYKSP 28 Score = 63.9 bits (154), Expect = 5e-09 Identities = 36/71 (50%), Positives = 38/71 (53%), Gaps = 17/71 (23%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYES--PPYVYK------PPTPPPYVYES--------- 39 P PPPYVYKSPP PP S PPY+YK P PPPYVY+S Sbjct: 1 PSPPPPYVYKSPP--------PPSPSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPP 52 Query: 38 PPYVYKPPTPP 6 PPYVYK P PP Sbjct: 53 PPYVYKSPPPP 63 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 30/65 (46%), Positives = 33/65 (50%), Gaps = 6/65 (9%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 YVYK P PP PY YKSPP PP+P P PPPY Y+SPP P Sbjct: 71 YVYKSPPPPSPSPPSPYYYKSPP----PPSPSP------------PPPYYYKSPP----P 110 Query: 17 PTPPP 3 P+P P Sbjct: 111 PSPSP 115 Score = 26.2 bits (56), Expect(2) = 2e-07 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 33 PSPPPPYVYKSP 44 [16][TOP] >UniRef100_Q2A9D3 Extensin, putative n=1 Tax=Brassica oleracea RepID=Q2A9D3_BRAOL Length = 509 Score = 77.4 bits (189), Expect(2) = 4e-14 Identities = 42/88 (47%), Positives = 44/88 (50%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSP---------PYVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY + SP PYVY P PPPY SP PYVY P P Sbjct: 293 YVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPP 352 Query: 59 PPY-------VYES--PPYVYKPPTPPP 3 PPY VY+S PPYVY P PPP Sbjct: 353 PPYYSPSPKMVYKSPPPPYVYSSPPPPP 380 Score = 23.9 bits (50), Expect(2) = 4e-14 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 264 PPPYVYSSP 272 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 40/78 (51%), Positives = 40/78 (51%), Gaps = 20/78 (25%) Frame = -3 Query: 179 YVYKPPTPPPY-------VYKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY VYKSPP YVY P PPPY SP PYVY P P Sbjct: 345 YVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPP 404 Query: 59 PPYVYESPPYVYKPPTPP 6 PPY SP YK P PP Sbjct: 405 PPYYSPSPKVNYKSPPPP 422 Score = 23.9 bits (50), Expect(2) = 2e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 316 PPPYVYSSP 324 Score = 72.0 bits (175), Expect(2) = 1e-12 Identities = 38/79 (48%), Positives = 39/79 (49%), Gaps = 20/79 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PP + YKSPP YVY P PPPY SP PYVY P P Sbjct: 423 YVYSSPPPPQFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 482 Query: 59 PPYVYESPPYVYKPPTPPP 3 PPY SP YK P PPP Sbjct: 483 PPYYSPSPKVYYKSPPPPP 501 Score = 23.9 bits (50), Expect(2) = 1e-12 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 394 PPPYVYSSP 402 Score = 70.5 bits (171), Expect(2) = 4e-12 Identities = 42/89 (47%), Positives = 42/89 (47%), Gaps = 30/89 (33%) Frame = -3 Query: 179 YVYKPPTPPPYV---------YKSPPYVYKPPTPPPYESP-PYV-YKPPTPPPYVYES-- 39 YVY P PPPY Y PPYVY P PPPY SP P V YK P PPPYVY S Sbjct: 371 YVYSSPPPPPYYSPSPKVNYKYPPPPYVYSSPPPPPYYSPSPKVNYKSP-PPPYVYSSPP 429 Query: 38 -----------------PPYVYKPPTPPP 3 PPYVY P PPP Sbjct: 430 PPQFYSPSPKAEYKSPPPPYVYSSPPPPP 458 Score = 23.9 bits (50), Expect(2) = 4e-12 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 342 PPPYVYSSP 350 Score = 69.3 bits (168), Expect(2) = 9e-12 Identities = 38/78 (48%), Positives = 38/78 (48%), Gaps = 20/78 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPY SP PYVY P P Sbjct: 145 YVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPP 204 Query: 59 PPYVYESPPYVYKPPTPP 6 PPY SP YK P PP Sbjct: 205 PPYYSPSPKVDYKSPPPP 222 Score = 23.9 bits (50), Expect(2) = 9e-12 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 142 PPPYVYNSP 150 Score = 71.6 bits (174), Expect(2) = 1e-11 Identities = 38/84 (45%), Positives = 39/84 (46%), Gaps = 29/84 (34%) Frame = -3 Query: 167 PPTPPPYVYKSP---------PYVYKPPTPPPYESP-----------PYVYKPPTPPPYV 48 PP PPPY SP PYVY P PPPY SP PYVY P PPPY Sbjct: 245 PPPPPPYYSPSPKVEYNSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYY 304 Query: 47 YES---------PPYVYKPPTPPP 3 + S PPYVY P PPP Sbjct: 305 FPSPKVDYKSPPPPYVYSSPPPPP 328 Score = 21.2 bits (43), Expect(2) = 1e-11 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 210 PPPYVYES 187 PPPYVY S Sbjct: 220 PPPYVYSS 227 Score = 68.2 bits (165), Expect(2) = 2e-11 Identities = 38/79 (48%), Positives = 38/79 (48%), Gaps = 20/79 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPY YKSPP YVY P PPPY SP PYVY P Sbjct: 171 YVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSLPP 230 Query: 59 PPYVYESPPYVYKPPTPPP 3 PPY SP YK P PPP Sbjct: 231 PPYYSPSPEVDYKSPPPPP 249 Score = 23.9 bits (50), Expect(2) = 2e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 168 PPPYVYSSP 176 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 41/90 (45%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 319 YVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPP 378 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 379 P--PYYSPSPKVNYKYPPPPYVYSSPPPPP 406 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/61 (55%), Positives = 35/61 (57%), Gaps = 11/61 (18%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPY--ESPPYVYKPPTPPPYVYESPP 33 YVY P PPPY YKSPP YVY P PPPY SP YK P PPPYVY+ P Sbjct: 449 YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKMPY 508 Query: 32 Y 30 Y Sbjct: 509 Y 509 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 290 PPPYVYNSP 298 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 420 PPPYVYSSP 428 Score = 67.0 bits (162), Expect(2) = 1e-10 Identities = 34/70 (48%), Positives = 35/70 (50%), Gaps = 12/70 (17%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK-PPTPPPYESP-----------PYVYKPPTPPPYVYESP 36 Y+Y PPPY SP YK PP PPPY SP PYVY P PPPY SP Sbjct: 101 YIYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSP 160 Query: 35 PYVYKPPTPP 6 YK P PP Sbjct: 161 KVEYKSPPPP 170 Score = 22.3 bits (46), Expect(2) = 1e-10 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PY+Y SP Sbjct: 70 PHPKPYIYSSP 80 Score = 65.1 bits (157), Expect(2) = 2e-10 Identities = 40/90 (44%), Positives = 40/90 (44%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPY-----------ESPPYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY PPYVY P P Sbjct: 267 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYFPSPKVDYKSPPPPYVYSSPPP 326 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 327 P--PYYSPSPKVYYKSPPPPYVYSSPPPPP 354 Score = 23.5 bits (49), Expect(2) = 2e-10 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 219 PPTPPPYVYESPLI 178 PP PPPY SP + Sbjct: 245 PPPPPPYYSPSPKV 258 Score = 67.4 bits (163), Expect(2) = 3e-10 Identities = 39/84 (46%), Positives = 39/84 (46%), Gaps = 29/84 (34%) Frame = -3 Query: 167 PPTPPPYV-------YKSPP--YVYKPPTPPPYES-----------PPYVYKPPTPPPYV 48 PP PPPY YKSPP YVY P PPPY S PPYVY P PPY Sbjct: 123 PPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVEYKSPPPPYVYSSPPLPPYY 182 Query: 47 YES---------PPYVYKPPTPPP 3 S PPYVY P PPP Sbjct: 183 SPSPKVDYKSPPPPYVYSSPPPPP 206 Score = 20.8 bits (42), Expect(2) = 3e-10 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -2 Query: 210 PPPYVYES 187 PPPY+Y S Sbjct: 98 PPPYIYSS 105 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 37/80 (46%), Positives = 37/80 (46%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK-PPTPPPYESP-PYVYKPPTPPPYVYES----------- 39 YVY PPPY SP YK PP PPPY SP P V PPPYVY S Sbjct: 223 YVYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSPKVEYNSPPPPYVYSSPPPPPYYSPSP 282 Query: 38 --------PPYVYKPPTPPP 3 PPYVY P PPP Sbjct: 283 KVEYKSPPPPYVYNSPPPPP 302 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 194 PPPYVYSSP 202 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 39/90 (43%), Positives = 40/90 (44%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PP + SP PYVY P P Sbjct: 397 YVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPQFYSPSPKAEYKSPPPPYVYSSPPP 456 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 457 P--PYYSPSPKVDYKSPPPPYVYSSPPPPP 484 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 368 PPPYVYSSP 376 Score = 62.8 bits (151), Expect = 1e-08 Identities = 37/80 (46%), Positives = 39/80 (48%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-PYV-YKPPTPPPYVYE--- 42 Y+Y P PP Y YKSPP Y+Y PPPY SP P V YK P PPP Y Sbjct: 75 YIYSSPPPPSYYSPSPKVEYKSPPPPYIYSSLPPPPYYSPSPEVDYKSPPPPPPYYSPSP 134 Query: 41 -------SPPYVYKPPTPPP 3 PPYVY P PPP Sbjct: 135 KVEYKSPPPPYVYNSPPPPP 154 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/87 (36%), Positives = 37/87 (42%), Gaps = 19/87 (21%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPP--------YVYKSPPYVYKPPTPPPYESP-----------P 84 P+ + Y PP+PPP Y PY+Y P PP Y SP P Sbjct: 41 PYQPKKNSPYYSAPPSPPPQYRRQGPKYTPHPKPYIYSSPPPPSYYSPSPKVEYKSPPPP 100 Query: 83 YVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y+Y PPPY SP YK P PPP Sbjct: 101 YIYSSLPPPPYYSPSPEVDYKSPPPPP 127 [17][TOP] >UniRef100_Q8H9E1 Extensin (Fragment) n=1 Tax=Solanum tuberosum RepID=Q8H9E1_SOLTU Length = 152 Score = 75.1 bits (183), Expect(2) = 4e-14 Identities = 41/77 (53%), Positives = 42/77 (54%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 YVYK P PP PY YKSPP Y YK P PP P PPY YK P PPP V Sbjct: 15 YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPPV 74 Query: 47 YESPP---YVYKPPTPP 6 Y+SPP Y YK P PP Sbjct: 75 YKSPPPPVYKYKSPPPP 91 Score = 26.2 bits (56), Expect(2) = 4e-14 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 9 PSLPPPYVYKSP 20 Score = 73.9 bits (180), Expect(2) = 3e-13 Identities = 40/71 (56%), Positives = 42/71 (59%), Gaps = 13/71 (18%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP-----YVYKPPTPPPYVYESPP- 33 Y YK P PPP VYKSPP Y YK P PP Y+SPP Y YK P PP Y Y+SPP Sbjct: 63 YYYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPP 122 Query: 32 --YVYKPPTPP 6 Y YK P PP Sbjct: 123 PVYKYKSPPPP 133 Score = 24.3 bits (51), Expect(2) = 3e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 25 PSPPPPYYYKSP 36 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 36/67 (53%), Positives = 40/67 (59%), Gaps = 9/67 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-----YVYKPPTPPPYE---SPPYVYKPPTPPPYVYESP-PYV 27 Y YK P PP Y YKSPP Y YK P PP Y+ PP VYK +PPP V++SP PY Sbjct: 83 YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAPYY 142 Query: 26 YKPPTPP 6 Y P PP Sbjct: 143 YTSPPPP 149 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 41 PSPPPPYYYKSP 52 Score = 70.9 bits (172), Expect = 4e-11 Identities = 36/65 (55%), Positives = 36/65 (55%), Gaps = 10/65 (15%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 P PPPYVYKS PPY YK PP P P PPY YK P PPP PPY YK Sbjct: 9 PSLPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYKS 67 Query: 17 PTPPP 3 P PPP Sbjct: 68 PPPPP 72 Score = 70.5 bits (171), Expect = 6e-11 Identities = 41/83 (49%), Positives = 43/83 (51%), Gaps = 25/83 (30%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPP--YESPP---YVYKPPTP 60 Y YK P PP PY YKSPP Y YK P PPP Y+SPP Y YK P P Sbjct: 31 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPPVYKSPPPPVYKYKSPPP 90 Query: 59 PPYVYESPP-----YVYKPPTPP 6 P Y Y+SPP Y YK P PP Sbjct: 91 PVYKYKSPPPPPPVYKYKSPPPP 113 Score = 54.7 bits (130), Expect(2) = 1e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYESP-PYVYKPPTPPPY 51 Y YK P PP Y YKSPP Y YK P PP ++SP PY Y P PP + Sbjct: 105 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAPYYYTSPPPPSH 151 Score = 24.3 bits (51), Expect(2) = 1e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 57 PSPPPPYYYKSP 68 [18][TOP] >UniRef100_Q2A9D1 Extensin-like region containing protein n=1 Tax=Brassica oleracea RepID=Q2A9D1_BRAOL Length = 543 Score = 77.0 bits (188), Expect(2) = 5e-14 Identities = 44/88 (50%), Positives = 45/88 (51%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 327 YVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPP 386 Query: 59 PPY-------VYES--PPYVYKPPTPPP 3 PPY VY+S PPYVY P PPP Sbjct: 387 PPYYSPSPKMVYKSPPPPYVYSSPPPPP 414 Score = 23.9 bits (50), Expect(2) = 5e-14 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 298 PPPYVYSSP 306 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 42/88 (47%), Positives = 42/88 (47%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 127 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPP 186 Query: 59 PPYVYES---------PPYVYKPPTPPP 3 PPY S PPYVY P PPP Sbjct: 187 PPYYSPSPKVEYKSPQPPYVYSSPPPPP 214 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 42/88 (47%), Positives = 42/88 (47%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 153 YVYNSPPPPPYYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPQPPYVYSSPPP 212 Query: 59 PPYVYES---------PPYVYKPPTPPP 3 PPY S PPYVY P PPP Sbjct: 213 PPYYSPSPKVDYKSPPPPYVYSSPPPPP 240 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 40/78 (51%), Positives = 40/78 (51%), Gaps = 20/78 (25%) Frame = -3 Query: 179 YVYKPPTPPPY-------VYKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY VYKSPP YVY P PPPY SP PYVY P P Sbjct: 379 YVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPP 438 Query: 59 PPYVYESPPYVYKPPTPP 6 PPY SP YK P PP Sbjct: 439 PPYYSPSPKVNYKSPPPP 456 Score = 23.9 bits (50), Expect(2) = 2e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 98 PPPYVYSSP 106 Score = 23.9 bits (50), Expect(2) = 2e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 124 PPPYVYSSP 132 Score = 23.9 bits (50), Expect(2) = 2e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 350 PPPYVYSSP 358 Score = 73.2 bits (178), Expect(2) = 7e-13 Identities = 39/78 (50%), Positives = 39/78 (50%), Gaps = 20/78 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSP--PYVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSP PYVY P PPPY SP PYVY P P Sbjct: 179 YVYSSPPPPPYYSPSPKVEYKSPQPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 238 Query: 59 PPYVYESPPYVYKPPTPP 6 PPY SP YK P PP Sbjct: 239 PPYYSPSPKVDYKSPPPP 256 Score = 73.2 bits (178), Expect(2) = 7e-13 Identities = 38/79 (48%), Positives = 40/79 (50%), Gaps = 20/79 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YV+ P PPP+ YKSPP YVY P PPPY SP PYVY P P Sbjct: 457 YVHSSPPPPPFYSPSPKAEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 516 Query: 59 PPYVYESPPYVYKPPTPPP 3 PPY SP YK P PPP Sbjct: 517 PPYYSPSPKVYYKSPPPPP 535 Score = 23.9 bits (50), Expect(2) = 7e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 150 PPPYVYNSP 158 Score = 23.9 bits (50), Expect(2) = 7e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 428 PPPYVYSSP 436 Score = 71.6 bits (174), Expect(2) = 2e-12 Identities = 40/88 (45%), Positives = 42/88 (47%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYES-----------PPYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY S PPYV+ P P Sbjct: 405 YVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPP 464 Query: 59 PPYVYES---------PPYVYKPPTPPP 3 PP+ S PPYVY P PPP Sbjct: 465 PPFYSPSPKAEYKSPPPPYVYSSPPPPP 492 Score = 23.9 bits (50), Expect(2) = 2e-12 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 376 PPPYVYSSP 384 Score = 71.2 bits (173), Expect(2) = 9e-12 Identities = 40/84 (47%), Positives = 40/84 (47%), Gaps = 29/84 (34%) Frame = -3 Query: 167 PPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTPPPYV 48 PP PPPY YKSPP YVY P PPPY SP PYVY P PPPY Sbjct: 279 PPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYY 338 Query: 47 YES---------PPYVYKPPTPPP 3 S PPYVY P PPP Sbjct: 339 SPSPKVDYKSPPPPYVYSSPPPPP 362 Score = 69.3 bits (168), Expect(2) = 9e-12 Identities = 38/80 (47%), Positives = 38/80 (47%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK-PPTPPPYES-----------PPYVYKPPTPPPYVYES- 39 YV P PPPY SP YK PP PPPY S PPYVY P PPPY S Sbjct: 257 YVCSSPPPPPYYSPSPKVDYKSPPPPPPYYSPSPKFEYKSPPPPYVYSSPPPPPYYSPSP 316 Query: 38 --------PPYVYKPPTPPP 3 PPYVY P PPP Sbjct: 317 KVEYKSPPPPYVYNSPPPPP 336 Score = 23.9 bits (50), Expect(2) = 9e-12 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 228 PPPYVYSSP 236 Score = 21.9 bits (45), Expect(2) = 9e-12 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 216 PTPPPYVYESPLICIQATNTSSIC 145 P PPPY SP + ++ +C Sbjct: 236 PPPPPYYSPSPKVDYKSPPPPYVC 259 Score = 70.1 bits (170), Expect(2) = 2e-11 Identities = 42/90 (46%), Positives = 42/90 (46%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 101 YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPP 160 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 PP Y S PPYVY P PPP Sbjct: 161 PP--YYSPSPKAEYKSPPPPYVYSSPPPPP 188 Score = 22.3 bits (46), Expect(2) = 2e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PY+Y SP Sbjct: 70 PHPKPYIYSSP 80 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 41/90 (45%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 353 YVYSSPPPPPYYSPSPKVYYKSPPPPYVYSSPPPPPYYSPSPKMVYKSPPPPYVYSSPPP 412 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 413 P--PYYSPSPKVNYKSPPPPYVYSSPPPPP 440 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/61 (55%), Positives = 35/61 (57%), Gaps = 11/61 (18%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPY--ESPPYVYKPPTPPPYVYESPP 33 YVY P PPPY YKSPP YVY P PPPY SP YK P PPPYVY+ P Sbjct: 483 YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKMPY 542 Query: 32 Y 30 Y Sbjct: 543 Y 543 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 324 PPPYVYNSP 332 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 480 PPPYVYSSP 488 Score = 66.6 bits (161), Expect(2) = 1e-10 Identities = 41/90 (45%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 301 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYNSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 360 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 361 P--PYYSPSPKVYYKSPPPPYVYSSPPPPP 388 Score = 23.1 bits (48), Expect(2) = 1e-10 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPPY SP Sbjct: 279 PPPPPPYYSPSP 290 Score = 68.6 bits (166), Expect = 2e-10 Identities = 39/88 (44%), Positives = 40/88 (45%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 Y+Y P P Y YKSPP YVY P PPPY SP PYVY P P Sbjct: 75 YIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 134 Query: 59 PPYVYES---------PPYVYKPPTPPP 3 PPY S PPYVY P PPP Sbjct: 135 PPYYSPSPKVEYKSPPPPYVYNSPPPPP 162 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 39/90 (43%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YV+ P PPP+ SP PYVY P P Sbjct: 431 YVYSSPPPPPYYSPSPKVNYKSPPPPYVHSSPPPPPFYSPSPKAEYKSPPPPYVYSSPPP 490 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 491 P--PYYSPSPKVDYKSPPPPYVYSSPPPPP 518 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 402 PPPYVYSSP 410 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 39/79 (49%), Positives = 41/79 (51%), Gaps = 20/79 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPY---------ESPPYVYKPPTPPP 54 YVY P PPPY YKSPP YVY P PPPY +SPP Y +PPP Sbjct: 205 YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVCSSPPP 264 Query: 53 YVYESP-PYV-YKPPTPPP 3 Y SP P V YK P PPP Sbjct: 265 PPYYSPSPKVDYKSPPPPP 283 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 176 PPPYVYSSP 184 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/67 (43%), Positives = 32/67 (47%), Gaps = 13/67 (19%) Frame = -3 Query: 164 PTPPPYVYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYES-----------PPYVY 24 P P PY+Y SPP Y P Y+SPP Y +PPP Y S PPYVY Sbjct: 70 PHPKPYIYSSPPPSSYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVY 129 Query: 23 KPPTPPP 3 P PPP Sbjct: 130 SSPPPPP 136 [19][TOP] >UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus RepID=Q39949_HELAN Length = 263 Score = 77.8 bits (190), Expect(2) = 5e-14 Identities = 42/69 (60%), Positives = 47/69 (68%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY-VYKPPTPPPYESPPY-VYKPPTP----PPYVYESP-----P 33 YVYK P PPP V+KSPP VYK PTPP ++SPP+ VYK P P PP VY+SP P Sbjct: 175 YVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSPPPPKKP 234 Query: 32 YVYKPPTPP 6 YVYK P PP Sbjct: 235 YVYKSPPPP 243 Score = 23.1 bits (48), Expect(2) = 5e-14 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PYVY+SP Sbjct: 169 PPPKKPYVYKSP 180 Score = 76.6 bits (187), Expect(2) = 1e-13 Identities = 44/80 (55%), Positives = 47/80 (58%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY-VYKPPTPPPYES-PPYVYKPP--------------TPPPYV 48 YVYK P PPP V+KSPP VYK P PP YES PP VYK P +PPP V Sbjct: 105 YVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPV 164 Query: 47 YESP-----PYVYKPPTPPP 3 Y+SP PYVYK P PPP Sbjct: 165 YKSPPPPKKPYVYKSPPPPP 184 Score = 23.1 bits (48), Expect(2) = 1e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PYVY+SP Sbjct: 99 PPPKKPYVYKSP 110 Score = 72.4 bits (176), Expect(2) = 3e-12 Identities = 40/64 (62%), Positives = 44/64 (68%), Gaps = 7/64 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY-VYKPPTPPPYESPP-----YVYKPPTPPPYVYES-PPYVYKP 18 VYK P PP VYKSPP V+K P PP Y+SPP YVYK P PPP V++S PP VYK Sbjct: 140 VYKSPPPP--VYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKS 197 Query: 17 PTPP 6 PTPP Sbjct: 198 PTPP 201 Score = 22.3 bits (46), Expect(2) = 3e-12 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VYESP Sbjct: 127 SPPPPVYESP 136 Score = 72.8 bits (177), Expect = 1e-11 Identities = 41/68 (60%), Positives = 45/68 (66%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-PPYVYKPPTPPPYESPPYVYKPP---TPPPYVYESP-----PYV 27 YVYK P PPP VYKS PP VYK P PP ++SPP PP +PPP VY+SP PYV Sbjct: 52 YVYKSPPPPP-VYKSPPPPVYKSPPPPVHKSPP----PPVHKSPPPPVYKSPPPPKKPYV 106 Query: 26 YKPPTPPP 3 YK P PPP Sbjct: 107 YKSPPPPP 114 Score = 66.6 bits (161), Expect(2) = 5e-10 Identities = 39/66 (59%), Positives = 43/66 (65%), Gaps = 9/66 (13%) Frame = -3 Query: 176 VYKPPTPP--PYVYKSPPY---VYKPPTPPPYESPPYVYKPP---TPPPYVYES-PPYVY 24 VYK P PP PYVYKSPP V+K P PP Y+SPP PP +PPP VY+S PP VY Sbjct: 94 VYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPP----PPVYESPPPPVYKSPPPPVY 149 Query: 23 KPPTPP 6 K P PP Sbjct: 150 KSPPPP 155 Score = 20.8 bits (42), Expect(2) = 5e-10 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 65 SPPPPVYKSP 74 Score = 65.9 bits (159), Expect(2) = 8e-10 Identities = 40/84 (47%), Positives = 44/84 (52%), Gaps = 27/84 (32%) Frame = -3 Query: 176 VYKPP------TPPPYVYKSP-----PYVYKPPTPPP---YESPPYVYKPPTPPPY---- 51 VYK P +PPP VYKSP PYVYK P PPP PP VYK PTPP + Sbjct: 148 VYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPP 207 Query: 50 ---------VYESPPYVYKPPTPP 6 V++SPP VYK P PP Sbjct: 208 HPVYKSPLPVHKSPPPVYKSPPPP 231 Score = 20.8 bits (42), Expect(2) = 8e-10 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP V++SP Sbjct: 110 PPPPPPVHKSP 120 Score = 64.7 bits (156), Expect(2) = 2e-09 Identities = 37/65 (56%), Positives = 41/65 (63%), Gaps = 8/65 (12%) Frame = -3 Query: 176 VYKPP------TPPPYVYKS-PPYVYKPPTPPPYESPPYVYKPPTPPPYVYES-PPYVYK 21 VYK P +PPP V+KS PP VYK P PP PYVYK P PPP V++S PP VYK Sbjct: 70 VYKSPPPPVHKSPPPPVHKSPPPPVYKSPPPP---KKPYVYKSPPPPPPVHKSPPPPVYK 126 Query: 20 PPTPP 6 P PP Sbjct: 127 SPPPP 131 Score = 20.4 bits (41), Expect(2) = 2e-09 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPP VY+SP Sbjct: 58 PPPPVYKSP 66 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/61 (60%), Positives = 39/61 (63%), Gaps = 9/61 (14%) Frame = -3 Query: 161 TPPPYVYKSP-----PYVYKPPTPPP---YESPPYVYKPPTPPPYVYES-PPYVYKPPTP 9 +PPP VYKSP PYVYK P PPP PP VYK +PPP VYES PP VYK P P Sbjct: 89 SPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYK--SPPPPVYESPPPPVYKSPPP 146 Query: 8 P 6 P Sbjct: 147 P 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/53 (49%), Positives = 27/53 (50%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PT Y Y SPP +PPP YVYK P PPP PP VYK P PP Sbjct: 25 PTTATYHYSSPPPPPPKKSPPPPPKQQYVYKSPPPPPVYKSPPPPVYKSPPPP 77 [20][TOP] >UniRef100_O65375 F12F1.9 protein n=1 Tax=Arabidopsis thaliana RepID=O65375_ARATH Length = 744 Score = 80.5 bits (197), Expect = 5e-14 Identities = 44/83 (53%), Positives = 46/83 (55%), Gaps = 15/83 (18%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPP------PYVYKSPP--YVYKPPTPPPY-----ESPPYVYKPP 66 P+ M+ Y PP PP PYVY SPP YVY P PPPY PPYVY P Sbjct: 445 PYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSP 504 Query: 65 TPPPYVYES--PPYVYKPPTPPP 3 PPPYVY S PPYVY P PPP Sbjct: 505 -PPPYVYSSPPPPYVYSSPPPPP 526 Score = 70.1 bits (170), Expect = 7e-11 Identities = 39/73 (53%), Positives = 40/73 (54%), Gaps = 5/73 (6%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPP--YVYKPPTPPPYVYES-- 39 P M+ Y PP PPPY SP PP PPP SPP YVY P PPPYVY S Sbjct: 428 PSSKMSPSVRAYSPP-PPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSP-PPPYVYSSPP 485 Query: 38 -PPYVYKPPTPPP 3 PPYVY P PPP Sbjct: 486 PPPYVYSSPPPPP 498 Score = 63.2 bits (152), Expect(2) = 1e-10 Identities = 32/70 (45%), Positives = 34/70 (48%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-----------YVYKPPTPPPYESPPYVYKPPTPPPYVYESPP 33 YVY P PPPYVY SPP YVY P PPP PP + PPP VY + P Sbjct: 489 YVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYA-P 547 Query: 32 YVYKPPTPPP 3 PP P P Sbjct: 548 VTQSPPPPSP 557 Score = 26.2 bits (56), Expect(2) = 1e-10 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY SP Sbjct: 484 PPPPPYVYSSP 494 Score = 53.1 bits (126), Expect(2) = 5e-07 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP P P Y PP PP P P PP PP P P Y PP Y PP P P Sbjct: 552 PPPPSPVYY--PPVTQSPPPPSPVYYPPVTNSPPPPSPVYY--PPVTYSPPPPSP 602 Score = 23.9 bits (50), Expect(2) = 5e-07 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 505 PPPYVYSSP 513 Score = 50.4 bits (119), Expect(2) = 3e-06 Identities = 27/64 (42%), Positives = 27/64 (42%), Gaps = 4/64 (6%) Frame = -3 Query: 182 SYVYKPPT----PPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 S VY PP PPP PP PP P P PP Y PP P P Y P PP Sbjct: 556 SPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYY--PQVTPSPP 613 Query: 14 TPPP 3 P P Sbjct: 614 PPSP 617 Score = 23.9 bits (50), Expect(2) = 3e-06 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 514 PPPYVYSSP 522 [21][TOP] >UniRef100_Q09082 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q09082_SOLLC Length = 388 Score = 77.4 bits (189), Expect(2) = 7e-14 Identities = 44/73 (60%), Positives = 45/73 (61%), Gaps = 14/73 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-- 33 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 178 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 234 Query: 32 ---YVYKPPTPPP 3 YVYK P PPP Sbjct: 235 SPKYVYKSPPPPP 247 Score = 77.4 bits (189), Expect(2) = 7e-14 Identities = 42/74 (56%), Positives = 43/74 (58%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPPYVYES------ 39 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PPPY Y+S Sbjct: 202 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPPYYYKSPPPPSP 258 Query: 38 ---PPYVYKPPTPP 6 PPY YK P PP Sbjct: 259 SPPPPYYYKSPPPP 272 Score = 23.1 bits (48), Expect(2) = 7e-14 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 136 PPPSPKYVYKSP 147 Score = 23.1 bits (48), Expect(2) = 7e-14 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 160 PPPSPKYVYKSP 171 Score = 74.7 bits (182), Expect(2) = 2e-13 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-- 33 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 22 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 78 Query: 32 ---YVYKPPTPP 6 YVYK P PP Sbjct: 79 SPKYVYKSPPPP 90 Score = 23.9 bits (50), Expect(2) = 2e-13 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 PTP PY Y+SP Sbjct: 5 PTPTPYYYKSP 15 Score = 75.1 bits (183), Expect(2) = 3e-13 Identities = 38/68 (55%), Positives = 38/68 (55%), Gaps = 10/68 (14%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPY 30 YVYK P PPPY YKS PPY YK PP P P PPY YK P PPP PPY Sbjct: 238 YVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPY 296 Query: 29 VYKPPTPP 6 YK P PP Sbjct: 297 YYKSPPPP 304 Score = 23.1 bits (48), Expect(2) = 3e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 196 PPPSPKYVYKSP 207 Score = 74.7 bits (182), Expect(2) = 4e-13 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-- 33 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 46 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 102 Query: 32 ---YVYKPPTPP 6 YVYK P PP Sbjct: 103 SPKYVYKSPPPP 114 Score = 74.7 bits (182), Expect(2) = 4e-13 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-- 33 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 70 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 126 Query: 32 ---YVYKPPTPP 6 YVYK P PP Sbjct: 127 SPKYVYKSPPPP 138 Score = 74.7 bits (182), Expect(2) = 4e-13 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-- 33 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 94 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 150 Query: 32 ---YVYKPPTPP 6 YVYK P PP Sbjct: 151 SPKYVYKSPPPP 162 Score = 74.7 bits (182), Expect(2) = 4e-13 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-- 33 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 118 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 174 Query: 32 ---YVYKPPTPP 6 YVYK P PP Sbjct: 175 SPKYVYKSPPPP 186 Score = 74.7 bits (182), Expect(2) = 4e-13 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-- 33 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 142 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 198 Query: 32 ---YVYKPPTPP 6 YVYK P PP Sbjct: 199 SPKYVYKSPPPP 210 Score = 74.7 bits (182), Expect(2) = 4e-13 Identities = 43/72 (59%), Positives = 44/72 (61%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPP-- 33 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 166 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 222 Query: 32 ---YVYKPPTPP 6 YVYK P PP Sbjct: 223 SPKYVYKSPPPP 234 Score = 23.1 bits (48), Expect(2) = 4e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 16 PPPSPKYVYKSP 27 Score = 23.1 bits (48), Expect(2) = 4e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 28 PPPSPKYVYKSP 39 Score = 23.1 bits (48), Expect(2) = 4e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 52 PPPSPKYVYKSP 63 Score = 23.1 bits (48), Expect(2) = 4e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 76 PPPSPKYVYKSP 87 Score = 23.1 bits (48), Expect(2) = 4e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 100 PPPSPKYVYKSP 111 Score = 23.1 bits (48), Expect(2) = 4e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 124 PPPSPKYVYKSP 135 Score = 72.0 bits (175), Expect(2) = 3e-12 Identities = 40/76 (52%), Positives = 40/76 (52%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPY-----------ESPPYVYKPPTPPP 54 YVYK P PP YVYKSPP YVYK P PPPY PPY YK P PPP Sbjct: 214 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPPPYYYKSPPPPSPSPPPPYYYKSP-PPP 272 Query: 53 YVYESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 273 SPSPPPPYYYKSPPPP 288 Score = 23.1 bits (48), Expect(2) = 3e-12 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 172 PPPSPKYVYKSP 183 Score = 72.8 bits (177), Expect = 1e-11 Identities = 42/72 (58%), Positives = 43/72 (59%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYK--PPTPPPYVYESPP-- 33 Y YK P PP YVYKSPP YVYK P PP SP YVYK PP P YVY+SPP Sbjct: 10 YYYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 66 Query: 32 ---YVYKPPTPP 6 YVYK P PP Sbjct: 67 SPKYVYKSPPPP 78 Score = 71.6 bits (174), Expect = 2e-11 Identities = 39/65 (60%), Positives = 40/65 (61%), Gaps = 12/65 (18%) Frame = -3 Query: 164 PTPPPYVYKSPP-----YVYKPPTPPPYESPPYVYK--PPTPPPYVYESPP-----YVYK 21 PTP PY YKSPP YVYK P PP SP YVYK PP P YVY+SPP YVYK Sbjct: 5 PTPTPYYYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPPSPKYVYK 61 Query: 20 PPTPP 6 P PP Sbjct: 62 SPPPP 66 Score = 65.9 bits (159), Expect(2) = 6e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 248 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 306 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 307 SPPPPYYYKCPPPP 320 Score = 24.6 bits (52), Expect(2) = 6e-11 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y+SP Sbjct: 243 PPPPPYYYKSP 253 Score = 67.0 bits (162), Expect(2) = 8e-11 Identities = 40/69 (57%), Positives = 42/69 (60%), Gaps = 10/69 (14%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPP--YVYESPPYV 27 YVYK P PP YVYKSPP YVYK P PP SP YVYK P PP YVY+SPP Sbjct: 190 YVYKSPPPPSPKYVYKSPPPPSPKYVYKSPPPP---SPKYVYKSPPPPSPKYVYKSPPPP 246 Query: 26 -YKPPTPPP 3 Y +PPP Sbjct: 247 PYYYKSPPP 255 Score = 65.9 bits (159), Expect(2) = 8e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 264 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKCP-PPPSP 322 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 323 SPPPPYYYKSPPPP 336 Score = 24.3 bits (51), Expect(2) = 8e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 258 PSPPPPYYYKSP 269 Score = 23.1 bits (48), Expect(2) = 8e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 148 PPPSPKYVYKSP 159 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 37/80 (46%), Positives = 37/80 (46%), Gaps = 22/80 (27%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 Y YK P PP PY YKS PPY YK PP P P PPY YK P Sbjct: 280 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKSPPPPSPS 339 Query: 65 TPPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 340 PPPPYYYHSPPPPVNSPPPP 359 Score = 24.3 bits (51), Expect(2) = 2e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 274 PSPPPPYYYKSP 285 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 37/81 (45%), Positives = 38/81 (46%), Gaps = 23/81 (28%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYESPP---YVYKPP---- 66 Y YK P PP PY YK PP Y YK P PPP SPP Y + PP Sbjct: 296 YYYKSPPPPSPSPPPPYYYKCPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYHSPPPPVN 354 Query: 65 -TPPPYVYESPPYVYKPPTPP 6 PPPY Y SPP K P PP Sbjct: 355 SPPPPYYYSSPPPPVKSPPPP 375 Score = 24.3 bits (51), Expect(2) = 2e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 290 PSPPPPYYYKSP 301 Score = 55.5 bits (132), Expect(2) = 9e-08 Identities = 29/56 (51%), Positives = 30/56 (53%), Gaps = 7/56 (12%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPP 33 Y YK P PP PY Y SPP V PP P Y SPP K P PP Y+Y SPP Sbjct: 328 YYYKSPPPPSPSPPPPYYYHSPPPPVNSPPPPYYYSSPPPPVKSPPPPVYIYGSPP 383 Score = 24.3 bits (51), Expect(2) = 9e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 322 PSPPPPYYYKSP 333 [22][TOP] >UniRef100_Q2A9D2 Extensin-like region containing protein n=1 Tax=Brassica oleracea RepID=Q2A9D2_BRAOL Length = 347 Score = 76.6 bits (187), Expect(2) = 7e-14 Identities = 40/79 (50%), Positives = 40/79 (50%), Gaps = 20/79 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 261 YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 320 Query: 59 PPYVYESPPYVYKPPTPPP 3 PPY SP YK P PPP Sbjct: 321 PPYYSPSPKVYYKSPPPPP 339 Score = 23.9 bits (50), Expect(2) = 7e-14 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 232 PPPYVYSSP 240 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 42/88 (47%), Positives = 42/88 (47%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 209 YVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 268 Query: 59 PPYVYES---------PPYVYKPPTPPP 3 PPY S PPYVY P PPP Sbjct: 269 PPYYSPSPKVDYKSPPPPYVYSSPPPPP 296 Score = 23.9 bits (50), Expect(2) = 2e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 180 PPPYVYSSP 188 Score = 74.3 bits (181), Expect(2) = 7e-13 Identities = 43/88 (48%), Positives = 44/88 (50%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 157 YVYSYPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPPP 216 Query: 59 PPYV-------YES--PPYVYKPPTPPP 3 PPY Y+S PPYVY P PPP Sbjct: 217 PPYYSPLPKVEYKSPPPPYVYSSPPPPP 244 Score = 22.7 bits (47), Expect(2) = 7e-13 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY+Y SP Sbjct: 128 PPPYLYNSP 136 Score = 67.0 bits (162), Expect(2) = 5e-11 Identities = 34/61 (55%), Positives = 35/61 (57%), Gaps = 11/61 (18%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPY--ESPPYVYKPPTPPPYVYESPP 33 YVY P PPPY YKSPP YVY P PPPY SP YK P PPPYVY+ P Sbjct: 287 YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVYYKSPPPPPYVYKKPY 346 Query: 32 Y 30 Y Sbjct: 347 Y 347 Score = 23.9 bits (50), Expect(2) = 5e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 258 PPPYVYSSP 266 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 41/90 (45%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 235 YVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPP 294 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 295 P--PYYSPSPKVDYKSPPPPYVYSSPPPPP 322 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 206 PPPYVYNSP 214 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 40/90 (44%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP Y+Y P PPPY SP PYVY P P Sbjct: 105 YVYSSPPPPPYYSPSLKVEYKSPPPPYLYNSPPPPPYYSPSPKAEYKSPPPPYVYSYPPP 164 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 165 P--PYYSPSPKVEYKSPPPPYVYSSPPPPP 192 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 102 PPPYVYSSP 110 Score = 66.6 bits (161), Expect(2) = 3e-10 Identities = 41/90 (45%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKS--PPYVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKS PPYVY P PPPY SP PYVY P P Sbjct: 183 YVYSSPPPPPYYSPSPKVEYKSQPPPYVYNSPPPPPYYSPLPKVEYKSPPPPYVYSSPPP 242 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 243 P--PYYSPSPKVDYKSPPPPYVYSSPPPPP 270 Score = 21.6 bits (44), Expect(2) = 3e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY P Sbjct: 154 PPPYVYSYP 162 Score = 67.8 bits (164), Expect = 4e-10 Identities = 41/95 (43%), Positives = 44/95 (46%), Gaps = 31/95 (32%) Frame = -3 Query: 194 MNHHSYVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVY 75 ++H YVY P PPY YKSPP YVY P PPPY SP PY+Y Sbjct: 74 LHHRLYVYSSPPLPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSLKVEYKSPPPPYLY 133 Query: 74 KPPTPPPYVYES-----------PPYVYKPPTPPP 3 P PPP Y S PPYVY P PPP Sbjct: 134 NSPPPPP--YYSPSPKAEYKSPPPPYVYSYPPPPP 166 Score = 64.7 bits (156), Expect = 3e-09 Identities = 40/90 (44%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 Y+Y P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 131 YLYNSPPPPPYYSPSPKAEYKSPPPPYVYSYPPPPPYYSPSPKVEYKSPPPPYVYSSPPP 190 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 191 P--PYYSPSPKVEYKSQPPPYVYNSPPPPP 218 [23][TOP] >UniRef100_B9GF15 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GF15_POPTR Length = 152 Score = 73.9 bits (180), Expect(2) = 7e-14 Identities = 42/82 (51%), Positives = 43/82 (52%), Gaps = 23/82 (28%) Frame = -3 Query: 179 YVY------KPPTPPPYVYKSPPYVYKPPTPPPYES--PPYVYK------PPTPPPYVYE 42 YVY P PPPY+YKSPP PP PPP S PPYVYK P PPPYVY Sbjct: 48 YVYMSPPPPSPSPPPPYIYKSPP----PPPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYN 103 Query: 41 S---------PPYVYKPPTPPP 3 S PPYVY P PPP Sbjct: 104 SPPPPSPSPPPPYVYNSPPPPP 125 Score = 26.6 bits (57), Expect(2) = 7e-14 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P +PPPY+Y+SP Sbjct: 26 PSSPPPYIYKSP 37 Score = 75.9 bits (185), Expect(2) = 9e-14 Identities = 39/77 (50%), Positives = 43/77 (55%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPP------TPPPYVYKS---------PPYVY-KPPTPPPYESPPYVYK---PPTPP 57 Y+YK P +PPPY+YKS PPYVY PP P P PPY+YK PP PP Sbjct: 16 YIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPSPPPPYIYKSPPPPPPP 75 Query: 56 PYVYESPPYVYKPPTPP 6 P PPYVYK P PP Sbjct: 76 PSPSPPPPYVYKSPPPP 92 Score = 24.3 bits (51), Expect(2) = 9e-14 Identities = 9/15 (60%), Positives = 12/15 (80%), Gaps = 3/15 (20%) Frame = -2 Query: 219 PPT---PPPYVYESP 184 PP+ PPPY+Y+SP Sbjct: 7 PPSTSPPPPYIYKSP 21 Score = 75.5 bits (184), Expect = 2e-12 Identities = 38/74 (51%), Positives = 42/74 (56%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYK------PPTPPPYVYES------- 39 +YK P PPP PPY+YK PP PPP PPY+YK P PPPYVY S Sbjct: 1 MYKSP-PPPSTSPPPPYIYKSPPPPPPSSPPPYIYKSPPPPSPSPPPPYVYMSPPPPSPS 59 Query: 38 --PPYVYKPPTPPP 3 PPY+YK P PPP Sbjct: 60 PPPPYIYKSPPPPP 73 Score = 63.2 bits (152), Expect(2) = 1e-10 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPP-PYESPPYVYKPPT-PPPYVYESPPYVY 24 YVYK P PP PYVY SPP P PP Y SPP P+ PPPY+Y+SPP Sbjct: 84 YVYKSPPPPSPSPPPPYVYNSPPPPSPSPPPPYVYNSPPPPPSSPSPPPPYIYKSPPPPS 143 Query: 23 KPPTPPP 3 P PPP Sbjct: 144 PSPPPPP 150 Score = 26.2 bits (56), Expect(2) = 1e-10 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 78 PSPPPPYVYKSP 89 [24][TOP] >UniRef100_B9IAD8 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAD8_POPTR Length = 379 Score = 74.3 bits (181), Expect(2) = 8e-14 Identities = 42/89 (47%), Positives = 46/89 (51%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 Y+YK P PP PYVYKS PPY+YK PP P P PPY YK P Sbjct: 127 YIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYYYKSPPPPSPS 186 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPYVY+S PPY YK P+PP Sbjct: 187 PPPPYVYKSPPPPSSSPPPPYYYKSPSPP 215 Score = 25.8 bits (55), Expect(2) = 8e-14 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y+SP Sbjct: 89 PSPPPPYIYKSP 100 Score = 73.2 bits (178), Expect(2) = 7e-13 Identities = 42/89 (47%), Positives = 45/89 (50%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 Y YK P PP PY+YKS PPYVYK PP P P PPY+YK P Sbjct: 111 YEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPS 170 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPY Y+S PPYVYK P PP Sbjct: 171 PPPPYYYKSPPPPSPSPPPPYVYKSPPPP 199 Score = 23.9 bits (50), Expect(2) = 7e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 105 PSPPPPYEYKSP 116 Score = 72.8 bits (177), Expect(2) = 9e-13 Identities = 38/74 (51%), Positives = 41/74 (55%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y+YK P PP PY YKSPP Y+YK P PP P PPYVYK P PPP Sbjct: 95 YIYKSPPPPSPSPPPPYEYKSPPPPSSSPPPPYIYKSPPPPSPSPPPPYVYKSP-PPPSP 153 Query: 47 YESPPYVYKPPTPP 6 PPY+YK P PP Sbjct: 154 SPPPPYIYKSPPPP 167 Score = 23.9 bits (50), Expect(2) = 9e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 57 PSPPPPYEYKSP 68 Score = 68.6 bits (166), Expect(2) = 3e-12 Identities = 42/90 (46%), Positives = 45/90 (50%), Gaps = 32/90 (35%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYKPPTPPPYES--PPYVYKPPT---- 63 Y+YK P PP PY YKS PPYVYK P PPP S PPY YK P+ Sbjct: 159 YIYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSP-PPPSSSPPPPYYYKSPSPPSS 217 Query: 62 --PPPYVYES---------PPYVYKPPTPP 6 PPPY Y+S PPY YK P PP Sbjct: 218 SPPPPYYYKSPPPLSPSPPPPYYYKSPPPP 247 Score = 26.2 bits (56), Expect(2) = 3e-12 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 137 PSPPPPYVYKSP 148 Score = 70.1 bits (170), Expect(2) = 4e-12 Identities = 43/90 (47%), Positives = 46/90 (51%), Gaps = 32/90 (35%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYES--PPYVYK------P 69 YVYK P PP PY YKSPP YVYK P PPP S PPY+YK P Sbjct: 47 YVYKSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSP-PPPSPSPPPPYIYKSPPPPSP 105 Query: 68 PTPPPYVYES---------PPYVYKPPTPP 6 PPPY Y+S PPY+YK P PP Sbjct: 106 SPPPPYEYKSPPPPSSSPPPPYIYKSPPPP 135 Score = 24.3 bits (51), Expect(2) = 4e-12 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY+SP Sbjct: 44 PPPYVYKSP 52 Score = 72.8 bits (177), Expect = 1e-11 Identities = 38/69 (55%), Positives = 41/69 (59%), Gaps = 10/69 (14%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYVYESPP 33 +YVY P PPPYVYKSPP Y YK P PP P+ P YVYK P PPP PP Sbjct: 37 AYVYSSP-PPPYVYKSPPPPSPSPPPPYEYKSPPPPSPHPPPTYVYKSP-PPPSPSPPPP 94 Query: 32 YVYKPPTPP 6 Y+YK P PP Sbjct: 95 YIYKSPPPP 103 Score = 65.9 bits (159), Expect(2) = 3e-11 Identities = 40/89 (44%), Positives = 42/89 (47%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYKPPTPPPYE-SPPYVYK------PP 66 Y YK P PP PYVYKS PPY YK P+PP PPY YK P Sbjct: 175 YYYKSPPPPSPSPPPPYVYKSPPPPSSSPPPPYYYKSPSPPSSSPPPPYYYKSPPPLSPS 234 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPY Y+S PPY YK P PP Sbjct: 235 PPPPYYYKSPPPPDPSPPPPYHYKSPPPP 263 Score = 65.5 bits (158), Expect(2) = 3e-11 Identities = 36/74 (48%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P+PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 207 YYYKSPSPPSSSPPPPYYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSP-PPPSP 265 Query: 47 YESPPYVYKPPTPP 6 PPY Y+ P PP Sbjct: 266 SPPPPYYYRSPPPP 279 Score = 26.2 bits (56), Expect(2) = 3e-11 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 185 PSPPPPYVYKSP 196 Score = 25.8 bits (55), Expect(2) = 3e-11 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y+SP Sbjct: 153 PSPPPPYIYKSP 164 Score = 69.7 bits (169), Expect = 9e-11 Identities = 41/89 (46%), Positives = 44/89 (49%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPPP------YVYKS---------PPYVYK-PPTPPPYESPPYVYKPP------ 66 Y YK P PP YVYKS PPY+YK PP P P PPY YK P Sbjct: 63 YEYKSPPPPSPHPPPTYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYEYKSPPPPSSS 122 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPY+Y+S PPYVYK P PP Sbjct: 123 PPPPYIYKSPPPPSPSPPPPYVYKSPPPP 151 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 32/54 (59%), Positives = 33/54 (61%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 P PPPY YKSPP PP+P P PPY YK P PPP PPYVYK P PP Sbjct: 297 PSPPPPYYYKSPP----PPSPSP--PPPYYYKSP-PPPSPSPPPPYVYKSPPPP 343 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y SP Sbjct: 265 PSPPPPYYYRSP 276 Score = 63.5 bits (153), Expect(2) = 4e-10 Identities = 37/80 (46%), Positives = 39/80 (48%), Gaps = 22/80 (27%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYK------PPTPPPYVYESP 36 Y YK P PP PY YKSPP PP+P P PPYVYK P PPPY Y SP Sbjct: 303 YYYKSPPPPSPSPPPPYYYKSPP----PPSPSP--PPPYVYKSPPPPSPSPPPPYYYHSP 356 Query: 35 P----------YVYKPPTPP 6 P Y+Y P PP Sbjct: 357 PPAMKSPPLSVYIYASPPPP 376 Score = 24.3 bits (51), Expect(2) = 4e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 297 PSPPPPYYYKSP 308 Score = 63.5 bits (153), Expect(2) = 1e-09 Identities = 39/89 (43%), Positives = 40/89 (44%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTP------PPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPP------ 66 Y YK P P PPY YKS PPY YK PP P P PPY Y+ P Sbjct: 223 YYYKSPPPLSPSPPPPYYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRSPPPPSSS 282 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPY Y S PPY YK P PP Sbjct: 283 PPPPYHYSSPPPPSPSPPPPYYYKSPPPP 311 Score = 22.7 bits (47), Expect(2) = 1e-09 Identities = 9/15 (60%), Positives = 11/15 (73%), Gaps = 3/15 (20%) Frame = -2 Query: 219 PPT---PPPYVYESP 184 PP+ PPPY Y+SP Sbjct: 198 PPSSSPPPPYYYKSP 212 Score = 60.5 bits (145), Expect(2) = 3e-09 Identities = 38/90 (42%), Positives = 40/90 (44%), Gaps = 32/90 (35%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYESPPYVY--------KP 69 Y YK P PP PY YKSPP Y Y+ P PPP SPP Y P Sbjct: 239 YYYKSPPPPDPSPPPPYHYKSPPPPSPSPPPPYYYRSP-PPPSSSPPPPYHYSSPPPPSP 297 Query: 68 PTPPPYVYES---------PPYVYKPPTPP 6 PPPY Y+S PPY YK P PP Sbjct: 298 SPPPPYYYKSPPPPSPSPPPPYYYKSPPPP 327 Score = 24.3 bits (51), Expect(2) = 3e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 233 PSPPPPYYYKSP 244 [25][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 79.7 bits (195), Expect = 9e-14 Identities = 37/58 (63%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVY---ESPPYVYKPPTPPP 3 PP PPP PPYVY P PPP PPYVY PP PPPYVY SPPYVY PP P P Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP-PPPYVYPPPPSPPYVYPPPPPSP 451 Score = 69.7 bits (169), Expect = 9e-11 Identities = 34/62 (54%), Positives = 35/62 (56%), Gaps = 7/62 (11%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYK-----PPTPPPYVY--ESPPYVYKPPTP 9 PP PPP PP PP PPP PPYVY PP+PPPYVY PPYVY PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPS 439 Query: 8 PP 3 PP Sbjct: 440 PP 441 Score = 67.8 bits (164), Expect = 4e-10 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 14/59 (23%) Frame = -3 Query: 167 PPTPPPYVYKSPP--------YVYKPPTP----PPYESPPYVY--KPPTPPPYVYESPP 33 PP PPPYVY SPP YVY PP P PP SPPYVY PP+P PY+Y SPP Sbjct: 402 PPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 [26][TOP] >UniRef100_Q9T0L0 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0L0_ARATH Length = 429 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 41/79 (51%), Positives = 43/79 (54%), Gaps = 22/79 (27%) Frame = -3 Query: 173 YKPPTPPPYVYKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPPPYV----- 48 YK P PPPYVY S PPYVY P PPPY S PPYVY P PPPY Sbjct: 328 YKSP-PPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPK 386 Query: 47 --YES--PPYVYKPPTPPP 3 Y+S PPY+Y P PPP Sbjct: 387 VEYKSPPPPYIYNSPPPPP 405 Score = 23.9 bits (50), Expect(2) = 2e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 306 PPPYVYSSP 314 Score = 73.9 bits (180), Expect(2) = 4e-13 Identities = 38/78 (48%), Positives = 39/78 (50%), Gaps = 20/78 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PY+Y P P Sbjct: 344 YVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPP 403 Query: 59 PPYVYESPPYVYKPPTPP 6 PPY SP YK P PP Sbjct: 404 PPYYSPSPKITYKSPPPP 421 Score = 23.9 bits (50), Expect(2) = 4e-13 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 341 PPPYVYNSP 349 Score = 73.6 bits (179), Expect(2) = 7e-13 Identities = 41/88 (46%), Positives = 42/88 (47%), Gaps = 29/88 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKS--PPYVYKPPTPPPYES-----------PPYVYKPPTP 60 Y+Y P PPPY YKS PPYVY P PPPY S PPYVY P P Sbjct: 154 YIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPP 213 Query: 59 PPYVYESP---------PYVYKPPTPPP 3 PPY SP PYVY P PPP Sbjct: 214 PPYYSPSPKVGYKSPPAPYVYSSPPPPP 241 Score = 23.5 bits (49), Expect(2) = 7e-13 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY+Y SP Sbjct: 151 PPPYIYSSP 159 Score = 69.3 bits (168), Expect(2) = 9e-12 Identities = 43/96 (44%), Positives = 45/96 (46%), Gaps = 37/96 (38%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKS--PPYVYKPPTPPPYES-----------PPYVYK---PP 66 YVY P PPPY +KS PPY+Y P PP Y S PPYVY PP Sbjct: 258 YVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPP 317 Query: 65 T-------------PPPYVYES--PPYVYKPPTPPP 3 T PPPYVY S PPYVY P PPP Sbjct: 318 TYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPP 353 Score = 23.9 bits (50), Expect(2) = 9e-12 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 255 PPPYVYSSP 263 Score = 68.9 bits (167), Expect(2) = 6e-11 Identities = 36/77 (46%), Positives = 37/77 (48%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKS--PPYVYKPPTPPPYE----------SPPYVYKPPTPP 57 YVY P PPPY YKS PPYVY P PPPY PPY+Y P PP Sbjct: 232 YVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPP 291 Query: 56 PYVYESPPYVYKPPTPP 6 Y SP YK P PP Sbjct: 292 SYYSPSPKIDYKSPPPP 308 Score = 21.6 bits (44), Expect(2) = 6e-11 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY P Sbjct: 203 PPPYVYSFP 211 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 41/90 (45%), Positives = 41/90 (45%), Gaps = 31/90 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 180 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPP 239 Query: 59 PPYVYES-----------PPYVYKPPTPPP 3 P Y S PPYVY P PPP Sbjct: 240 P--PYYSPSPKVNYKSPPPPYVYSSPPPPP 267 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 177 PPPYVYSSP 185 Score = 67.4 bits (163), Expect(2) = 4e-10 Identities = 40/96 (41%), Positives = 41/96 (42%), Gaps = 39/96 (40%) Frame = -3 Query: 173 YKPPTPPPYVYKS-------------------PPYVYKPPTPPPYESP-----------P 84 YK P PPPYVY S PPY+Y P PPPY SP P Sbjct: 121 YKSP-PPPYVYSSLPPLTYYSPSPKVIYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPP 179 Query: 83 YVYKPPTPPPYVYES---------PPYVYKPPTPPP 3 YVY P PPPY S PPYVY P PPP Sbjct: 180 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPP 215 Score = 20.4 bits (41), Expect(2) = 4e-10 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -2 Query: 216 PTPPPYVYESPLICIQATNTSSI 148 PTP PY + P + I++ S+ Sbjct: 81 PTPLPYYFPFPKLDIKSPPPPSV 103 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 32/61 (52%), Positives = 36/61 (59%), Gaps = 11/61 (18%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPY--ESPPYVYKPPTPPPYVYESPP 33 YVY P PPPY YKSPP Y+Y P PPPY SP YK P PPPY+Y++P Sbjct: 370 YVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSPKITYKSP-PPPYIYKTPY 428 Query: 32 Y 30 Y Sbjct: 429 Y 429 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 367 PPPYVYNSP 375 Score = 65.1 bits (157), Expect(2) = 1e-09 Identities = 39/88 (44%), Positives = 40/88 (45%), Gaps = 30/88 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 206 YVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPP 265 Query: 59 PPYVYE----------SPPYVYKPPTPP 6 PP Y PPY+Y P PP Sbjct: 266 PP--YSPSPKVEFKSPPPPYIYNSPPPP 291 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 Query: 216 PTPPPYVYESPLI 178 P PPPY SP + Sbjct: 159 PPPPPYYSPSPKV 171 [27][TOP] >UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum tuberosum RepID=Q8H9E0_SOLTU Length = 217 Score = 75.1 bits (183), Expect(2) = 2e-13 Identities = 40/70 (57%), Positives = 42/70 (60%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPP--- 33 Y YK P PP Y YKSPP Y YK P PP Y+SPP Y YK P PP Y Y+SPP Sbjct: 98 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV 157 Query: 32 YVYKPPTPPP 3 Y YK P PPP Sbjct: 158 YKYKSPPPPP 167 Score = 23.5 bits (49), Expect(2) = 2e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 62 PPPPPVYKYKSP 73 Score = 73.2 bits (178), Expect(2) = 9e-13 Identities = 41/73 (56%), Positives = 43/73 (58%), Gaps = 15/73 (20%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP---YVYKPPTPPP----YESPP---YVYKPPTPPPYVYESP 36 Y YK P PPP Y YKSPP Y YK P PPP Y+SPP Y YK P PP Y Y+SP Sbjct: 34 YKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSP 93 Query: 35 P---YVYKPPTPP 6 P Y YK P PP Sbjct: 94 PPPVYKYKSPPPP 106 Score = 23.5 bits (49), Expect(2) = 9e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 18 PPPPPVYKYKSP 29 Score = 72.4 bits (176), Expect(2) = 2e-12 Identities = 39/69 (56%), Positives = 41/69 (59%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPP--- 33 Y YK P PP Y YKSPP Y YK P PP Y+SPP Y YK P PP Y Y+SPP Sbjct: 68 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV 127 Query: 32 YVYKPPTPP 6 Y YK P PP Sbjct: 128 YKYKSPPPP 136 Score = 23.5 bits (49), Expect(2) = 2e-12 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 40 PPPPPVYKYKSP 51 Score = 72.4 bits (176), Expect(2) = 1e-11 Identities = 39/69 (56%), Positives = 41/69 (59%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPP--- 33 Y YK P PP Y YKSPP Y YK P PP Y+SPP Y YK P PP Y Y+SPP Sbjct: 78 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV 137 Query: 32 YVYKPPTPP 6 Y YK P PP Sbjct: 138 YKYKSPPPP 146 Score = 72.4 bits (176), Expect(2) = 1e-11 Identities = 39/69 (56%), Positives = 41/69 (59%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPP--- 33 Y YK P PP Y YKSPP Y YK P PP Y+SPP Y YK P PP Y Y+SPP Sbjct: 88 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV 147 Query: 32 YVYKPPTPP 6 Y YK P PP Sbjct: 148 YKYKSPPPP 156 Score = 72.4 bits (176), Expect(2) = 1e-11 Identities = 37/64 (57%), Positives = 38/64 (59%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKP 18 Y YK P PP Y YKSPP Y YK P PPP P Y YK P PP Y Y+SPP Y YK Sbjct: 138 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPP---PVYKYKSPPPPVYKYKSPPPPVYKYKS 194 Query: 17 PTPP 6 P PP Sbjct: 195 PPPP 198 Score = 20.8 bits (42), Expect(2) = 1e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 29 PPPPVYKYKSP 39 Score = 20.8 bits (42), Expect(2) = 1e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 51 PPPPVYKYKSP 61 Score = 20.8 bits (42), Expect(2) = 1e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 93 PPPPVYKYKSP 103 Score = 71.6 bits (174), Expect(2) = 2e-11 Identities = 42/75 (56%), Positives = 44/75 (58%), Gaps = 17/75 (22%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP---YVYKPPTPPP----YESPP---YVYKPPTPPP--YVYE 42 Y YK P PPP Y YKSPP Y YK P PPP Y+SPP Y YK P PPP Y Y+ Sbjct: 12 YKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYK 71 Query: 41 SPP---YVYKPPTPP 6 SPP Y YK P PP Sbjct: 72 SPPPPVYKYKSPPPP 86 Score = 20.8 bits (42), Expect(2) = 2e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 7 PPPPVYKYKSP 17 Score = 70.5 bits (171), Expect(2) = 4e-11 Identities = 39/70 (55%), Positives = 42/70 (60%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYE---SPP 33 Y YK P PP Y YKSPP Y YK P PP Y+SPP Y YK P PPP VY+ PP Sbjct: 118 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPP 177 Query: 32 YVYKPPTPPP 3 VYK +PPP Sbjct: 178 PVYKYKSPPP 187 Score = 20.8 bits (42), Expect(2) = 4e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 73 PPPPVYKYKSP 83 Score = 70.9 bits (172), Expect = 4e-11 Identities = 40/71 (56%), Positives = 42/71 (59%), Gaps = 13/71 (18%) Frame = -3 Query: 179 YVYKPPTPPP--YVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPP- 33 Y YK P PPP Y YKSPP Y YK P PP Y+SPP Y YK P PP Y Y+SPP Sbjct: 56 YKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP 115 Query: 32 --YVYKPPTPP 6 Y YK P PP Sbjct: 116 PVYKYKSPPPP 126 Score = 70.5 bits (171), Expect = 6e-11 Identities = 39/70 (55%), Positives = 42/70 (60%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-----YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPPY 30 Y YK P PP Y YKSPP Y YK P PP Y+SPP Y YK P PP Y Y+SPP Sbjct: 46 YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP 105 Query: 29 -VYKPPTPPP 3 VYK +PPP Sbjct: 106 PVYKYKSPPP 115 Score = 69.3 bits (168), Expect = 1e-10 Identities = 36/67 (53%), Positives = 38/67 (56%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVY 24 Y YK P PP Y YKSPP Y YK P PP Y+ Y PP PP Y Y+SPP Y Y Sbjct: 2 YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYK---YKSPPPPPPVYKYKSPPPPVYKY 58 Query: 23 KPPTPPP 3 K P PPP Sbjct: 59 KSPPPPP 65 Score = 68.6 bits (166), Expect(2) = 1e-10 Identities = 36/67 (53%), Positives = 40/67 (59%), Gaps = 9/67 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP-----YVYKPPTPPPYE---SPPYVYKPPTPPPYVYESP-PYV 27 Y YK P PP Y YKSPP Y YK P PP Y+ PP VYK +PPP V++SP PY Sbjct: 148 YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAPYY 207 Query: 26 YKPPTPP 6 Y P PP Sbjct: 208 YTSPPPP 214 Score = 20.8 bits (42), Expect(2) = 1e-10 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 103 PPPPVYKYKSP 113 Score = 68.2 bits (165), Expect(2) = 2e-10 Identities = 38/71 (53%), Positives = 41/71 (57%), Gaps = 13/71 (18%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYE---SPPYVYKPPTPPP--YVYESPP--- 33 Y YK P PP Y YKSPP Y YK P PP Y+ PP VYK +PPP Y Y+SPP Sbjct: 108 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPP 167 Query: 32 --YVYKPPTPP 6 Y YK P PP Sbjct: 168 PVYKYKSPPPP 178 Score = 20.8 bits (42), Expect(2) = 2e-10 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 83 PPPPVYKYKSP 93 Score = 65.1 bits (157), Expect = 2e-09 Identities = 39/76 (51%), Positives = 42/76 (55%), Gaps = 19/76 (25%) Frame = -3 Query: 176 VYKPPTPPP--YVYKSPP-----YVYKPPTPP--PYESPP-----YVYKPPTPPPYVYES 39 VYK +PPP Y YKSPP Y YK P PP Y+SPP Y YK P PP Y Y+S Sbjct: 1 VYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKS 60 Query: 38 PP-----YVYKPPTPP 6 PP Y YK P PP Sbjct: 61 PPPPPPVYKYKSPPPP 76 Score = 65.1 bits (157), Expect = 2e-09 Identities = 39/73 (53%), Positives = 41/73 (56%), Gaps = 15/73 (20%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY---VYK-PPTPPP---YESPP-----YVYKPPTPPPYVYESP 36 Y YK P PP Y YKSPP VYK PPP Y+SPP Y YK P PP Y Y+SP Sbjct: 24 YKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSP 83 Query: 35 P---YVYKPPTPP 6 P Y YK P PP Sbjct: 84 PPPVYKYKSPPPP 96 Score = 54.7 bits (130), Expect(2) = 2e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPPPYESP-PYVYKPPTPPPY 51 Y YK P PP Y YKSPP Y YK P PP ++SP PY Y P PP + Sbjct: 170 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPAPYYYTSPPPPSH 216 Score = 23.5 bits (49), Expect(2) = 2e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y Y+SP Sbjct: 164 PPPPPVYKYKSP 175 [28][TOP] >UniRef100_Q9ZWT0 Extensin n=1 Tax=Adiantum capillus-veneris RepID=Q9ZWT0_ADICA Length = 207 Score = 77.0 bits (188), Expect = 6e-13 Identities = 42/92 (45%), Positives = 47/92 (51%), Gaps = 20/92 (21%) Frame = -3 Query: 218 HQHLPHMCM----NHHSYVYKPPTPP------PYVYKSPP---------YVYK-PPTPPP 99 H H PH + Y YK P PP PY+YKSPP Y+YK PP P P Sbjct: 67 HPHYPHKSPPPSPSSPPYKYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYIYKSPPPPSP 126 Query: 98 YESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PPY+YK P PPP PPY+YK P PPP Sbjct: 127 SPPPPYLYKSP-PPPSPSPPPPYIYKSPPPPP 157 Score = 75.1 bits (183), Expect = 2e-12 Identities = 36/74 (48%), Positives = 40/74 (54%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y+YK P PP PY+YKSPP Y+YK P PP P PPY+YK P PPP Sbjct: 100 YIYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYIYKSPPPPPCT 159 Query: 47 YESPPYVYKPPTPP 6 PPY Y P PP Sbjct: 160 PSPPPYFYSSPPPP 173 Score = 73.6 bits (179), Expect = 7e-12 Identities = 34/60 (56%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y+YK P PPP PPY Y P PP P PPY YK P PPP PPYVYK P PPP Sbjct: 148 YIYKSPPPPPCTPSPPPYFYSSPPPPSPSPPPPYQYKSP-PPPSHPSPPPYVYKSPPPPP 206 Score = 68.2 bits (165), Expect = 3e-10 Identities = 36/75 (48%), Positives = 39/75 (52%), Gaps = 4/75 (5%) Frame = -3 Query: 218 HQHLPHMCMN---HHSYVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPY 51 H H H H Y +K P P P SPPY YK P PP P PPY+YK P PPP Sbjct: 54 HPHYHHHKQRTPWHPHYPHKSPPPSP---SSPPYKYKSPPPPSPSPPPPYIYKSP-PPPS 109 Query: 50 VYESPPYVYKPPTPP 6 PPY+YK P PP Sbjct: 110 PSPPPPYIYKSPPPP 124 [29][TOP] >UniRef100_Q43687 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata RepID=Q43687_VIGUN Length = 242 Score = 68.2 bits (165), Expect(2) = 7e-13 Identities = 37/75 (49%), Positives = 38/75 (50%), Gaps = 14/75 (18%) Frame = -3 Query: 188 HHSYVYKPPT----PPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPY 51 H+ Y PP PPPY YKS PPY YK PP P P PPY YK P PPP Sbjct: 70 HYEYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPR 128 Query: 50 VYESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 129 PSPPPPYYYKSPPPP 143 Score = 28.9 bits (63), Expect(2) = 7e-13 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPPYVY SP Sbjct: 42 PPPPPPYVYSSP 53 Score = 71.6 bits (174), Expect(2) = 2e-12 Identities = 37/74 (50%), Positives = 39/74 (52%), Gaps = 16/74 (21%) Frame = -3 Query: 182 SYVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPY 51 SY YK P PP PY YKSPP Y YK P PP P PPY YK P PPPY Sbjct: 167 SYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPPY 226 Query: 50 VYESPPYVYKPPTP 9 ++ P Y YK P P Sbjct: 227 EHKDPYYQYKSPPP 240 Score = 24.3 bits (51), Expect(2) = 2e-12 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 129 PSPPPPYYYKSP 140 Score = 68.9 bits (167), Expect(2) = 1e-11 Identities = 41/91 (45%), Positives = 42/91 (46%), Gaps = 32/91 (35%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP----------YVYKPPTPP-PYESPPYVYKPPTPP-- 57 Y YK P PP PY YKSPP Y YK P PP P PPY YK P PP Sbjct: 135 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPSYYYKSPPPPSPSPPPPYYYKSPPPPSP 194 Query: 56 ----PYVYES---------PPYVYKPPTPPP 3 PY Y+S PPY YK P PPP Sbjct: 195 SPPPPYYYKSPPPPSPSPPPPYYYKSPPPPP 225 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 97 PSPPPPYYYKSP 108 Score = 66.6 bits (161), Expect(2) = 5e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK P PP P PPY YK P PPP Sbjct: 87 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSP-PPPSP 145 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 146 SPPPPYYYKSPPPP 159 Score = 24.3 bits (51), Expect(2) = 5e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 81 PSPPPPYYYKSP 92 Score = 70.1 bits (170), Expect = 7e-11 Identities = 36/76 (47%), Positives = 38/76 (50%), Gaps = 17/76 (22%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPP----------------YVYKPPTPP-PYESPPYVYKPPTPPP 54 +Y + PP PPPYVY SPP Y YK P PP P PPY YK P PPP Sbjct: 37 AYTHSPPPPPPYVYSSPPPPSLSPPPPYKYKDPHYEYKSPPPPSPSPPPPYYYKSP-PPP 95 Query: 53 YVYESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 96 SPSPPPPYYYKSPPPP 111 Score = 63.9 bits (154), Expect(2) = 3e-10 Identities = 35/67 (52%), Positives = 36/67 (53%), Gaps = 12/67 (17%) Frame = -3 Query: 170 KPPTPPPYVYKS---------PPYVYKPPTPPPYESPP---YVYKPPTPPPYVYESPPYV 27 +P PPPY YKS PPY YK P PPP SPP Y YK P PPP PPY Sbjct: 128 RPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPSYYYKSP-PPPSPSPPPPYY 185 Query: 26 YKPPTPP 6 YK P PP Sbjct: 186 YKSPPPP 192 Score = 24.3 bits (51), Expect(2) = 3e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 113 PSPPPPYYYKSP 124 Score = 63.9 bits (154), Expect(2) = 3e-09 Identities = 35/74 (47%), Positives = 35/74 (47%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PP Sbjct: 103 YYYKSPPPPSPSPPPPYYYKSPPPPRPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 162 Query: 47 YESPPYVYKPPTPP 6 P Y YK P PP Sbjct: 163 PPPPSYYYKSPPPP 176 Score = 20.8 bits (42), Expect(2) = 3e-09 Identities = 8/15 (53%), Positives = 10/15 (66%), Gaps = 3/15 (20%) Frame = -2 Query: 219 PPT---PPPYVYESP 184 PP+ PPPY Y+ P Sbjct: 55 PPSLSPPPPYKYKDP 69 [30][TOP] >UniRef100_Q09085 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q09085_PHAVU Length = 368 Score = 76.6 bits (187), Expect = 8e-13 Identities = 41/87 (47%), Positives = 43/87 (49%), Gaps = 16/87 (18%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP------- 60 H+H P H Y Y P PPPY YKSPPY YK P PP PY YK P P Sbjct: 99 HKHSP--TPYHKPYYYNSP-PPPYYYKSPPYYYKSPPPPSPSPSPYYYKSPPPPHKDPYY 155 Query: 59 PPYVYES---------PPYVYKPPTPP 6 PPY Y+S PPY YK P PP Sbjct: 156 PPYYYKSPPPPSPSPPPPYYYKSPPPP 182 Score = 66.2 bits (160), Expect(2) = 6e-11 Identities = 34/64 (53%), Positives = 34/64 (53%), Gaps = 10/64 (15%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 P PPPY YKS PPY YK PP P P PPY YK P PPP PPY YK Sbjct: 254 PSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYKS 312 Query: 17 PTPP 6 P PP Sbjct: 313 PPPP 316 Score = 24.3 bits (51), Expect(2) = 6e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 216 PSPPPPYYYKSP 227 Score = 65.9 bits (159), Expect(2) = 8e-11 Identities = 36/79 (45%), Positives = 37/79 (46%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYK------PPTPPPYVYES- 39 Y YK P PP PY YKSPP P P P PPY YK P PPPY Y+S Sbjct: 222 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSP 281 Query: 38 --------PPYVYKPPTPP 6 PPY YK P PP Sbjct: 282 PPPSPSPPPPYYYKSPPPP 300 Score = 24.3 bits (51), Expect(2) = 8e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 184 PSPPPPYYYKSP 195 Score = 65.1 bits (157), Expect(2) = 1e-10 Identities = 38/81 (46%), Positives = 40/81 (49%), Gaps = 22/81 (27%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPP--- 57 Y YK P PP PY YKS PPY YK PP P P PPY YK P PP Sbjct: 260 YYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPD 319 Query: 56 ---PYVYESPPYVYKPPTPPP 3 PY Y+SPP PP+P P Sbjct: 320 PPTPYYYKSPP----PPSPSP 336 Score = 24.3 bits (51), Expect(2) = 1e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 232 PSPPPPYYYKSP 243 Score = 68.9 bits (167), Expect = 2e-10 Identities = 39/83 (46%), Positives = 40/83 (48%), Gaps = 16/83 (19%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVY 75 PH + Y YK P PP PY YKS PPY YK PP P P PPY Y Sbjct: 149 PHKDPYYPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYY 208 Query: 74 KPPTPPPYVYESPPYVYKPPTPP 6 K P PPP PPY YK P PP Sbjct: 209 KSP-PPPSPSPPPPYYYKSPPPP 230 Score = 63.2 bits (152), Expect(2) = 5e-10 Identities = 37/80 (46%), Positives = 38/80 (47%), Gaps = 22/80 (27%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYKPPTPPPYESP-PYVYK------PP 66 Y YK P PP PY YKS PPY YK P PP + P PY YK P Sbjct: 276 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPDPPTPYYYKSPPPPSPS 335 Query: 65 TPPPYVYESPPYVYKPPTPP 6 PPPY Y SPP K P PP Sbjct: 336 PPPPYYYVSPPPPTKSPPPP 355 Score = 24.3 bits (51), Expect(2) = 5e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 254 PSPPPPYYYKSP 265 Score = 66.6 bits (161), Expect = 8e-10 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP-----PYVYKSPP----------YVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKSPP Y YK PP P P PPY YK P PPP Sbjct: 126 YYYKSPPPPSPSPSPYYYKSPPPPHKDPYYPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 184 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 185 SPPPPYYYKSPPPP 198 Score = 66.6 bits (161), Expect = 8e-10 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 174 YYYKSPPPPSPSPPPPYYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 232 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 233 SPPPPYYYKSPPPP 246 Score = 65.5 bits (158), Expect = 2e-09 Identities = 37/79 (46%), Positives = 38/79 (48%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK-----PPT 63 Y YK P PP PY YKS PPY YK PP P P PPY YK P+ Sbjct: 190 YYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 249 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPP PPY YK P PP Sbjct: 250 PPPSPSPPPPYYYKSPPPP 268 Score = 48.5 bits (114), Expect(2) = 9e-06 Identities = 32/71 (45%), Positives = 33/71 (46%), Gaps = 15/71 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYESPPYVYKPPTPPPYVY 45 Y YK P PP PY YKSPP Y Y P PPP +SPP PP Y Y Sbjct: 308 YYYKSPPPPSPDPPTPYYYKSPPPPSPSPPPPYYYVSP-PPPTKSPP-------PPAYSY 359 Query: 44 ESPPYVYKPPT 12 SPP PPT Sbjct: 360 ASPP----PPT 366 Score = 24.3 bits (51), Expect(2) = 9e-06 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 270 PSPPPPYYYKSP 281 [31][TOP] >UniRef100_Q41707 Extensin class 1 protein n=1 Tax=Vigna unguiculata RepID=Q41707_VIGUN Length = 489 Score = 70.5 bits (171), Expect(2) = 9e-13 Identities = 39/74 (52%), Positives = 39/74 (52%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 YVYK P PP PY YKSPP Y YK P PP P PPY YK P PPP Sbjct: 92 YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 150 Query: 47 YESPPYVYKPPTPP 6 PPYVYK P PP Sbjct: 151 SPPPPYVYKSPPPP 164 Score = 70.5 bits (171), Expect(2) = 9e-13 Identities = 39/74 (52%), Positives = 39/74 (52%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 YVYK P PP PY YKSPP Y YK P PP P PPY YK P PPP Sbjct: 156 YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 214 Query: 47 YESPPYVYKPPTPP 6 PPYVYK P PP Sbjct: 215 SPPPPYVYKSPPPP 228 Score = 70.5 bits (171), Expect(2) = 9e-13 Identities = 42/89 (47%), Positives = 43/89 (48%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 YVYK P PP PY YKS PPY YK PP P P PPY YK P Sbjct: 348 YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 407 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPY Y+S PPYVYK P PP Sbjct: 408 PPPPYYYKSPPPPSPSPPPPYVYKSPPPP 436 Score = 26.2 bits (56), Expect(2) = 9e-13 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 86 PSPPPPYVYKSP 97 Score = 26.2 bits (56), Expect(2) = 9e-13 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 150 PSPPPPYVYKSP 161 Score = 26.2 bits (56), Expect(2) = 9e-13 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 342 PSPPPPYVYKSP 353 Score = 68.6 bits (166), Expect(2) = 3e-12 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 YVYK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 220 YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 278 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 279 SPPPPYYYKSPPPP 292 Score = 26.2 bits (56), Expect(2) = 3e-12 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 214 PSPPPPYVYKSP 225 Score = 74.3 bits (181), Expect = 4e-12 Identities = 39/75 (52%), Positives = 40/75 (53%), Gaps = 8/75 (10%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPP-------PYVYKSPPYVYK-PPTPPPYESPPYVYKPPTPPPY 51 P N Y YK P PP PYV+K PPY YK PP P P PPYVYK P PPP Sbjct: 43 PPYYYNAPPYYYKSPPPPSPSPPPPPYVHKYPPYYYKSPPPPSPSPPPPYVYKSP-PPPS 101 Query: 50 VYESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 102 PSPPPPYYYKSPPPP 116 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKSPP Y YK P PP P PPYVYK P PPP Sbjct: 108 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSP-PPPSP 166 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 167 SPPPPYYYKSPPPP 180 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPYVYK PP P P PPY YK P PPP Sbjct: 124 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSP-PPPSP 182 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 183 SPPPPYYYKSPPPP 196 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKSPP Y YK P PP P PPYVYK P PPP Sbjct: 172 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSP-PPPSP 230 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 231 SPPPPYYYKSPPPP 244 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPYVYK PP P P PPY YK P PPP Sbjct: 188 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSP-PPPSP 246 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 247 SPPPPYYYKSPPPP 260 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PYVYKS PPY YK PP P P PPY YK P PPP Sbjct: 204 YYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 262 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 263 SPPPPYYYKSPPPP 276 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKSPP Y YK P PP P PPY YK P PPP Sbjct: 284 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 342 Query: 47 YESPPYVYKPPTPP 6 PPYVYK P PP Sbjct: 343 SPPPPYVYKSPPPP 356 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKSPP Y YK P PP P PPYVYK P PPP Sbjct: 300 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSP-PPPSP 358 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 359 SPPPPYYYKSPPPP 372 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPYVYK PP P P PPY YK P PPP Sbjct: 316 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSP-PPPSP 374 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 375 SPPPPYYYKSPPPP 388 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PYVYKS PPY YK PP P P PPY YK P PPP Sbjct: 332 YYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 390 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 391 SPPPPYYYKSPPPP 404 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKSPP Y YK P PP P PPYVYK P PPP Sbjct: 380 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSP-PPPSP 438 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 439 SPPPPYYYKSPPPP 452 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPYVYK PP P P PPY YK P PPP Sbjct: 396 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSP-PPPSP 454 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 455 SPPPPYYYKSPPPP 468 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 102 PSPPPPYYYKSP 113 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 118 PSPPPPYYYKSP 129 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 134 PSPPPPYYYKSP 145 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 166 PSPPPPYYYKSP 177 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 182 PSPPPPYYYKSP 193 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 246 PSPPPPYYYKSP 257 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 262 PSPPPPYYYKSP 273 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 278 PSPPPPYYYKSP 289 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 294 PSPPPPYYYKSP 305 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 358 PSPPPPYYYKSP 369 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 374 PSPPPPYYYKSP 385 Score = 66.6 bits (161), Expect(2) = 4e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 236 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 294 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 295 SPPPPYYYKSPPPP 308 Score = 66.6 bits (161), Expect(2) = 4e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 252 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 310 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 311 SPPPPYYYKSPPPP 324 Score = 24.3 bits (51), Expect(2) = 4e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 198 PSPPPPYYYKSP 209 Score = 24.3 bits (51), Expect(2) = 4e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 230 PSPPPPYYYKSP 241 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/54 (55%), Positives = 33/54 (61%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 P PPY Y +PPY YK P PPP SPP PPPYV++ PPY YK P PP Sbjct: 39 PKQTPPYYYNAPPYYYKSP-PPPSPSPP-------PPPYVHKYPPYYYKSPPPP 84 [32][TOP] >UniRef100_Q7DLZ6 Extensin-like protein (Fragment) n=1 Tax=Vigna unguiculata RepID=Q7DLZ6_VIGUN Length = 164 Score = 70.5 bits (171), Expect(2) = 9e-13 Identities = 42/89 (47%), Positives = 43/89 (48%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 YVYK P PP PY YKS PPY YK PP P P PPY YK P Sbjct: 23 YVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 82 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPY Y+S PPYVYK P PP Sbjct: 83 PPPPYYYKSPPPPSPSPPPPYVYKSPPPP 111 Score = 26.2 bits (56), Expect(2) = 9e-13 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 17 PSPPPPYVYKSP 28 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PYVYKS PPY YK PP P P PPY YK P PPP Sbjct: 7 YYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 65 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 66 SPPPPYYYKSPPPP 79 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKSPP Y YK P PP P PPYVYK P PPP Sbjct: 55 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSP-PPPSP 113 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 114 SPPPPYYYKSPPPP 127 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPYVYK PP P P PPY YK P PPP Sbjct: 71 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSP-PPPSP 129 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 130 SPPPPYYYKSPPPP 143 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 1 PSPPPPYYYKSP 12 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 33 PSPPPPYYYKSP 44 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 49 PSPPPPYYYKSP 60 Score = 68.2 bits (165), Expect = 3e-10 Identities = 35/64 (54%), Positives = 35/64 (54%), Gaps = 10/64 (15%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 P PPPY YKS PPYVYK PP P P PPY YK P PPP PPY YK Sbjct: 1 PSPPPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYKS 59 Query: 17 PTPP 6 P PP Sbjct: 60 PPPP 63 [33][TOP] >UniRef100_C6TK91 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TK91_SOYBN Length = 146 Score = 76.3 bits (186), Expect = 1e-12 Identities = 42/84 (50%), Positives = 44/84 (52%), Gaps = 25/84 (29%) Frame = -3 Query: 182 SYVYKPPTPP-------PYVYKSPPYVYK-PPTPPPYESPPYVYK------PPTPPPYVY 45 S Y PTPP PY YKSPPY YK PP P P PPYVYK P PPPY+Y Sbjct: 34 SNYYPHPTPPTYRQINPPYYYKSPPYYYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYIY 93 Query: 44 ESP-----------PYVYKPPTPP 6 +SP PYVYK P PP Sbjct: 94 KSPPPPSPSPPPPSPYVYKSPPPP 117 Score = 70.9 bits (172), Expect = 4e-11 Identities = 36/68 (52%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYK--------PPTPPPYVYESPPYV 27 Y YK P PPP PPYVYK PP P P PPY+YK PP P PYVY+SPP Sbjct: 59 YYYKSP-PPPSPSPPPPYVYKSPPPPSPSPPPPYIYKSPPPPSPSPPPPSPYVYKSPPPP 117 Query: 26 YKPPTPPP 3 P+PPP Sbjct: 118 SPSPSPPP 125 Score = 63.2 bits (152), Expect(2) = 1e-10 Identities = 33/63 (52%), Positives = 36/63 (57%), Gaps = 6/63 (9%) Frame = -3 Query: 179 YVYKPP------TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 YVYK P PPPY+YKSPP PP+P P PYVYK P PPP SPP + P Sbjct: 75 YVYKSPPPPSPSPPPPYIYKSPP----PPSPSPPPPSPYVYKSP-PPPSPSPSPPPSHSP 129 Query: 17 PTP 9 P P Sbjct: 130 PPP 132 Score = 26.2 bits (56), Expect(2) = 1e-10 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 69 PSPPPPYVYKSP 80 Score = 55.5 bits (132), Expect(2) = 3e-08 Identities = 28/57 (49%), Positives = 31/57 (54%), Gaps = 8/57 (14%) Frame = -3 Query: 179 YVYKPPTPP--------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP 33 Y+YK P PP PYVYKSPP P+PPP SP PP PY+Y SPP Sbjct: 91 YIYKSPPPPSPSPPPPSPYVYKSPPPPSPSPSPPPSHSP-----PPPHHPYLYNSPP 142 Score = 25.8 bits (55), Expect(2) = 3e-08 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y+SP Sbjct: 85 PSPPPPYIYKSP 96 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/73 (43%), Positives = 35/73 (47%), Gaps = 24/73 (32%) Frame = -3 Query: 152 PYVYKSPPYVYKPPTPPP---------YESPPYVYK------PPTPPPYVYES------- 39 PY Y P Y PTPP Y+SPPY YK P PPPYVY+S Sbjct: 28 PY-YGQPSNYYPHPTPPTYRQINPPYYYKSPPYYYKSPPPPSPSPPPPYVYKSPPPPSPS 86 Query: 38 --PPYVYKPPTPP 6 PPY+YK P PP Sbjct: 87 PPPPYIYKSPPPP 99 [34][TOP] >UniRef100_Q6GUG3 Serine/proline-rich repeat protein n=2 Tax=Lupinus angustifolius RepID=Q6GUG3_LUPAN Length = 198 Score = 69.7 bits (169), Expect(2) = 2e-12 Identities = 38/74 (51%), Positives = 40/74 (54%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYV 48 YVYK P PP PY YKSPP Y+YK P PP P PPYV K P PPP Sbjct: 61 YVYKSPPPPSPSPPPPYAYKSPPPPSPSPPPPYLYKSPPPPSPSPPPPYVNKSP-PPPSS 119 Query: 47 YESPPYVYKPPTPP 6 PPY+YK P PP Sbjct: 120 SPPPPYIYKSPPPP 133 Score = 26.2 bits (56), Expect(2) = 2e-12 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 55 PSPPPPYVYKSP 66 Score = 68.2 bits (165), Expect = 3e-10 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPP-PYVYKSPPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPP 33 P+ SY Y+ P PP P PPYVYK PP P P PPY YK P PPP PP Sbjct: 34 PYYYYQPPSYYYQSPPPPSPSPSPPPPYVYKSPPPPSPSPPPPYAYKSP-PPPSPSPPPP 92 Query: 32 YVYKPPTPP 6 Y+YK P PP Sbjct: 93 YLYKSPPPP 101 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 YV K P PP PY+YKSPP P PPP SPP P PPP PPYVYK Sbjct: 109 YVNKSPPPPSSSPPPPYIYKSPP-PPSPSPPPPSPSPP-PPSPSPPPPSPSPPPPYVYKS 166 Query: 17 PTPP 6 P PP Sbjct: 167 PPPP 170 Score = 25.0 bits (53), Expect(2) = 2e-09 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y+SP Sbjct: 87 PSPPPPYLYKSP 98 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 31/72 (43%), Positives = 34/72 (47%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPP-----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP----PPYVYESP--- 36 Y+YK P +PPP PP PP P P PPYVYK P P PP SP Sbjct: 125 YIYKSPPPPSPSPPPPSPSPPPPSPSPPPPSPSPPPPYVYKSPPPPSPSPPPPSPSPPPP 184 Query: 35 --PYVYKPPTPP 6 PY+Y P PP Sbjct: 185 YHPYLYSSPPPP 196 Score = 24.3 bits (51), Expect(2) = 2e-07 Identities = 9/15 (60%), Positives = 12/15 (80%), Gaps = 3/15 (20%) Frame = -2 Query: 219 PPT---PPPYVYESP 184 PP+ PPPY+Y+SP Sbjct: 116 PPSSSPPPPYIYKSP 130 [35][TOP] >UniRef100_Q40415 Extensin (Fragment) n=1 Tax=Nicotiana sylvestris RepID=Q40415_NICSY Length = 131 Score = 74.7 bits (182), Expect(2) = 2e-12 Identities = 39/66 (59%), Positives = 43/66 (65%), Gaps = 9/66 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP---YVYKPPTPPP--YESPP---YVYKPPTPPPYVYES-PPYVY 24 +Y+ P PP Y YKSPP Y YK P PPP Y+SPP Y YK P PPP VY+S PP VY Sbjct: 53 IYRSPPPPVYKYKSPPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVY 112 Query: 23 KPPTPP 6 K P PP Sbjct: 113 KSPPPP 118 Score = 20.8 bits (42), Expect(2) = 2e-12 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 37 PPPPVYKYKSP 47 Score = 74.3 bits (181), Expect = 4e-12 Identities = 39/70 (55%), Positives = 43/70 (61%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPP--- 33 YVY P PP Y YKSPP +Y+ P PP Y+SPP Y YK P PPP VY+SPP Sbjct: 32 YVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPIYKYKSPPPPPPVYKSPPPPV 91 Query: 32 YVYKPPTPPP 3 Y YK P PPP Sbjct: 92 YKYKSPPPPP 101 Score = 68.2 bits (165), Expect(2) = 2e-10 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKS-PPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y YK P PPP VYKS PP VYK +PPP PP VYK P PP Y PPY Y +PPP Sbjct: 72 YKYKSPPPPPPVYKSPPPPVYKYKSPPP---PPPVYKSPPPPVYKSPPPPYHYYYTSPPP 128 Score = 20.8 bits (42), Expect(2) = 2e-10 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 57 PPPPVYKYKSP 67 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 5/49 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPTPPPYESPP--YVYKPPTPPPYVY 45 VYK P PP Y YKSPP VYK P PP Y+SPP Y Y +PPP Y Sbjct: 83 VYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSPPPPYHYYYTSPPPPHY 131 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 77 PPPPPPVYKSP 87 [36][TOP] >UniRef100_Q43505 Extensin-like protein Dif54 n=1 Tax=Solanum lycopersicum RepID=Q43505_SOLLC Length = 436 Score = 74.3 bits (181), Expect = 4e-12 Identities = 38/62 (61%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPPP--YESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 S YK P PPP YKSP Y YK P PPP YE P YK P PPPY ES PY YK P P Sbjct: 310 SKYYKSPPPPPTYYKSPVY-YKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPY-YKSPPP 367 Query: 8 PP 3 PP Sbjct: 368 PP 369 Score = 72.8 bits (177), Expect(2) = 4e-12 Identities = 36/59 (61%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY--ESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 YK P PPP Y+ P YK P PPPY ES PY YK P PPPY ES PY YK P PPP Sbjct: 329 YKSPPPPPTYYEKSPSYYKSPLPPPYYKESMPY-YKSPPPPPYYKESTPY-YKSPPPPP 385 Score = 21.6 bits (44), Expect(2) = 4e-12 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 216 PTPPPYVYESPL 181 P PPP Y+SP+ Sbjct: 316 PPPPPTYYKSPV 327 Score = 70.9 bits (172), Expect(2) = 3e-11 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 YK P PPPY +S PY PP PP Y+ YK P PPPY ES PY YK P PPP Sbjct: 362 YKSPPPPPYYKESTPYYKSPPPPPYYKESTPSYKSPPPPPYYKESTPY-YKSPPPPP 417 Score = 20.8 bits (42), Expect(2) = 3e-11 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PP Y +SP Sbjct: 332 PPPPPTYYEKSP 343 Score = 70.1 bits (170), Expect = 7e-11 Identities = 37/59 (62%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY--ESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 YK P PPPY +S PY YK P PPPY ES PY YK P PPPY ES P YK P PPP Sbjct: 346 YKSPLPPPYYKESMPY-YKSPPPPPYYKESTPY-YKSPPPPPYYKESTP-SYKSPPPPP 401 Score = 64.7 bits (156), Expect = 3e-09 Identities = 35/63 (55%), Positives = 37/63 (58%), Gaps = 4/63 (6%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP--YVYKPPTPPP--YESPPYVYKPPTPPPYVYESPPYVYKPPT 12 Y YK P+P Y YKSP YK P PPP Y+SP Y YK P PPP YE P YK P Sbjct: 293 YYYKSPSPSQY-YKSPAPSKYYKSPPPPPTYYKSPVY-YKSPPPPPTYYEKSPSYYKSPL 350 Query: 11 PPP 3 PPP Sbjct: 351 PPP 353 Score = 63.9 bits (154), Expect = 5e-09 Identities = 33/58 (56%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY--ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPY +S P YK P PPPY ES PY YK P PPPY ES P PP+ P Sbjct: 378 YKSPPPPPYYKESTPS-YKSPPPPPYYKESTPY-YKSPPPPPYYKESTPSYKSPPSSP 433 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/64 (50%), Positives = 36/64 (56%), Gaps = 7/64 (10%) Frame = -3 Query: 173 YKPPTPPPYVYKSPP----YVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPP 15 YK P+P Y YKSP Y YK P+P Y +P YK P PPP Y+SP Y YK P Sbjct: 275 YKSPSPVKY-YKSPAPSKHYYYKSPSPSQYYKSPAPSKYYKSPPPPPTYYKSPVY-YKSP 332 Query: 14 TPPP 3 PPP Sbjct: 333 PPPP 336 [37][TOP] >UniRef100_Q41983 Extensin precusor (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q41983_ARATH Length = 99 Score = 74.3 bits (181), Expect = 4e-12 Identities = 45/82 (54%), Positives = 48/82 (58%), Gaps = 23/82 (28%) Frame = -3 Query: 182 SYVYKPPTPPP--YVYKSPP-----YVYKPPTPPP----YESPP-----YVYKPPTPPP- 54 +YVYK P PP YVYKSPP YVYK P PP Y+SPP YVYK P PP Sbjct: 10 TYVYKSPXPPTPTYVYKSPPPPTPTYVYKSPPPPTPTYVYKSPPPPTPTYVYKSPPPPTP 69 Query: 53 -YVYESPP-----YVYKPPTPP 6 YVY+SPP YVYK P PP Sbjct: 70 KYVYKSPPPPTPTYVYKSPPPP 91 Score = 60.8 bits (146), Expect(2) = 5e-09 Identities = 37/70 (52%), Positives = 40/70 (57%), Gaps = 16/70 (22%) Frame = -3 Query: 182 SYVYKPPTPPP--YVYKSPP-----YVYKPPTPPP----YESPP-----YVYKPPTPPPY 51 +YVYK P PP YVYKSPP YVYK P PP Y+SPP YVYK P PP Sbjct: 34 TYVYKSPPPPTPTYVYKSPPPPTPTYVYKSPPPPTPKYVYKSPPPPTPTYVYKSPPPP-- 91 Query: 50 VYESPPYVYK 21 +P YVYK Sbjct: 92 ---TPKYVYK 98 Score = 23.1 bits (48), Expect(2) = 5e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P YVY+SP Sbjct: 29 PPPTPTYVYKSP 40 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/60 (53%), Positives = 35/60 (58%), Gaps = 16/60 (26%) Frame = -3 Query: 137 SPPYVYKPPTPPP----YESPP-----YVYK--PPTPPPYVYESPP-----YVYKPPTPP 6 +P YVYK P PP Y+SPP YVYK PP P YVY+SPP YVYK P PP Sbjct: 8 APTYVYKSPXPPTPTYVYKSPPPPTPTYVYKSPPPPTPTYVYKSPPPPTPTYVYKSPPPP 67 [38][TOP] >UniRef100_Q9ZUC3 F5O8.27 protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZUC3_ARATH Length = 895 Score = 69.7 bits (169), Expect(2) = 7e-12 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P P Y+S PPYVY P PPPY SP YK P PP Sbjct: 706 YKSP-PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 763 Score = 69.3 bits (168), Expect(2) = 7e-12 Identities = 39/68 (57%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 588 YVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSP-PPPYVYSSPPPP 646 Query: 26 YKPPTPPP 3 Y PTP P Sbjct: 647 YYSPTPKP 654 Score = 24.3 bits (51), Expect(2) = 7e-12 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPPYVY SP Sbjct: 584 SPPPYVYSSP 593 Score = 23.9 bits (50), Expect(2) = 7e-12 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 660 PPPYVYSSP 668 Score = 68.6 bits (166), Expect(2) = 2e-11 Identities = 38/68 (55%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKS--PPYVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKS PPYVY P PP Y SP VYK P PPPYVY SPP Sbjct: 436 YVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 494 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 495 YYSPSPKP 502 Score = 23.9 bits (50), Expect(2) = 2e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 433 PPPYVYSSP 441 Score = 68.2 bits (165), Expect(2) = 2e-11 Identities = 36/60 (60%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P P Y+S PPYVY P PPPY SP +YK P PP Sbjct: 228 VYKSP-PPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSP-PPPYYSPSPKPIYKSPPPP 285 Score = 68.2 bits (165), Expect(2) = 2e-11 Identities = 41/86 (47%), Positives = 42/86 (48%), Gaps = 27/86 (31%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKSPP YVY P PPPY S PPYVY P PP Sbjct: 713 YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 772 Query: 56 PY------VYES--PPYVYKPPTPPP 3 Y Y+S PPYVY P PPP Sbjct: 773 YYSPSPKVEYKSPPPPYVYSSPPPPP 798 Score = 23.9 bits (50), Expect(2) = 2e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 183 PPPYVYNSP 191 Score = 23.9 bits (50), Expect(2) = 2e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 685 PPPYVYSSP 693 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 38/68 (55%), Positives = 40/68 (58%), Gaps = 11/68 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPY------VYES--PPYV 27 YK P PPPYVY SPP Y P P P Y+S PPYVY P PP Y Y+S PPYV Sbjct: 681 YKSP-PPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYV 739 Query: 26 YKPPTPPP 3 Y P PPP Sbjct: 740 YSSPPPPP 747 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 635 PPPYVYSSP 643 Score = 67.4 bits (163), Expect(2) = 3e-11 Identities = 37/68 (54%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP Y+Y P PP Y SP VYK P PPPYVY SPP Sbjct: 186 YVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSP-PPPYVYSSPPPP 244 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 245 YYSPSPKP 252 Score = 67.4 bits (163), Expect(2) = 3e-11 Identities = 37/68 (54%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP +YK P PPPYVY SPP Sbjct: 236 YVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSP-PPPYVYNSPPPP 294 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 295 YYSPSPKP 302 Score = 67.4 bits (163), Expect(2) = 3e-11 Identities = 37/68 (54%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP VYK P PPPY+Y SPP Sbjct: 361 YVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSP-PPPYIYNSPPPP 419 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 420 YYSPSPKP 427 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 158 PPPYVYSSP 166 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 233 PPPYVYSSP 241 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 333 PPPYVYNSP 341 Score = 67.4 bits (163), Expect(2) = 4e-11 Identities = 37/68 (54%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 Y+Y P PP Y VYKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 211 YIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSP-PPPYVYSSPPPP 269 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 270 YYSPSPKP 277 Score = 67.0 bits (162), Expect(2) = 4e-11 Identities = 36/60 (60%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 +YK P PPPYVY SPP Y P+P P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 278 IYKSP-PPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFP-PPPYYSPSPKPVYKSPPPP 335 Score = 67.0 bits (162), Expect(2) = 4e-11 Identities = 38/76 (50%), Positives = 41/76 (53%), Gaps = 18/76 (23%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPP---------------PY 51 VYK P PPPYVY SPP Y P+P P Y+SPP YVY P PP PY Sbjct: 328 VYKSP-PPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPY 386 Query: 50 VYESPPYVYKPPTPPP 3 VY SPP Y P+P P Sbjct: 387 VYSSPPPPYYSPSPKP 402 Score = 23.9 bits (50), Expect(2) = 4e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 258 PPPYVYSSP 266 Score = 23.9 bits (50), Expect(2) = 4e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 283 PPPYVYNSP 291 Score = 23.5 bits (49), Expect(2) = 4e-11 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY+Y SP Sbjct: 208 PPPYIYSSP 216 Score = 69.7 bits (169), Expect(2) = 6e-11 Identities = 38/69 (55%), Positives = 40/69 (57%), Gaps = 10/69 (14%) Frame = -3 Query: 179 YVYKPPTPPPY-------VYKS--PPYVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPY 30 YVY P PPPY YKS PPYVY P PP Y +P VYK P PPPYVY SPP Sbjct: 562 YVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSP-PPPYVYNSPPP 620 Query: 29 VYKPPTPPP 3 Y P+P P Sbjct: 621 PYYSPSPKP 629 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P P Y+S PPY+Y P PPPY SP VYK P PP Sbjct: 179 YKSP-PPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSP-PPPYYSPSPKPVYKSPPPP 235 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 37/68 (54%), Positives = 41/68 (60%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPY------VYES--PPY 30 VYK P PPPY+Y SPP Y P+P P Y+S PPYVY P PP Y Y+S PPY Sbjct: 403 VYKSP-PPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPY 461 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 462 VYSSPPPP 469 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 38/75 (50%), Positives = 39/75 (52%), Gaps = 18/75 (24%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPP---------------PYV 48 YK P PPPYVY SPP Y PTP P Y+SPP YVY P PP PYV Sbjct: 631 YKSP-PPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYV 689 Query: 47 YESPPYVYKPPTPPP 3 Y SPP Y P P P Sbjct: 690 YSSPPPPYYSPAPKP 704 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 133 PPPYVYNSP 141 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 358 PPPYVYSSP 366 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 610 PPPYVYNSP 618 Score = 20.8 bits (42), Expect(2) = 6e-11 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 P PYVY SP Sbjct: 559 PTPYVYHSP 567 Score = 65.9 bits (159), Expect(2) = 1e-10 Identities = 40/86 (46%), Positives = 42/86 (48%), Gaps = 27/86 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PPPY SP PYVY P P Sbjct: 738 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSP-PPPYYSPSPKVEYKSPPPPYVYSSPPP 796 Query: 59 PPYV-------YESPPYVYKPPTPPP 3 PPY Y+SPP Y +PPP Sbjct: 797 PPYYSPSPKVEYKSPPPPYVYSSPPP 822 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P P Y+S PPYVY P PPPY SP +YK P P Sbjct: 478 VYKSP-PPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSP-PPPYYSPSPKVIYKSPPHP 535 Score = 24.3 bits (51), Expect(2) = 1e-10 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPPYVY SP Sbjct: 457 SPPPYVYSSP 466 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 710 PPPYVYSSP 718 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 37/68 (54%), Positives = 38/68 (55%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 61 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 119 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 120 YYSPSPKP 127 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P P Y+S PPYVY P PPPY SP YK P PP Sbjct: 104 YKSP-PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSP-PPPYYSPSPKVEYKSPPPP 160 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 37/68 (54%), Positives = 38/68 (55%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 136 YVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 194 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 195 YYSPSPKP 202 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 32 PPPYVYSSP 40 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 58 PPPYVYSSP 66 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 108 PPPYVYSSP 116 Score = 67.0 bits (162), Expect(2) = 2e-10 Identities = 36/59 (61%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 354 YKSP-PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSP-PPPYYSPSPKPVYKSPPPP 410 Score = 21.6 bits (44), Expect(2) = 2e-10 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY P Sbjct: 308 PPPYVYSFP 316 Score = 64.3 bits (155), Expect(2) = 3e-10 Identities = 36/66 (54%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP Y+Y P PP Y SP YK P PPPYVY SPP Sbjct: 386 YVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSP-PPPYVYSSPPPP 444 Query: 26 YKPPTP 9 Y P+P Sbjct: 445 YYSPSP 450 Score = 64.3 bits (155), Expect(2) = 3e-10 Identities = 37/77 (48%), Positives = 40/77 (51%), Gaps = 9/77 (11%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESP-PYVYKPPTPPP 54 PH+C+ PP PP Y YKSPP YVY P PPPY SP P +PPP Sbjct: 535 PHVCVC-------PPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPP 587 Query: 53 YVYESPPYVYKPPTPPP 3 YVY SPP Y P P P Sbjct: 588 YVYSSPPPPYYSPAPKP 604 Score = 23.9 bits (50), Expect(2) = 3e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 383 PPPYVYSSP 391 Score = 23.9 bits (50), Expect(2) = 3e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 508 PPPYVYNSP 516 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 111 YVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSP-PPPYVYSSPPPP 169 Query: 26 YKPPTP 9 Y P+P Sbjct: 170 YYSPSP 175 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 83 PPPYVYSSP 91 Score = 67.0 bits (162), Expect(2) = 5e-10 Identities = 38/76 (50%), Positives = 41/76 (53%), Gaps = 18/76 (23%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPP---------------PY 51 VYK P PPPYVY SPP Y P+P P Y+SPP YVY P PP PY Sbjct: 605 VYKSP-PPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPY 663 Query: 50 VYESPPYVYKPPTPPP 3 VY SPP Y P+P P Sbjct: 664 VYSSPPPPYYSPSPKP 679 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 39/88 (44%), Positives = 39/88 (44%), Gaps = 30/88 (34%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTP 60 YVY P PPPY YKSPP YVY P PP Y SP PYVY P P Sbjct: 789 YVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPP 848 Query: 59 PPYVYE----------SPPYVYKPPTPP 6 P Y Y PPYVY P PP Sbjct: 849 PAY-YSPSPKIEYKSPPPPYVYSSPPPP 875 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 761 PPPYVYSSP 769 Score = 20.4 bits (41), Expect(2) = 5e-10 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY SP Sbjct: 567 PPPPPYYSPSP 577 Score = 63.2 bits (152), Expect(2) = 8e-10 Identities = 38/77 (49%), Positives = 39/77 (50%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 Y+Y P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 411 YIYNSPPPPYYSPSPKPSYKSPPPPYVYSSP-PPPYYSPSPKLTYKSSPPPYVYSSP-PP 468 Query: 56 PYVYESPPYVYKPPTPP 6 PY SP VYK P PP Sbjct: 469 PYYSPSPKVVYKSPPPP 485 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 39/87 (44%), Positives = 39/87 (44%), Gaps = 29/87 (33%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESP-----------PYVYKPPTPP 57 YVY P PP Y YKSPP YVY P PPPY SP PYVY P PP Sbjct: 764 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 823 Query: 56 PYVYE----------SPPYVYKPPTPP 6 Y Y PPYVY P PP Sbjct: 824 TY-YSPSPKVEYKSPPPPYVYNSPPPP 849 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 735 PPPYVYSSP 743 Score = 23.5 bits (49), Expect(2) = 8e-10 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY+Y SP Sbjct: 408 PPPYIYNSP 416 Score = 66.6 bits (161), Expect = 8e-10 Identities = 38/68 (55%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 286 YVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSP-PPPYVYNSPPPP 344 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 345 YYSPSPKP 352 Score = 66.6 bits (161), Expect = 8e-10 Identities = 38/68 (55%), Positives = 39/68 (57%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 311 YVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSP-PPPYVYSSPPPP 369 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 370 YYSPSPKP 377 Score = 65.5 bits (158), Expect = 2e-09 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P P Y+S PPYVY P PPPY SP YK P PP Sbjct: 254 YKSP-PPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSP-PPPYYSPSPKPAYKSPPPP 310 Score = 65.5 bits (158), Expect = 2e-09 Identities = 37/75 (49%), Positives = 40/75 (53%), Gaps = 18/75 (24%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPP---------------PYV 48 YK P PPPYVY SPP Y P+P P Y+SPP YVY P PP PYV Sbjct: 656 YKSP-PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYV 714 Query: 47 YESPPYVYKPPTPPP 3 Y SPP Y P+P P Sbjct: 715 YSSPPPPYYSPSPKP 729 Score = 65.1 bits (157), Expect = 2e-09 Identities = 36/68 (52%), Positives = 38/68 (55%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP YK P PPPY+Y SPP Sbjct: 161 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSP-PPPYIYSSPPPP 219 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 220 YYSPSPKP 227 Score = 65.1 bits (157), Expect = 2e-09 Identities = 34/59 (57%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPY+Y SPP Y P+P P Y+S PPYVY P PPPY SP YK P PP Sbjct: 204 YKSP-PPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSP-PPPYYSPSPKPAYKSPPPP 260 Score = 65.1 bits (157), Expect = 2e-09 Identities = 36/68 (52%), Positives = 38/68 (55%), Gaps = 9/68 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y +YKSPP YVY P PP Y SP YK P PPPYVY PP Sbjct: 261 YVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSP-PPPYVYSFPPPP 319 Query: 26 YKPPTPPP 3 Y P+P P Sbjct: 320 YYSPSPKP 327 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/66 (56%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 461 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSP-PPPYVYNSPPPP 519 Query: 26 YKPPTP 9 Y P+P Sbjct: 520 YYSPSP 525 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/59 (57%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P P Y+S PPY+Y P PPPY SP YK P PP Sbjct: 379 YKSP-PPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSP-PPPYYSPSPKPSYKSPPPP 435 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 86 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSP-PPPYVYNSPPPP 144 Query: 26 YKPPTP 9 Y P+P Sbjct: 145 YYSPSP 150 Score = 63.2 bits (152), Expect = 9e-09 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY PP Y P+P P Y+S PPYVY P PPPY SP YK P PP Sbjct: 304 YKSP-PPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSP-PPPYYSPSPKPAYKSPPPP 360 Score = 62.8 bits (151), Expect = 1e-08 Identities = 40/88 (45%), Positives = 42/88 (47%), Gaps = 28/88 (31%) Frame = -3 Query: 185 HSYVYKPPTPPPYV-------YKSP--PYVYKPPTPPPYES-----------PPYVYKPP 66 H +V P PPP YKSP PYVY P PPPY S PPYVY P Sbjct: 534 HPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSP 593 Query: 65 TPPPY------VYES--PPYVYKPPTPP 6 PP Y VY+S PPYVY P PP Sbjct: 594 PPPYYSPAPKPVYKSPPPPYVYNSPPPP 621 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/67 (53%), Positives = 39/67 (58%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPYV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+S PPYV Sbjct: 79 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYV 137 Query: 26 YKPPTPP 6 Y P PP Sbjct: 138 YNSPPPP 144 Score = 58.2 bits (139), Expect(2) = 2e-08 Identities = 39/86 (45%), Positives = 41/86 (47%), Gaps = 27/86 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYK----------PPTPP 57 YVY P PP Y YKSPP YVY P PP Y SP +YK PP PP Sbjct: 486 YVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPP 545 Query: 56 PY------VYESP--PYVYKPPTPPP 3 Y Y+SP PYVY P PPP Sbjct: 546 CYSHSPKIEYKSPPTPYVYHSPPPPP 571 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 483 PPPYVYSSP 491 Score = 61.2 bits (147), Expect = 3e-08 Identities = 37/67 (55%), Positives = 38/67 (56%), Gaps = 10/67 (14%) Frame = -3 Query: 179 YVYKPPTPP------PYV-YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPY 30 YVY P PP P V YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 35 YVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYSSPPP 93 Query: 29 VYKPPTP 9 Y P+P Sbjct: 94 PYYSPSP 100 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 35/78 (44%), Positives = 35/78 (44%), Gaps = 20/78 (25%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPP----------YVYKPPTPPPYVYESPP 33 YVY P PP Y SP YK P PP Y SPP YK P PPPYVY SPP Sbjct: 815 YVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSP-PPPYVYSSPP 873 Query: 32 ---------YVYKPPTPP 6 YK P PP Sbjct: 874 PPSYSPSPKAEYKSPPPP 891 Score = 23.9 bits (50), Expect(2) = 6e-08 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 786 PPPYVYSSP 794 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/63 (50%), Positives = 34/63 (53%), Gaps = 11/63 (17%) Frame = -3 Query: 161 TPPPYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTP-PPYVYESPPYVYKPP 15 +PPPYVY SPP VYK P PP Y SPP Y P+P P Y PPYVY P Sbjct: 457 SPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSP 516 Query: 14 TPP 6 PP Sbjct: 517 PPP 519 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 54 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 110 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 111 YVYSSPPPP 119 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 129 YKSP-PPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 185 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 186 YVYNSPPPP 194 Score = 58.2 bits (139), Expect = 3e-07 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 154 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSP-PPPY-YSPSPKPTYKSPPPP 210 Query: 32 YVYKPPTPP 6 Y+Y P PP Sbjct: 211 YIYSSPPPP 219 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/72 (48%), Positives = 38/72 (52%), Gaps = 11/72 (15%) Frame = -3 Query: 191 NHHSYVYKPPTPPPY-------VYKS--PPYVYKPPTPP-PYESPPYV-YKPPTPPPYVY 45 ++ Y Y P PP Y YKS PPYVY P PP Y P V YK P PPPYVY Sbjct: 5 SYEPYTYSSPPPPLYDSPTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSP-PPPYVY 63 Query: 44 ESPPYVYKPPTP 9 SPP Y P+P Sbjct: 64 SSPPPPYYSPSP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/86 (38%), Positives = 38/86 (44%), Gaps = 28/86 (32%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPPYVYKPPTPPP-----------YESPPYVYKPPTPPPY 51 YVY P PP Y +YKSPP+ + PPP Y+SPP Y +PPP Sbjct: 511 YVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPPPP 570 Query: 50 VYES-----------PPYVYKPPTPP 6 Y S PPYVY P PP Sbjct: 571 PYYSPSPKPAYKSSPPPYVYSSPPPP 596 [39][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 69.7 bits (169), Expect(2) = 7e-12 Identities = 36/63 (57%), Positives = 36/63 (57%), Gaps = 5/63 (7%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--VYKPPTPPPY--ESPPYVYKPPTPP-PYVYESPPYVYKPPT 12 VY PP PPP VY PP VY PP PPP PP VY PP PP P PP VY PP Sbjct: 278 VYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPP 337 Query: 11 PPP 3 PPP Sbjct: 338 PPP 340 Score = 23.9 bits (50), Expect(2) = 7e-12 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PPP VY P Sbjct: 271 PPSPPPPVYSPP 282 Score = 67.8 bits (164), Expect = 4e-10 Identities = 34/60 (56%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYE--SPPYVYKPPTPPP 3 VY PP PPP VY PP PPP PP VY PP PPP VY PP VY PP PPP Sbjct: 255 VYSPPPPPP--------VYSPPPPPP-SPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPP 305 Score = 64.7 bits (156), Expect(2) = 4e-10 Identities = 33/61 (54%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYK---PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VY PP PPP PP VY PP+PPP PP VY PP PPP SPP PP+PP Sbjct: 297 VYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPP----SPP----PPSPP 348 Query: 5 P 3 P Sbjct: 349 P 349 Score = 23.1 bits (48), Expect(2) = 4e-10 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP VY P Sbjct: 281 PPPPPPPVYSPP 292 Score = 67.0 bits (162), Expect = 6e-10 Identities = 33/61 (54%), Positives = 33/61 (54%), Gaps = 4/61 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP----YESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 VY PP PPP PP VY PP PPP PP VY PP PPP PP VY PP P Sbjct: 264 VYSPPPPPP---SPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPP 320 Query: 8 P 6 P Sbjct: 321 P 321 Score = 66.6 bits (161), Expect = 8e-10 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Frame = -3 Query: 167 PPTPPPYVYKSPPY---VYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP VY PP VY PP PPP Y PP PP PPP VY PP PP+PPP Sbjct: 271 PPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPP----PPSPPP 325 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/57 (57%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPY---VYKPPTPPP 3 P P P VY PP VY PP PPP SPP PP+PPP VY PP VY PP PPP Sbjct: 243 PVPSPPVYLPPP-VYSPPPPPPVYSPPP--PPPSPPPPVYSPPPPPPPVYSPPPPPP 296 Score = 59.7 bits (143), Expect(2) = 1e-08 Identities = 28/58 (48%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP VY PP PP P PP PP V PP PPP PP ++ PP P P Sbjct: 325 PPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTP 382 Score = 23.1 bits (48), Expect(2) = 1e-08 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP VY P Sbjct: 307 PPPPPPPVYSPP 318 Score = 58.2 bits (139), Expect(2) = 2e-08 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPY--VYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP V PP PPP PP ++ PP P PY Y SPP P +PPP Sbjct: 344 PPSPPP-PSPLPPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPP 399 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PPP VY P Sbjct: 325 PPSPPPPVYSPP 336 Score = 55.8 bits (133), Expect(2) = 9e-08 Identities = 28/62 (45%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP----YVYKPPT 12 Y Y P PP + PP + PP P P SPP P PP Y Y SPP VY PP Sbjct: 383 YYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPPP 442 Query: 11 PP 6 PP Sbjct: 443 PP 444 Score = 23.9 bits (50), Expect(2) = 9e-08 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P PY Y SP Sbjct: 377 PPPPTPYYYSSP 388 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/79 (39%), Positives = 35/79 (44%), Gaps = 22/79 (27%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKP------------------PTPPPYESPPYVY---KPPTP 60 ++ PP P PY Y SPP P P PPP+ PP +Y PP P Sbjct: 374 LFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPP 433 Query: 59 PPYVYE-SPPYVYKPPTPP 6 P VY PP VY PP PP Sbjct: 434 PHPVYSPPPPPVYSPPPPP 452 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = -3 Query: 176 VYKPPTPP-PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 VY PP PP P PP VY PP PPP SPP PP+PPP PP V PP PPP Sbjct: 314 VYSPPPPPSPPPPSPPPPVYSPPPPPP--SPP----PPSPPP-PSPLPPCVRPPPPPPP 365 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/61 (45%), Positives = 31/61 (50%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 + Y+ PP P P PP VY PP PP SPP +PP PPP SPP P PP Sbjct: 425 YPYLSPPPPPHPVYSPPPPPVYSPPPPP---SPPPCIEPPPPPPCAEYSPPPP-SPSPPP 480 Query: 5 P 3 P Sbjct: 481 P 481 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/64 (42%), Positives = 30/64 (46%), Gaps = 9/64 (14%) Frame = -3 Query: 167 PPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYK------PPTPPPYVYESPPYVYKPP 15 PP+PPP + PP Y PP P P PP YK PP PP + Y PP PP Sbjct: 451 PPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPP 510 Query: 14 TPPP 3 P P Sbjct: 511 PPAP 514 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/73 (41%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESP-PY 30 P C + P PPP YK PP PP P Y SPP + P PP VYE P P Sbjct: 463 PPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPPPPAPVYEGPLPP 522 Query: 29 V----YKPPTPPP 3 + Y P PPP Sbjct: 523 ITGVSYASPPPPP 535 [40][TOP] >UniRef100_Q9LHS1 Genomic DNA, chromosome 5, TAC clone:K3D20 n=2 Tax=Arabidopsis thaliana RepID=Q9LHS1_ARATH Length = 334 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 39/78 (50%), Positives = 40/78 (51%), Gaps = 19/78 (24%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P+PP Y YKSPP YVY P PPPY S PPYVY P PP Sbjct: 208 YVYNSPSPPYYSPSPKVDYKSPPPPYVYNSP-PPPYFSPSPKVDYKSPPPPYVYSSPPPP 266 Query: 56 PYVYESPPYVYKPPTPPP 3 PY SP YK P PPP Sbjct: 267 PYYSPSPEVSYKSPPPPP 284 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPPYVY SP Sbjct: 204 SPPPYVYNSP 213 Score = 65.9 bits (159), Expect(2) = 1e-10 Identities = 42/79 (53%), Positives = 44/79 (55%), Gaps = 20/79 (25%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESP-PYV-YKPPTPPPYV----- 48 YVY P PPPY YKSPP YVY P PPPY SP P V YK P PPPY Sbjct: 233 YVYNSP-PPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSPSLE 291 Query: 47 --YESPP--YVYKPPTPPP 3 Y+SPP +VY P PPP Sbjct: 292 VSYKSPPPLFVYNFPPPPP 310 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 230 PPPYVYNSP 238 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 37/86 (43%), Positives = 39/86 (45%), Gaps = 27/86 (31%) Frame = -3 Query: 179 YVYKPPTPP--------PYVYKSPPYVYKPPTPPPYESPPYV-YKPPTPPPYVYES---- 39 YVY P PP Y + PPYVY P+PP Y P V YK P PPPYVY S Sbjct: 183 YVYNSPPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSP-PPPYVYNSPPPP 241 Query: 38 --------------PPYVYKPPTPPP 3 PPYVY P PPP Sbjct: 242 YFSPSPKVDYKSPPPPYVYSSPPPPP 267 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 155 PPPYVYNSP 163 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 133 YVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSP-PPPYVYNSPPPP 191 Query: 26 YKPPTP 9 Y P+P Sbjct: 192 YYSPSP 197 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 31/69 (44%), Positives = 33/69 (47%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPP-----------YVYKPPTPPPYVYESPP 33 YVY P PPPY SP YK P PPPY SP +VY P PPP+ SP Sbjct: 258 YVYSSPPPPPYYSPSPEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPPPFYSPSPK 317 Query: 32 YVYKPPTPP 6 YK P P Sbjct: 318 VSYKSPPAP 326 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 130 PPPYVYNSP 138 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 255 PPPYVYSSP 263 Score = 61.6 bits (148), Expect = 3e-08 Identities = 36/67 (53%), Positives = 39/67 (58%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YES--PPYV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+S PPYV Sbjct: 101 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYV 159 Query: 26 YKPPTPP 6 Y P PP Sbjct: 160 YNSPPPP 166 Score = 61.2 bits (147), Expect = 3e-08 Identities = 40/85 (47%), Positives = 42/85 (49%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKSPP YVY P PPPY S PPYVY P+PP Sbjct: 158 YVYNSPPPPYYSLSPKVDYKSPPPPYVYNSP-PPPYYSPSPKVDYKFSPPPYVYNSPSPP 216 Query: 56 PYV------YES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 217 YYSPSPKVDYKSPPPPYVYNSPPPP 241 Score = 60.8 bits (146), Expect = 4e-08 Identities = 39/85 (45%), Positives = 39/85 (45%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYES---- 39 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY S Sbjct: 108 YVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSP-PPPYVYNSPPPP 166 Query: 38 --------------PPYVYKPPTPP 6 PPYVY P PP Sbjct: 167 YYSLSPKVDYKSPPPPYVYNSPPPP 191 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/66 (51%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 Y++ P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 83 YLFNSPPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 141 Query: 26 YKPPTP 9 Y P+P Sbjct: 142 YYSPSP 147 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 126 YKSP-PPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYV 184 Query: 20 PPTPPP 3 +PPP Sbjct: 185 YNSPPP 190 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/64 (48%), Positives = 36/64 (56%), Gaps = 11/64 (17%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYV------YESPP--YVYKP 18 P P PY++ SPP Y P+P Y+SPP YVY P PP Y Y+SPP YVY Sbjct: 78 PHPKPYLFNSPPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNS 137 Query: 17 PTPP 6 P PP Sbjct: 138 PPPP 141 [41][TOP] >UniRef100_B9GU80 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GU80_POPTR Length = 153 Score = 68.6 bits (166), Expect(2) = 1e-11 Identities = 38/74 (51%), Positives = 38/74 (51%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 45 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSS 103 Query: 47 YESPPYVYKPPTPP 6 PPYVYK P PP Sbjct: 104 SPPPPYVYKSPPPP 117 Score = 24.3 bits (51), Expect(2) = 1e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 7 PSPPPPYYYKSP 18 Score = 66.2 bits (160), Expect(2) = 6e-11 Identities = 40/81 (49%), Positives = 40/81 (49%), Gaps = 23/81 (28%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYES--PPYVYK------P 69 Y YK P PP PY YKSPP Y YK P PPP S PPYVYK P Sbjct: 61 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSSSPPPPYVYKSPPPPSP 119 Query: 68 PTPPPYVYESPPYVYKPPTPP 6 PPPY Y SPP K P PP Sbjct: 120 SPPPPYYYHSPPPPVKSPPPP 140 Score = 24.3 bits (51), Expect(2) = 6e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 39 PSPPPPYYYKSP 50 Score = 62.4 bits (150), Expect(2) = 8e-10 Identities = 34/74 (45%), Positives = 35/74 (47%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPYVYK PP P P PPY Y P PP Sbjct: 77 YYYKSPPPPSPSPPPPYYYKSPPPPSSSPPPPYVYKSPPPPSPSPPPPYYYHSPPPPVKS 136 Query: 47 YESPPYVYKPPTPP 6 P Y+Y P PP Sbjct: 137 PPPPVYIYASPPPP 150 Score = 24.3 bits (51), Expect(2) = 8e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 55 PSPPPPYYYKSP 66 Score = 65.9 bits (159), Expect = 1e-09 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 13 YYYKSPPPPSPSPPPPYHYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 71 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 72 SPPPPYYYKSPPPP 85 Score = 65.5 bits (158), Expect = 2e-09 Identities = 34/64 (53%), Positives = 34/64 (53%), Gaps = 10/64 (15%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 P PPPY YKS PPY YK PP P P PPY YK P PPP PPY YK Sbjct: 7 PSPPPPYYYKSPPPPSPSPPPPYHYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYKS 65 Query: 17 PTPP 6 P PP Sbjct: 66 PPPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = -3 Query: 158 PPPYVYKSPPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PPP PPY YK PP P P PPY YK P PPP PPY YK P PP Sbjct: 3 PPPSPSPPPPYYYKSPPPPSPSPPPPYHYKSP-PPPSPSPPPPYYYKSPPPP 53 Score = 51.2 bits (121), Expect(2) = 1e-06 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 YVYK P PPP PPY Y P PPP +SPP PP Y+Y SPP PPT Sbjct: 109 YVYKSP-PPPSPSPPPPYYYHSP-PPPVKSPP-------PPVYIYASPP----PPT 151 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 10/15 (66%), Positives = 12/15 (80%), Gaps = 3/15 (20%) Frame = -2 Query: 219 PPT---PPPYVYESP 184 PP+ PPPYVY+SP Sbjct: 100 PPSSSPPPPYVYKSP 114 Score = 48.9 bits (115), Expect(2) = 7e-06 Identities = 28/61 (45%), Positives = 31/61 (50%), Gaps = 18/61 (29%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYESPP---YVYKPPTPPP 54 Y YK P PP PYVYKSPP Y Y P PPP +SPP Y+Y P PP Sbjct: 93 YYYKSPPPPSSSPPPPYVYKSPPPPSPSPPPPYYYHSP-PPPVKSPPPPVYIYASPPPPT 151 Query: 53 Y 51 + Sbjct: 152 H 152 Score = 24.3 bits (51), Expect(2) = 7e-06 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 71 PSPPPPYYYKSP 82 [42][TOP] >UniRef100_Q01945 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q01945_SOLLC Length = 90 Score = 72.0 bits (175), Expect = 2e-11 Identities = 40/79 (50%), Positives = 41/79 (51%), Gaps = 25/79 (31%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPP------TPPPYVYES- 39 P PPPYVYKS PPYVYK PP P P PPYVYK P PPPY Y+S Sbjct: 4 PSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSPSPPPPYVYKSPPPPSHSPPPPYYYKSP 63 Query: 38 --------PPYVYKPPTPP 6 PPY YK P PP Sbjct: 64 PPPSPSPPPPYYYKSPPPP 82 Score = 64.3 bits (155), Expect(2) = 6e-11 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 6/65 (9%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 YVYK P PP PYVYKSPP P PP Y P P PPPY Y+SPP P Sbjct: 26 YVYKSPPPPSPSPPPPYVYKSPPPPSHSPPPPYYYKSPPPPSPSPPPPYYYKSPP----P 81 Query: 17 PTPPP 3 P+P P Sbjct: 82 PSPSP 86 Score = 26.2 bits (56), Expect(2) = 6e-11 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 4 PSPPPPYVYKSP 15 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/55 (60%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PP+P P PPYVYK PP P P PPYVYK P PPP PPYVYK P PP Sbjct: 1 PPSPSP----PPPYVYKSPPPPSPSPPPPYVYKSP-PPPSPSPPPPYVYKSPPPP 50 Score = 53.5 bits (127), Expect(2) = 9e-08 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 6/56 (10%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPY 30 YVYK P PP PY YKSPP PP+P P PPY YK P PPP PPY Sbjct: 42 YVYKSPPPPSHSPPPPYYYKSPP----PPSPSP--PPPYYYKSP-PPPSPSPPPPY 90 Score = 26.2 bits (56), Expect(2) = 9e-08 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPYVY+SP Sbjct: 20 PSPPPPYVYKSP 31 [43][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 68.2 bits (165), Expect(2) = 2e-11 Identities = 33/58 (56%), Positives = 33/58 (56%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 VY PP PPP PP VY PP PPP PP VY PP PPP PP VY PP P P Sbjct: 435 VYSPPPPPP----PPPPVYSPPPPPPPPPPPPVYSPPPPPP-PPPPPPPVYSPPPPSP 487 Score = 23.9 bits (50), Expect(2) = 2e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PPP VY P Sbjct: 428 PPSPPPPVYSPP 439 Score = 65.1 bits (157), Expect(2) = 3e-10 Identities = 35/73 (47%), Positives = 36/73 (49%), Gaps = 18/73 (24%) Frame = -3 Query: 167 PPTPPPYVYKSPPY--------VYKPPTPPPYESPPYVYKPPTPPPYVYESPP------- 33 PP PPP VY PP VY PP PPP PP VY PP PP VY SPP Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP--VYSSPPPPPSPAP 529 Query: 32 ---YVYKPPTPPP 3 Y +PP PPP Sbjct: 530 TPVYCTRPPPPPP 542 Score = 65.1 bits (157), Expect(2) = 3e-10 Identities = 28/61 (45%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP---TPP 6 VY P PPP +P Y +PP PPP+ PP + PP P PY Y SPP + P +PP Sbjct: 517 VYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPP 576 Query: 5 P 3 P Sbjct: 577 P 577 Score = 23.1 bits (48), Expect(2) = 3e-10 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP VY P Sbjct: 441 PPPPPPPVYSPP 452 Score = 23.1 bits (48), Expect(2) = 3e-10 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP VY P Sbjct: 472 PPPPPPPVYSPP 483 Score = 64.7 bits (156), Expect(2) = 4e-10 Identities = 32/57 (56%), Positives = 32/57 (56%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VY PP PPP PP VY PP P P PP VY PP PPP PP VY PP PP Sbjct: 463 VYSPPPPPPPPPPPPP-VYSPPPPSPPPPPPPVYSPPPPPP--PPPPPPVYSPPPPP 516 Score = 23.1 bits (48), Expect(2) = 4e-10 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP VY P Sbjct: 456 PPPPPPPVYSPP 467 Score = 62.4 bits (150), Expect(2) = 2e-09 Identities = 32/65 (49%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPP---TPPPYESPP---YVYKPPTPPPYVYESPPY--VYKP 18 + PP P PY Y SPP + P +PPP SPP Y Y P PPP SPP VY P Sbjct: 550 FSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSP 609 Query: 17 PTPPP 3 P PPP Sbjct: 610 PPPPP 614 Score = 23.1 bits (48), Expect(2) = 2e-09 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP VY P Sbjct: 502 PPPPPPPVYSPP 513 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 37/84 (44%), Positives = 38/84 (45%), Gaps = 16/84 (19%) Frame = -3 Query: 206 PHMCMNHHS-----YVYKPPTPPPYVYKSPPY--VYKPPTPPPYESPP-----YVYKPPT 63 PH HS Y Y P PPP SPP VY PP PPP PP Y PP Sbjct: 572 PHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPP 631 Query: 62 PPPYVYES----PPYVYKPPTPPP 3 PPP V+ S PP Y P PPP Sbjct: 632 PPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P PY Y SP Sbjct: 552 PPPPEPYYYSSP 563 Score = 65.1 bits (157), Expect = 2e-09 Identities = 34/63 (53%), Positives = 34/63 (53%), Gaps = 8/63 (12%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYE--------SPPYVYKPPT 12 PP PPP VY SPP PP PPP SPP PP PPP VY PP VY PP Sbjct: 441 PPPPPPPVY-SPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499 Query: 11 PPP 3 PPP Sbjct: 500 PPP 502 Score = 60.1 bits (144), Expect(2) = 8e-09 Identities = 31/68 (45%), Positives = 34/68 (50%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPP----------YVYKPPTPPPYVYESPPYV 27 VY PP PPP PP VY PP PP Y SPP Y +PP PPP + PP Sbjct: 494 VYSPPPPPPP--PPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP--HSPPPPQ 549 Query: 26 YKPPTPPP 3 + PP P P Sbjct: 550 FSPPPPEP 557 Score = 23.1 bits (48), Expect(2) = 8e-09 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP VY P Sbjct: 487 PPPPPPPVYSPP 498 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP VY PP PP PPP SPP PP PPP PP VY PP PPP Sbjct: 428 PPSPPPPVYSPPP---PPPPPPPVYSPP----PPPPPP----PPPPVYSPPPPPP 471 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/73 (45%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPY--VYKPPTPPPYVYESPP 33 PH HS P +PPP +Y PY+ PP P P SPP VY PP PPP + PP Sbjct: 566 PHSSPPPHSPP-PPHSPPPPIY---PYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Query: 32 ---YVYKPPTPPP 3 Y PP PPP Sbjct: 622 PPCIEYSPPPPPP 634 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/65 (46%), Positives = 31/65 (47%), Gaps = 7/65 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPYVYKPPTPPPYVYESPP----YVYKP 18 VY PP PPP + PP Y PP PPP Y P PPP Y SPP Y P Sbjct: 606 VYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVH----YSSPPPPPVYYSSPPPPPVYYSSP 661 Query: 17 PTPPP 3 P PPP Sbjct: 662 PPPPP 666 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/56 (48%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYK--PPTPPP 3 P PP ++ +PP + PP P P PP VY PP PPP PP VY PP PPP Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSP---PPPVYSPPPPPP----PPPPVYSPPPPPPPP 458 Score = 52.4 bits (124), Expect(2) = 5e-06 Identities = 29/62 (46%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPY--VYKPPTPPPYESPPYVYKPPTPPPYVYESP---PYVYKPPTP 9 Y P PPP Y SPP VY PPP PP Y P PP Y SP P Y P P Sbjct: 638 YSSPPPPPVYYSSPPPPPVYYSSPPPP---PPVHYSSPPPPEVHYHSPPPSPVHYSSPPP 694 Query: 8 PP 3 PP Sbjct: 695 PP 696 Score = 21.2 bits (43), Expect(2) = 5e-06 Identities = 9/13 (69%), Positives = 9/13 (69%), Gaps = 1/13 (7%) Frame = -2 Query: 219 PPTPPPYV-YESP 184 PP PPP V Y SP Sbjct: 629 PPPPPPVVHYSSP 641 [44][TOP] >UniRef100_Q9SK35 Putative uncharacterized protein At2g24980 n=1 Tax=Arabidopsis thaliana RepID=Q9SK35_ARATH Length = 559 Score = 68.2 bits (165), Expect(2) = 2e-11 Identities = 35/66 (53%), Positives = 36/66 (54%), Gaps = 8/66 (12%) Frame = -3 Query: 182 SYVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYV 27 SYVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Sbjct: 476 SYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 535 Query: 26 YKPPTP 9 Y P+P Sbjct: 536 YYSPSP 541 Score = 23.9 bits (50), Expect(2) = 2e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 449 PPPYVYSSP 457 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 177 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 236 Query: 23 KPPTP 9 P+P Sbjct: 237 YSPSP 241 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 202 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 261 Query: 23 KPPTP 9 P+P Sbjct: 262 YSPSP 266 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 227 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 286 Query: 23 KPPTP 9 P+P Sbjct: 287 YSPSP 291 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 252 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 311 Query: 23 KPPTP 9 P+P Sbjct: 312 YSPSP 316 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 277 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 336 Query: 23 KPPTP 9 P+P Sbjct: 337 YSPSP 341 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 302 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 361 Query: 23 KPPTP 9 P+P Sbjct: 362 YSPSP 366 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 327 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 386 Query: 23 KPPTP 9 P+P Sbjct: 387 YSPSP 391 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 352 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPY 411 Query: 23 KPPTP 9 P+P Sbjct: 412 YSPSP 416 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 377 YVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 436 Query: 23 KPPTP 9 P+P Sbjct: 437 YSPSP 441 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 402 YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 461 Query: 23 KPPTP 9 P+P Sbjct: 462 YSPSP 466 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 149 PPPYVYNSP 157 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 174 PPPYVYSSP 182 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 199 PPPYVYSSP 207 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 224 PPPYVYSSP 232 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 249 PPPYVYSSP 257 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 274 PPPYVYSSP 282 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 299 PPPYVYSSP 307 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 324 PPPYVYSSP 332 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 349 PPPYVYSSP 357 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 374 PPPYVYSSP 382 Score = 66.2 bits (160), Expect(2) = 8e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 152 YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 211 Query: 23 KPPTP 9 P+P Sbjct: 212 YSPSP 216 Score = 23.9 bits (50), Expect(2) = 8e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 124 PPPYVYSSP 132 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PP YVY SPP Y Sbjct: 427 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPY 486 Query: 23 KPPTP 9 P+P Sbjct: 487 YSPSP 491 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PP YVY SPP Y Sbjct: 452 YVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPY 511 Query: 23 KPPTP 9 P+P Sbjct: 512 YSPSP 516 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 399 PPPYVYNSP 407 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 424 PPPYVYSSP 432 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 77 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 135 Query: 26 YKPPTP 9 Y P+P Sbjct: 136 YYSPSP 141 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 102 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 160 Query: 26 YKPPTP 9 Y P+P Sbjct: 161 YYSPSP 166 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 74 PPPYVYSSP 82 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 99 PPPYVYSSP 107 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 127 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 185 Query: 26 YKPPTP 9 Y P+P Sbjct: 186 YYSPSP 191 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYES---PPYVYKPPTPPPY------VYES--PPYV 27 YK P PPPYVY SPP Y P+P Y PPYVY P PP Y Y+S PPYV Sbjct: 370 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYV 428 Query: 26 YKPPTPP 6 Y P PP Sbjct: 429 YSSPPPP 435 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPY------VYESPP--YV 27 YK P PPPYVY SPP Y P+P Y PPYVY P PP Y Y+SPP YV Sbjct: 420 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYV 478 Query: 26 YKPPTPP 6 Y P PP Sbjct: 479 YSSPPPP 485 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 145 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVYYKSPPPP 201 Score = 61.2 bits (147), Expect(2) = 2e-08 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PP YVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 495 YKSP-PPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVTYKSPPPP 551 Score = 20.8 bits (42), Expect(2) = 2e-08 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PP YVY SP Sbjct: 474 PPSYVYSSP 482 Score = 61.6 bits (148), Expect = 3e-08 Identities = 36/67 (53%), Positives = 39/67 (58%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPY------VYESPP--YV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP YV Sbjct: 445 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYV 503 Query: 26 YKPPTPP 6 Y P PP Sbjct: 504 YSSPPPP 510 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 33/60 (55%), Positives = 35/60 (58%), Gaps = 9/60 (15%) Frame = -3 Query: 182 SYVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPY 30 SYVY P PP Y YKSPP YVY P PP Y SP YK P PPPYVY++P Y Sbjct: 501 SYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVTYKSP-PPPYVYKTPYY 559 Score = 20.8 bits (42), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PP YVY SP Sbjct: 499 PPSYVYSSP 507 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 70 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 128 Query: 20 PPTPPP 3 +PPP Sbjct: 129 YSSPPP 134 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 120 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV 178 Query: 20 PPTPPP 3 +PPP Sbjct: 179 YSSPPP 184 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 95 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 151 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 152 YVYNSPPPP 160 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/55 (60%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Frame = -3 Query: 161 TPPPYV-YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYVYKPPTP 9 TP P V YKSPP YVY P PP Y P V YK P PPPYVY SPP Y P+P Sbjct: 63 TPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPPYYSPSP 116 Score = 53.1 bits (126), Expect = 9e-06 Identities = 34/76 (44%), Positives = 39/76 (51%), Gaps = 13/76 (17%) Frame = -3 Query: 191 NHHSYVYKPPT----PPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYV----- 48 N SY +K P P PYV SPP Y P+P Y+SPP YVY P PP Y Sbjct: 34 NSPSYEHKGPKYAPHPKPYVKSSPPPQYYTPSPKVNYKSPPPPYVYSSPPPPYYSPSPKV 93 Query: 47 -YESPPYVYKPPTPPP 3 Y+SPP Y +PPP Sbjct: 94 DYKSPPPPYVYSSPPP 109 [45][TOP] >UniRef100_Q9M6R7 Extensin n=1 Tax=Pisum sativum RepID=Q9M6R7_PEA Length = 327 Score = 70.9 bits (172), Expect(2) = 2e-11 Identities = 35/58 (60%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYK---PPTP 9 YK P+PPP VYKSPP YK +PPP PPY Y P PP Y Y SPP YK PPTP Sbjct: 199 YKYPSPPPPVYKSPPPPYKYQSPPP---PPYKYSSPPPPVYKYNSPPPPYKHISPPTP 253 Score = 21.2 bits (43), Expect(2) = 2e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 182 PPPPVYKYQSP 192 Score = 70.9 bits (172), Expect(2) = 3e-11 Identities = 38/69 (55%), Positives = 42/69 (60%), Gaps = 10/69 (14%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPPPYVYES--PPY 30 Y Y P PP Y YKSPP Y YK P PP Y+SPP YK P+PPP VY+S PPY Sbjct: 157 YKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPY 216 Query: 29 VYKPPTPPP 3 Y+ P PPP Sbjct: 217 KYQSPPPPP 225 Score = 20.8 bits (42), Expect(2) = 3e-11 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PY Y SP Sbjct: 151 PPVKKPYKYSSP 162 Score = 70.5 bits (171), Expect(2) = 3e-11 Identities = 38/77 (49%), Positives = 41/77 (53%), Gaps = 18/77 (23%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---------------YVYKPPTPPPYES--PPYVYKPPTPPPY 51 Y YK P PP Y YKSPP Y Y P PP Y+S PPY Y+ P PPPY Sbjct: 167 YKYKSPPPPVYKYKSPPPPVYKYQSPPPPKKSYKYPSPPPPVYKSPPPPYKYQSPPPPPY 226 Query: 50 VYES-PPYVYKPPTPPP 3 Y S PP VYK +PPP Sbjct: 227 KYSSPPPPVYKYNSPPP 243 Score = 20.8 bits (42), Expect(2) = 3e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 129 PPPPVYKYKSP 139 Score = 70.1 bits (170), Expect(2) = 6e-11 Identities = 35/63 (55%), Positives = 37/63 (58%), Gaps = 4/63 (6%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKPP 15 SY Y P PP Y YKSPP VYK +PPP PY Y P PP Y Y+SPP Y YK P Sbjct: 123 SYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKSP 182 Query: 14 TPP 6 PP Sbjct: 183 PPP 185 Score = 20.4 bits (41), Expect(2) = 6e-11 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 90 PPPPIYKYKSP 100 Score = 65.5 bits (158), Expect(2) = 8e-11 Identities = 38/82 (46%), Positives = 39/82 (47%), Gaps = 23/82 (28%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPP---------YVYKPPTPPP-----YESPP---YVYKPPTPPP 54 SY Y P PP Y YKSPP Y Y P PPP Y SPP Y YK P PP Sbjct: 84 SYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPPPPV 143 Query: 53 YVYESP------PYVYKPPTPP 6 Y Y+SP PY Y P PP Sbjct: 144 YKYKSPPPPVKKPYKYSSPPPP 165 Score = 24.6 bits (52), Expect(2) = 8e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P PY Y+SP Sbjct: 34 PPPPKPYYYQSP 45 Score = 65.1 bits (157), Expect(2) = 2e-10 Identities = 34/59 (57%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYES-PPYVYKPPTPPPYVYES-PPYVYKPPTP 9 + + PP P Y YKSPP VY PP Y+S PP VY PP PP YVY S PP VY PP P Sbjct: 257 FKFPPPPTPIYKYKSPPPVYSPPPVYKYKSPPPPVYSPP-PPHYVYSSPPPPVYSPPPP 314 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPY Y SP Sbjct: 221 PPPPPYKYSSP 231 Score = 63.5 bits (153), Expect(2) = 6e-10 Identities = 37/82 (45%), Positives = 38/82 (46%), Gaps = 24/82 (29%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK---------------PPTP-------PPYESPPYVYKPP 66 Y Y P PP Y Y SPP YK PPTP PP SPP VYK Sbjct: 226 YKYSSPPPPVYKYNSPPPPYKHISPPTPGKPFKFPPPPTPIYKYKSPPPVYSPPPVYKYK 285 Query: 65 TPPPYVYESPP--YVYKPPTPP 6 +PPP VY PP YVY P PP Sbjct: 286 SPPPPVYSPPPPHYVYSSPPPP 307 Score = 23.5 bits (49), Expect(2) = 6e-10 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P+PPP VY+SP Sbjct: 202 PSPPPPVYKSP 212 Score = 63.5 bits (153), Expect = 7e-09 Identities = 36/78 (46%), Positives = 40/78 (51%), Gaps = 16/78 (20%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYKSPPY-VYKPPTPPPYES---------PPYVYKPPTPPP---Y 51 N++ Y PP P PY Y+SPP V+ PP P Y S PPY Y P PPP Y Sbjct: 26 NNYLYSSPPPPPKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSY 85 Query: 50 VYESPP---YVYKPPTPP 6 Y SPP Y YK P PP Sbjct: 86 KYSSPPPPIYKYKSPPPP 103 Score = 62.0 bits (149), Expect(2) = 1e-08 Identities = 40/83 (48%), Positives = 43/83 (51%), Gaps = 25/83 (30%) Frame = -3 Query: 176 VYKPPTPPPYVYKS---PPYVYKPPTPP--PYESPPYVYK---PPTP-----------PP 54 VYK P PPPY Y+S PPY Y P PP Y SPP YK PPTP P Sbjct: 208 VYKSP-PPPYKYQSPPPPPYKYSSPPPPVYKYNSPPPPYKHISPPTPGKPFKFPPPPTPI 266 Query: 53 YVYESPPYVYKPP------TPPP 3 Y Y+SPP VY PP +PPP Sbjct: 267 YKYKSPPPVYSPPPVYKYKSPPP 289 Score = 20.8 bits (42), Expect(2) = 1e-08 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 162 PPPPVYKYKSP 172 Score = 62.0 bits (149), Expect(2) = 1e-08 Identities = 31/60 (51%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP-YVYKPPTPPPYESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 +YK +PPP VY PP Y YK P PP Y PP YVY P PP Y P Y+Y P PP Sbjct: 266 IYKYKSPPP-VYSPPPVYKYKSPPPPVYSPPPPHYVYSSPPPPVYSPPPPHYIYASPPPP 324 Score = 20.4 bits (41), Expect(2) = 1e-08 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y SP Sbjct: 231 PPPPVYKYNSP 241 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/72 (52%), Positives = 38/72 (52%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTPPP---YVYKSPP---YVYKPPTPPPYES--PPYVYKPPTPPP---YVYESPP 33 Y Y P PPP Y Y SPP Y YK P PPP S PPY Y P PPP Y Y SPP Sbjct: 72 YHYSSPPPPPKKSYKYSSPPPPIYKYKSP-PPPVHSPPPPYHYSSPPPPPKKSYKYSSPP 130 Query: 32 ---YVYKPPTPP 6 Y YK P PP Sbjct: 131 PPVYKYKSPPPP 142 Score = 59.7 bits (143), Expect = 1e-07 Identities = 37/82 (45%), Positives = 39/82 (47%), Gaps = 25/82 (30%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP------YVYKPPTPP--PYESPP---YVYKPPTPPPYVYESPP 33 Y YK P PP Y YKSPP Y Y P PP Y+SPP Y YK P PP Y Y+SPP Sbjct: 134 YKYKSPPPPVYKYKSPPPPVKKPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYQSPP 193 Query: 32 -----YVY---------KPPTP 9 Y Y PP P Sbjct: 194 PPKKSYKYPSPPPPVYKSPPPP 215 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/80 (43%), Positives = 37/80 (46%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPY-VYKPPTPPPYESPP------YVYKPPTPPPYVYES- 39 Y PP P PPY Y SPP V+ PP P Y SPP Y Y P PP Y Y+S Sbjct: 41 YYQSPPPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSP 100 Query: 38 --------PPYVYKPPTPPP 3 PPY Y P PPP Sbjct: 101 PPPVHSPPPPYHYSSPPPPP 120 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/62 (46%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP-YVYKPPTP 9 ++Y+Y P PPP PY Y+ P PPP SPP Y +PPP V+ PP Y Y P P Sbjct: 26 NNYLYSSPPPPP-----KPYYYQSP-PPPVHSPPPPYHYSSPPPPVHSPPPPYHYSSPPP 79 Query: 8 PP 3 PP Sbjct: 80 PP 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 4/48 (8%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP--YVYKPPTPPPYESPP--YVYKPPTPPPYVY 45 VYK +PPP VY PP YVY P PP Y PP Y+Y P PPPY Y Sbjct: 281 VYKYKSPPPPVYSPPPPHYVYSSPPPPVYSPPPPHYIYASP-PPPYHY 327 [46][TOP] >UniRef100_B9RL73 LRX2, putative n=1 Tax=Ricinus communis RepID=B9RL73_RICCO Length = 766 Score = 71.6 bits (174), Expect = 2e-11 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPP---TPPPYVYKSPPYVYK--PPTPPP--YESPPYVYKPPTPPPYV-YESPPYVY 24 Y PP +PPP Y PPY ++ PP PPP Y+SPPY +KPP PPP + Y+SPPY + Sbjct: 534 YTPSPPKHSSPPPVEYYPPPYQHQTSPPPPPPVQYQSPPYHHKPPPPPPPIEYQSPPYQH 593 Query: 23 KPPTPPP 3 K PPP Sbjct: 594 KTSPPPP 600 Score = 62.8 bits (151), Expect(2) = 1e-09 Identities = 36/92 (39%), Positives = 43/92 (46%), Gaps = 29/92 (31%) Frame = -3 Query: 191 NHHSYVYKPPT------------PPPYV-------YKSPPYVYKPPTPPPYESPPYV--- 78 ++HSY PPT PPP V + PP V P+PP + SPP V Sbjct: 491 HYHSYAPPPPTKKVSPSTHHAPPPPPPVDYTPTPKHSPPPPVEYTPSPPKHSSPPPVEYY 550 Query: 77 -------YKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP Y+SPPY +KPP PPP Sbjct: 551 PPPYQHQTSPPPPPPVQYQSPPYHHKPPPPPP 582 Score = 23.1 bits (48), Expect(2) = 1e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP V +SP Sbjct: 475 PPPPPPVVEQSP 486 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPP-P--YESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP Y+SPPY +KPP PP P Y+SPPY +K PPP Y++ Y P PPP Sbjct: 560 PPPPPPVQYQSPPYHHKPPPPPPPIEYQSPPYQHKTSPPPPPGYDT----YSSPPPPP 613 Score = 54.7 bits (130), Expect(2) = 1e-07 Identities = 31/69 (44%), Positives = 39/69 (56%), Gaps = 10/69 (14%) Frame = -3 Query: 179 YVYKPPTPPPYV-YKSPPYVYK--PPTPPPYESPPYVYKPPTPPP---YVYESPP----Y 30 Y +KPP PPP + Y+SPPY +K PP PP Y++ Y P PPP Y + PP Y Sbjct: 573 YHHKPPPPPPPIEYQSPPYQHKTSPPPPPGYDT----YSSPPPPPKNEYAHSPPPTHGHY 628 Query: 29 VYKPPTPPP 3 K +PPP Sbjct: 629 PPKRESPPP 637 Score = 24.3 bits (51), Expect(2) = 1e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y+SP Sbjct: 560 PPPPPPVQYQSP 571 [47][TOP] >UniRef100_Q9LJK0 Genomic DNA, chromosome 3, P1 clone: MZN14 n=1 Tax=Arabidopsis thaliana RepID=Q9LJK0_ARATH Length = 1018 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 38/66 (57%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 517 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 575 Query: 26 YKPPTP 9 Y P+P Sbjct: 576 YYSPSP 581 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 38/66 (57%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 542 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 600 Query: 26 YKPPTP 9 Y P+P Sbjct: 601 YYSPSP 606 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 38/66 (57%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 709 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 767 Query: 26 YKPPTP 9 Y P+P Sbjct: 768 YYSPSP 773 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 38/66 (57%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 734 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 792 Query: 26 YKPPTP 9 Y P+P Sbjct: 793 YYSPSP 798 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 38/66 (57%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 759 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 817 Query: 26 YKPPTP 9 Y P+P Sbjct: 818 YYSPSP 823 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 38/66 (57%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 784 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 842 Query: 26 YKPPTP 9 Y P+P Sbjct: 843 YYSPSP 848 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 38/66 (57%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 809 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 867 Query: 26 YKPPTP 9 Y P+P Sbjct: 868 YYSPSP 873 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 489 PPPYVYSSP 497 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 514 PPPYVYSSP 522 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 681 PPPYVYSSP 689 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 706 PPPYVYSSP 714 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 731 PPPYVYSSP 739 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 756 PPPYVYSSP 764 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 781 PPPYVYSSP 789 Score = 67.4 bits (163), Expect(2) = 3e-11 Identities = 38/66 (57%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 367 YVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSP-PPPYVYSSPPPP 425 Query: 26 YKPPTP 9 Y P+P Sbjct: 426 YYSPSP 431 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 339 PPPYVYSSP 347 Score = 67.0 bits (162), Expect(2) = 4e-11 Identities = 38/66 (57%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 267 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 325 Query: 26 YKPPTP 9 Y PTP Sbjct: 326 YYSPTP 331 Score = 23.9 bits (50), Expect(2) = 4e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 239 PPPYVYSSP 247 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 37/66 (56%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y +YKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 492 YVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 550 Query: 26 YKPPTP 9 Y P+P Sbjct: 551 YYSPSP 556 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 464 PPPYVYSSP 472 Score = 66.2 bits (160), Expect(2) = 7e-11 Identities = 36/60 (60%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP VYK P PP Sbjct: 259 VYKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 316 Score = 23.9 bits (50), Expect(2) = 7e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 214 PPPYVYSSP 222 Score = 65.9 bits (159), Expect(2) = 1e-10 Identities = 40/77 (51%), Positives = 40/77 (51%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y VYKS PPYVY P PPPY S PPYVY P PP Sbjct: 192 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPPYVYSSP-PP 249 Query: 56 PYVYESPPYVYKPPTPP 6 PY SP VYK P PP Sbjct: 250 PYYSPSPKIVYKSPPPP 266 Score = 65.9 bits (159), Expect(2) = 1e-10 Identities = 40/77 (51%), Positives = 40/77 (51%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y VYKS PPYVY P PPPY S PPYVY P PP Sbjct: 392 YVYSSPPPPYYTPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPPYVYSSP-PP 449 Query: 56 PYVYESPPYVYKPPTPP 6 PY SP VYK P PP Sbjct: 450 PYYSPSPKVVYKSPPPP 466 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 37/66 (56%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 684 YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 742 Query: 26 YKPPTP 9 Y P+P Sbjct: 743 YYSPSP 748 Score = 24.3 bits (51), Expect(2) = 1e-10 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPPYVY SP Sbjct: 655 SPPPYVYSSP 664 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 189 PPPYVYSSP 197 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 364 PPPYVYSSP 372 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 37/66 (56%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 292 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSP-PPPYVYSSPPPP 350 Query: 26 YKPPTP 9 Y P+P Sbjct: 351 YYSPSP 356 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 37/66 (56%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 342 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSP-PPPYVYSSPPPP 400 Query: 26 YKPPTP 9 Y P+P Sbjct: 401 YYTPSP 406 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 38/68 (55%), Positives = 41/68 (60%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPY 30 VYK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y VY+S PPY Sbjct: 409 VYKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPY 467 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 468 VYSSPPPP 475 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 37/66 (56%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 417 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 475 Query: 26 YKPPTP 9 Y P+P Sbjct: 476 YYSPSP 481 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 37/66 (56%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 442 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 500 Query: 26 YKPPTP 9 Y P+P Sbjct: 501 YYSPSP 506 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 37/66 (56%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y VYKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 834 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 892 Query: 26 YKPPTP 9 Y P+P Sbjct: 893 YYSPSP 898 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 264 PPPYVYSSP 272 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 314 PPPYVYSSP 322 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 389 PPPYVYSSP 397 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 414 PPPYVYSSP 422 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 439 PPPYVYSSP 447 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 806 PPPYVYSSP 814 Score = 65.1 bits (157), Expect(2) = 2e-10 Identities = 36/60 (60%), Positives = 37/60 (61%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y PTP Y+SPP YVY P PPPY SP YK P PP Sbjct: 309 VYKSP-PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPP 366 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 289 PPPYVYSSP 297 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 38/75 (50%), Positives = 42/75 (56%), Gaps = 9/75 (12%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPY------VYKS--PPYVYKPPTPPPYESP-PYVYKPPTPPP 54 PH+C+ PP PP Y VYKS PPYVY P PPPY SP P V+ PPP Sbjct: 632 PHVCVC-------PPPPPCYSPSPKVVYKSSPPPYVYSSP-PPPYHSPSPKVHYKSPPPP 683 Query: 53 YVYESPPYVYKPPTP 9 YVY SPP Y P+P Sbjct: 684 YVYSSPPPPYYSPSP 698 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 589 PPPYVYSSP 597 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 92 YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSP-PPPYVYSSPPPP 150 Query: 26 YKPPTP 9 Y P+P Sbjct: 151 YYSPSP 156 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 859 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 917 Query: 26 YKPPTP 9 Y P+P Sbjct: 918 YYSPSP 923 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 909 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSP-PPPYVYSSPPPP 967 Query: 26 YKPPTP 9 Y P+P Sbjct: 968 YYSPSP 973 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 89 PPPYVYNSP 97 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 831 PPPYVYSSP 839 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 881 PPPYVYSSP 889 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTP------PPYVYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P P P YKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 167 YVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSP-PPPYVYSSPPPP 225 Query: 26 YKPPTP 9 Y P+P Sbjct: 226 YYSPSP 231 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 36/66 (54%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 884 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 942 Query: 26 YKPPTP 9 Y P P Sbjct: 943 YYSPAP 948 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 139 PPPYVYSSP 147 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 856 PPPYVYSSP 864 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 38/68 (55%), Positives = 41/68 (60%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPY 30 VYK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y VY+S PPY Sbjct: 209 VYKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPY 267 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 268 VYSSPPPP 275 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 P PYVY SP Sbjct: 164 PSPYVYNSP 172 Score = 65.9 bits (159), Expect = 1e-09 Identities = 36/60 (60%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 534 VYKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 591 Score = 65.9 bits (159), Expect = 1e-09 Identities = 36/60 (60%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 726 VYKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 783 Score = 65.9 bits (159), Expect = 1e-09 Identities = 36/60 (60%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 751 VYKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 808 Score = 65.9 bits (159), Expect = 1e-09 Identities = 36/60 (60%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 776 VYKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 833 Score = 65.9 bits (159), Expect = 1e-09 Identities = 36/60 (60%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 801 VYKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 858 Score = 65.5 bits (158), Expect = 2e-09 Identities = 37/66 (56%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP VYK P PPPYVY SPP Sbjct: 217 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSP-PPPYVYSSPPPP 275 Query: 26 YKPPTP 9 Y P+P Sbjct: 276 YYSPSP 281 Score = 60.8 bits (146), Expect(2) = 3e-09 Identities = 36/67 (53%), Positives = 39/67 (58%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPYV 27 YK P P PYVY SPP Y P+P Y+SPP YVY P PP Y VY+S PPYV Sbjct: 160 YKSP-PSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV 218 Query: 26 YKPPTPP 6 Y P PP Sbjct: 219 YSSPPPP 225 Score = 60.8 bits (146), Expect(2) = 3e-09 Identities = 34/60 (56%), Positives = 36/60 (60%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P P Sbjct: 559 VYKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVYYKSPPSP 616 Score = 23.9 bits (50), Expect(2) = 3e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 114 PPPYVYSSP 122 Score = 23.9 bits (50), Expect(2) = 3e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 539 PPPYVYSSP 547 Score = 64.7 bits (156), Expect = 3e-09 Identities = 35/60 (58%), Positives = 38/60 (63%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 +YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 509 LYKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 566 Score = 64.3 bits (155), Expect = 4e-09 Identities = 37/68 (54%), Positives = 41/68 (60%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPY 30 VYK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y +Y+S PPY Sbjct: 459 VYKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPY 517 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 518 VYSSPPPP 525 Score = 64.3 bits (155), Expect = 4e-09 Identities = 36/66 (54%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP +YK P PPPYVY SPP Sbjct: 467 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSP-PPPYVYSSPPPP 525 Query: 26 YKPPTP 9 Y P+P Sbjct: 526 YYSPSP 531 Score = 64.3 bits (155), Expect = 4e-09 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 485 YKSP-PPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 541 Score = 64.3 bits (155), Expect = 4e-09 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 677 YKSP-PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 733 Score = 64.3 bits (155), Expect = 4e-09 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP VYK P PP Sbjct: 702 YKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVVYKSPPPP 758 Score = 63.9 bits (154), Expect = 5e-09 Identities = 37/67 (55%), Positives = 40/67 (59%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPYV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y VY+S PPYV Sbjct: 335 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYV 393 Query: 26 YKPPTPP 6 Y P PP Sbjct: 394 YSSPPPP 400 Score = 63.5 bits (153), Expect = 7e-09 Identities = 39/77 (50%), Positives = 39/77 (50%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKSPP YVY P PPPY S PPYVY P PP Sbjct: 317 YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPPYVYSSP-PP 374 Query: 56 PYVYESPPYVYKPPTPP 6 PY SP VYK P PP Sbjct: 375 PYYSPSPKIVYKSPPPP 391 Score = 63.5 bits (153), Expect = 7e-09 Identities = 37/67 (55%), Positives = 40/67 (59%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPYV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y VY+S PPYV Sbjct: 360 YKSP-PPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYV 418 Query: 26 YKPPTPP 6 Y P PP Sbjct: 419 YSSPPPP 425 Score = 59.3 bits (142), Expect(2) = 8e-09 Identities = 35/67 (52%), Positives = 35/67 (52%), Gaps = 9/67 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPY SP Sbjct: 934 YVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYYSPSPKVD 992 Query: 26 YKPPTPP 6 YK P PP Sbjct: 993 YKSPPPP 999 Score = 23.9 bits (50), Expect(2) = 8e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 906 PPPYVYSSP 914 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 384 VYKSP-PPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPP 441 Score = 63.2 bits (152), Expect = 9e-09 Identities = 34/66 (51%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYV 27 YVY P PPPY YKSPP YVY P PP Y P V+ PPPYVY SPP Sbjct: 659 YVYSSP-PPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPP 717 Query: 26 YKPPTP 9 Y P+P Sbjct: 718 YYSPSP 723 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 826 VYKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPP 883 Score = 58.9 bits (141), Expect(2) = 1e-08 Identities = 32/66 (48%), Positives = 33/66 (50%), Gaps = 8/66 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y VYKSPP YVY P PP Y P VY P PY SP +Y Sbjct: 567 YVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLY 626 Query: 23 KPPTPP 6 K P P Sbjct: 627 KSPPHP 632 Score = 58.9 bits (141), Expect(2) = 1e-08 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 10/65 (15%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP--------PPYESP-PYV-YKPPTPPPYVYESPPYVY 24 YK P PPPYVY SPP Y P+P PPY SP P V YK P PPPYVY SPP Sbjct: 952 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPPS 1009 Query: 23 KPPTP 9 P+P Sbjct: 1010 YSPSP 1014 Score = 23.9 bits (50), Expect(2) = 1e-08 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 564 PPPYVYSSP 572 Score = 23.9 bits (50), Expect(2) = 1e-08 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 931 PPPYVYSSP 939 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP YK P PP Sbjct: 185 YKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPP 241 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP YK P PP Sbjct: 435 YKSP-PPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPP 491 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/67 (52%), Positives = 39/67 (58%), Gaps = 9/67 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVY 24 VYK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 851 VYKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 909 Query: 23 KPPTPPP 3 +PPP Sbjct: 910 VYSSPPP 916 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/73 (46%), Positives = 37/73 (50%), Gaps = 18/73 (24%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVY----------KPPTPPPYESPPYVYKPPTP--------PPYV 48 YK P PPPYVY SPP Y PP+P Y SPP Y P+P PPYV Sbjct: 135 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPYV 193 Query: 47 YESPPYVYKPPTP 9 Y SPP Y P+P Sbjct: 194 YSSPPPPYYSPSP 206 Score = 60.1 bits (144), Expect = 7e-08 Identities = 35/66 (53%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP YK P P PYVY SPP Sbjct: 117 YVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PSPYVYNSPPPS 175 Query: 26 YKPPTP 9 Y P+P Sbjct: 176 YYSPSP 181 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/67 (47%), Positives = 36/67 (53%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYE----------SPPYV 27 YK P PPPYVY SPP Y P+P Y+SPP Y +PPP +Y PPYV Sbjct: 85 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYV 143 Query: 26 YKPPTPP 6 Y P PP Sbjct: 144 YSSPPPP 150 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 877 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 935 Query: 20 PPTPPP 3 +PPP Sbjct: 936 YSSPPP 941 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 902 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYV 960 Query: 20 PPTPPP 3 +PPP Sbjct: 961 YSSPPP 966 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 235 YKSP-PPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 293 Query: 20 PPTPPP 3 +PPP Sbjct: 294 YSSPPP 299 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/66 (50%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPY-VYKPPTPPPYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP +Y P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 110 YKSP-PPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPSPYV 168 Query: 20 PPTPPP 3 +PPP Sbjct: 169 YNSPPP 174 Score = 57.0 bits (136), Expect = 6e-07 Identities = 38/85 (44%), Positives = 43/85 (50%), Gaps = 28/85 (32%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP------PP-----------YESPPYVYK---PPTPP 57 VYK P PPPYVY SPP Y P+P PP Y+SPP+ + PP PP Sbjct: 584 VYKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPP 642 Query: 56 PY------VYES--PPYVYKPPTPP 6 Y VY+S PPYVY P PP Sbjct: 643 CYSPSPKVVYKSSPPPYVYSSPPPP 667 Score = 57.0 bits (136), Expect = 6e-07 Identities = 35/60 (58%), Positives = 36/60 (60%), Gaps = 4/60 (6%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYESPPYV-YKPPTPP 6 YK P PPPYVY SPP Y P P Y+SPP YVY P PPPY Y P V YK P PP Sbjct: 927 YKSP-PPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 983 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/58 (55%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYV-YKPPTPPPYESPPYV-YKPPTPPPYVYESPPYVYKPPTP 9 VY P PPP Y P V YK P PP Y P V YK P PPPYVY SPP Y P+P Sbjct: 51 VYSSP-PPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKSP-PPPYVYNSPPPPYYSPSP 106 [48][TOP] >UniRef100_Q9FG07 Gb|AAD23015.1 n=2 Tax=Arabidopsis thaliana RepID=Q9FG07_ARATH Length = 434 Score = 67.8 bits (164), Expect(2) = 3e-11 Identities = 34/65 (52%), Positives = 36/65 (55%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP +Y Sbjct: 77 YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLY 136 Query: 23 KPPTP 9 P+P Sbjct: 137 YSPSP 141 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 74 PPPYVYNSP 82 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 152 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 211 Query: 23 KPPTP 9 P+P Sbjct: 212 YSPSP 216 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 177 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 236 Query: 23 KPPTP 9 P+P Sbjct: 237 YSPSP 241 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 202 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 261 Query: 23 KPPTP 9 P+P Sbjct: 262 YSPSP 266 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 227 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 286 Query: 23 KPPTP 9 P+P Sbjct: 287 YSPSP 291 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 252 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 311 Query: 23 KPPTP 9 P+P Sbjct: 312 YSPSP 316 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 277 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 336 Query: 23 KPPTP 9 P+P Sbjct: 337 YSPSP 341 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 302 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPY 361 Query: 23 KPPTP 9 P+P Sbjct: 362 YSPSP 366 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 124 PPPYVYSSP 132 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 149 PPPYVYSSP 157 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 174 PPPYVYSSP 182 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 199 PPPYVYSSP 207 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 224 PPPYVYSSP 232 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 249 PPPYVYSSP 257 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 274 PPPYVYSSP 282 Score = 67.0 bits (162), Expect(2) = 1e-10 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 52 YVYSSPPPPYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 111 Query: 23 KPPTP 9 P+P Sbjct: 112 YSPSP 116 Score = 22.7 bits (47), Expect(2) = 1e-10 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P P PYVY SP Sbjct: 47 PHPKPYVYSSP 57 Score = 65.1 bits (157), Expect(2) = 2e-10 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP +Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 120 YKSP-PPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVYYKSPPPP 176 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 99 PPPYVYSSP 107 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P V+ PPPYVY SPP Y Sbjct: 327 YVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 386 Query: 23 KPPTP 9 P+P Sbjct: 387 YSPSP 391 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 299 PPPYVYSSP 307 Score = 64.3 bits (155), Expect(2) = 3e-10 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P V+ PPPYVY SPP Y Sbjct: 352 YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 411 Query: 23 KPPTP 9 P+P Sbjct: 412 YSPSP 416 Score = 23.9 bits (50), Expect(2) = 3e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 324 PPPYVYSSP 332 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP YK P PP Sbjct: 370 YKSP-PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSP-PPPYYSPSPKVTYKSPPPP 426 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 349 PPPYVYSSP 357 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P P Y P VY PPPYVY SPP Y Sbjct: 102 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPPPPY 161 Query: 23 KPPTP 9 P+P Sbjct: 162 YSPSP 166 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 320 YKSP-PPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSP-PPPYYSPSPKVHYKSPPPP 376 Score = 56.6 bits (135), Expect(2) = 5e-08 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 9/59 (15%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPY 30 YVY P PP Y YKSPP YVY P PP Y SP YK P PPPYVY++P Y Sbjct: 377 YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVTYKSP-PPPYVYKTPYY 434 Score = 23.9 bits (50), Expect(2) = 5e-08 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 374 PPPYVYSSP 382 Score = 55.8 bits (133), Expect = 1e-06 Identities = 35/71 (49%), Positives = 37/71 (52%), Gaps = 13/71 (18%) Frame = -3 Query: 182 SYVYKPP-TP----PPYVYKSP-------PYVYKPPTPPPYESPPYV-YKPPTPPPYVYE 42 SY Y P TP P Y +K P PYVY P PP Y P V YK P PPPYVY Sbjct: 22 SYPYSSPHTPAYDSPSYEHKGPKYAPHPKPYVYSSPPPPYYTPSPKVNYKSP-PPPYVYN 80 Query: 41 SPPYVYKPPTP 9 SPP Y P+P Sbjct: 81 SPPPPYYSPSP 91 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYVYKPPTPPP 3 P P PYVY SPP Y P+P Y+SPP YVY P PPPY Y P VY PPP Sbjct: 47 PHPKPYVYSSPPPPYYTPSPKVNYKSPPPPYVYNSP-PPPY-YSPSPKVYYKSPPPP 101 [49][TOP] >UniRef100_Q41402 Nodulin n=1 Tax=Sesbania rostrata RepID=Q41402_SESRO Length = 330 Score = 71.2 bits (173), Expect = 3e-11 Identities = 39/67 (58%), Positives = 41/67 (61%), Gaps = 9/67 (13%) Frame = -3 Query: 176 VYKPPT-PPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYV---YESPPYVYKP 18 + KPPT PP Y+ PP VYKPP PPPYE PP VY PP PPP YE PP VY P Sbjct: 33 IEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKPPPVYPP 92 Query: 17 P--TPPP 3 P PPP Sbjct: 93 PYEKPPP 99 Score = 63.9 bits (154), Expect = 5e-09 Identities = 40/72 (55%), Positives = 42/72 (58%), Gaps = 14/72 (19%) Frame = -3 Query: 176 VYKPPT-PPPY-----VYKSPPYVYKPPT-PPPYESPPYVYKPP---TPPPY--VYESPP 33 VYKPP PPPY VY SPPY PP PPPYE PP VY PP PP Y +E PP Sbjct: 51 VYKPPIFPPPYEKPPPVY-SPPYEKPPPVYPPPYEKPPPVYPPPYEKPPPEYQPPHEKPP 109 Query: 32 YVYKPP--TPPP 3 Y+PP PPP Sbjct: 110 PEYQPPHENPPP 121 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/58 (56%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = -3 Query: 161 TPPPYVYKSPPYVYKPPT---PPPYESPPYVYKPPTPPPYVYESPPYVYKPP--TPPP 3 TP Y PP + KPPT PP YE PP VYKPP PP YE PP VY PP PPP Sbjct: 21 TPVLANYYEPPPIEKPPTYEPPPTYEKPPPVYKPPIFPP-PYEKPPPVYSPPYEKPPP 77 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/66 (45%), Positives = 34/66 (51%), Gaps = 12/66 (18%) Frame = -3 Query: 173 YKPP--TPPPYV---YKSPPYVYKPPTP-------PPYESPPYVYKPPTPPPYVYESPPY 30 YKPP PPPY ++ PP YKPP PPY PP YKPP P Y PPY Sbjct: 262 YKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPPEYPPYVKPPPEYKPPHEKPPGYNPPPY 321 Query: 29 VYKPPT 12 + PP+ Sbjct: 322 GHYPPS 327 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 8/80 (10%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPY- 51 H+ PH + Y+ P ++ PP+ PP PP+E PP YKPP PPPY Sbjct: 214 HEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYE 273 Query: 50 --VYESPPYVYKPP--TPPP 3 +E PP YKPP PPP Sbjct: 274 KPPHEKPPPEYKPPHEKPPP 293 Score = 53.5 bits (127), Expect = 7e-06 Identities = 35/84 (41%), Positives = 39/84 (46%), Gaps = 12/84 (14%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPP--TPPPYESPPYV-----YKPP-- 66 H+ PH H KPP ++ PP YKPP PPPYE PP+ YKPP Sbjct: 234 HEKPPHEKPPHE----KPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHE 289 Query: 65 --TPPPYV-YESPPYVYKPPTPPP 3 PP Y Y PP YKPP P Sbjct: 290 KPPPPEYPPYVKPPPEYKPPHEKP 313 Score = 53.1 bits (126), Expect = 9e-06 Identities = 34/77 (44%), Positives = 39/77 (50%), Gaps = 19/77 (24%) Frame = -3 Query: 176 VYKPP--TPPPYV---YKSPPYVYKPPTP-------PPYESPPYVYKPP--TPPPYV--- 48 VY PP PPP Y+ PP VY PP PP+E PP Y+PP PPP Sbjct: 67 VYSPPYEKPPPVYPPPYEKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPP 126 Query: 47 YESPPYVYKPP--TPPP 3 +E PP Y+PP PPP Sbjct: 127 HEKPPPEYQPPHEKPPP 143 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/72 (41%), Positives = 36/72 (50%), Gaps = 16/72 (22%) Frame = -3 Query: 170 KPPT---PPPYV--------YKSPPYVYKPPTPPPYESPPYVYKPPTPPPY---VYESPP 33 KPP+ PPPY Y+ PP+ P PPY+ PPY P PP+ +E PP Sbjct: 189 KPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPP 248 Query: 32 YVYKPP--TPPP 3 YKPP PPP Sbjct: 249 PEYKPPHEKPPP 260 [50][TOP] >UniRef100_Q9M1G9 Extensin-2 n=1 Tax=Arabidopsis thaliana RepID=EXTN2_ARATH Length = 743 Score = 67.4 bits (163), Expect(2) = 3e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 400 YVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 459 Query: 23 KPPTP 9 P+P Sbjct: 460 YSPSP 464 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 372 PPPYVYSSP 380 Score = 67.0 bits (162), Expect(2) = 4e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 375 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPY 434 Query: 23 KPPTP 9 P+P Sbjct: 435 YSPSP 439 Score = 23.9 bits (50), Expect(2) = 4e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 347 PPPYVYSSP 355 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 425 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 484 Query: 23 KPPTP 9 P+P Sbjct: 485 YSPSP 489 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 450 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 509 Query: 23 KPPTP 9 P+P Sbjct: 510 YSPSP 514 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 475 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 534 Query: 23 KPPTP 9 P+P Sbjct: 535 YSPSP 539 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 575 YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 634 Query: 23 KPPTP 9 P+P Sbjct: 635 YSPSP 639 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 397 PPPYVYSSP 405 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 422 PPPYVYSSP 430 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 447 PPPYVYSSP 455 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 547 PPPYVYSSP 555 Score = 66.2 bits (160), Expect(2) = 7e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 550 YVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 609 Query: 23 KPPTP 9 P+P Sbjct: 610 YSPSP 614 Score = 23.9 bits (50), Expect(2) = 7e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 522 PPPYVYSSP 530 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P V+ PPPYVY SPP Y Sbjct: 500 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 559 Query: 23 KPPTP 9 P+P Sbjct: 560 YSPSP 564 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 472 PPPYVYSSP 480 Score = 64.3 bits (155), Expect(2) = 3e-10 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P V+ PPPYVY SPP Y Sbjct: 525 YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPY 584 Query: 23 KPPTP 9 P+P Sbjct: 585 YSPSP 589 Score = 23.9 bits (50), Expect(2) = 3e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 497 PPPYVYSSP 505 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 75 YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 133 Query: 26 YKPPTP 9 Y P+P Sbjct: 134 YYSPSP 139 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 325 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSP-PPPYVYSSPPPP 383 Query: 26 YKPPTP 9 Y P+P Sbjct: 384 YYSPSP 389 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 593 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVYYKSPPPP 649 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 72 PPPYVYSSP 80 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 297 PPPYVYSSP 305 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 572 PPPYVYNSP 580 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 100 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 158 Query: 26 YKPPTP 9 Y P+P Sbjct: 159 YYSPSP 164 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 125 YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYSSPPPP 183 Query: 26 YKPPTP 9 Y P+P Sbjct: 184 YYSPSP 189 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 150 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 208 Query: 26 YKPPTP 9 Y P+P Sbjct: 209 YYSPSP 214 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 175 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYSSPPPP 233 Query: 26 YKPPTP 9 Y P+P Sbjct: 234 YYSPSP 239 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 200 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 258 Query: 26 YKPPTP 9 Y P+P Sbjct: 259 YYSPSP 264 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 225 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 283 Query: 26 YKPPTP 9 Y P+P Sbjct: 284 YYSPSP 289 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 250 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 308 Query: 26 YKPPTP 9 Y P+P Sbjct: 309 YYSPSP 314 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 275 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 333 Query: 26 YKPPTP 9 Y P+P Sbjct: 334 YYSPSP 339 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 97 PPPYVYSSP 105 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 122 PPPYVYNSP 130 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 147 PPPYVYSSP 155 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 172 PPPYVYSSP 180 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 197 PPPYVYSSP 205 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 222 PPPYVYSSP 230 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 247 PPPYVYSSP 255 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 272 PPPYVYSSP 280 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 350 YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVEYKSPPPPYVYSSPPPP 408 Query: 56 PY------VYES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 409 TYSPSPKVYYKSPPPPYVYSSPPPP 433 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 322 PPPYVYSSP 330 Score = 61.6 bits (148), Expect(2) = 2e-09 Identities = 36/76 (47%), Positives = 38/76 (50%), Gaps = 9/76 (11%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPP 54 PH+C+ PP PP Y VYKSPP YVY P PP Y SP YK P PP Sbjct: 665 PHVCVC-------PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPS 717 Query: 53 YVYESPPYVYKPPTPP 6 Y SP YK P PP Sbjct: 718 YYSPSPKVEYKSPPPP 733 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 622 PPPYVYSSP 630 Score = 60.1 bits (144), Expect(2) = 5e-09 Identities = 32/66 (48%), Positives = 32/66 (48%), Gaps = 8/66 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPY SP Y Sbjct: 600 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYY 659 Query: 23 KPPTPP 6 K P P Sbjct: 660 KSPPHP 665 Score = 23.9 bits (50), Expect(2) = 5e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 597 PPPYVYSSP 605 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 493 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVHYKSPPPP 549 Score = 62.4 bits (150), Expect = 2e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 543 YKSP-PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSP-PPPYYSPSPKVYYKSPPPP 599 Score = 61.2 bits (147), Expect = 3e-08 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 300 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPPYVYSSPPPP 358 Query: 56 PYV------YES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 359 TYSPSPKVDYKSPPPPYVYSSPPPP 383 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 118 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV 176 Query: 20 PPTPPP 3 +PPP Sbjct: 177 YSSPPP 182 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 168 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV 226 Query: 20 PPTPPP 3 +PPP Sbjct: 227 YSSPPP 232 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 193 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 251 Query: 20 PPTPPP 3 +PPP Sbjct: 252 YSSPPP 257 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 218 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 276 Query: 20 PPTPPP 3 +PPP Sbjct: 277 YSSPPP 282 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 243 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 301 Query: 20 PPTPPP 3 +PPP Sbjct: 302 YSSPPP 307 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 268 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 326 Query: 20 PPTPPP 3 +PPP Sbjct: 327 YSSPPP 332 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 293 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 351 Query: 20 PPTPPP 3 +PPP Sbjct: 352 YSSPPP 357 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/59 (59%), Positives = 36/59 (61%), Gaps = 6/59 (10%) Frame = -3 Query: 167 PPT--PPPYV-YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYVYKPPTP 9 PPT P P V YKSPP YVY P PP Y P V YK P PPPYVY SPP Y P+P Sbjct: 57 PPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSP-PPPYVYSSPPPPYYSPSP 114 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 93 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSP-PPPY-YSPSPKVDYKSPPPP 149 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 150 YVYSSPPPP 158 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 143 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 199 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 200 YVYSSPPPP 208 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/77 (45%), Positives = 36/77 (46%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYK-----------PPTPPPY------ 51 YVY P PPPY SP YK P PP Y P VY PP PP Y Sbjct: 625 YVYSSP-PPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV 683 Query: 50 VYES--PPYVYKPPTPP 6 VY+S PPYVY P PP Sbjct: 684 VYKSPPPPYVYNSPPPP 700 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/66 (50%), Positives = 35/66 (53%), Gaps = 10/66 (15%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPPTPPPYV------YES--PPYVY 24 YK P P PYV SPP Y P Y+S PPYVY P PP Y Y+S PPYVY Sbjct: 44 YKTP-PLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVY 102 Query: 23 KPPTPP 6 P PP Sbjct: 103 SSPPPP 108 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/66 (50%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPY-VYKPPTPPPYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 68 YKSP-PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 126 Query: 20 PPTPPP 3 +PPP Sbjct: 127 YNSPPP 132 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/75 (48%), Positives = 38/75 (50%), Gaps = 18/75 (24%) Frame = -3 Query: 173 YKPPTPPPY------VYKSPPYVYK---PPTPPPYE-SPPYVYKPPTPPPYVYESPP--- 33 YK P PP Y YKSPP+ + PP PP Y SP VYK P PPPYVY SPP Sbjct: 643 YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP-PPPYVYNSPPPPY 701 Query: 32 -----YVYKPPTPPP 3 VY PPP Sbjct: 702 YSPSPKVYYKSPPPP 716 [51][TOP] >UniRef100_UPI0001739340 ATHRGP1 (HYDROXYPROLINE-RICH GLYCOPROTEIN); structural constituent of cell wall n=1 Tax=Arabidopsis thaliana RepID=UPI0001739340 Length = 699 Score = 67.4 bits (163), Expect(2) = 3e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 356 YVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 415 Query: 23 KPPTP 9 P+P Sbjct: 416 YSPSP 420 Score = 23.9 bits (50), Expect(2) = 3e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 328 PPPYVYSSP 336 Score = 67.0 bits (162), Expect(2) = 4e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 331 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPY 390 Query: 23 KPPTP 9 P+P Sbjct: 391 YSPSP 395 Score = 23.9 bits (50), Expect(2) = 4e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 303 PPPYVYSSP 311 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 381 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 440 Query: 23 KPPTP 9 P+P Sbjct: 441 YSPSP 445 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 406 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 465 Query: 23 KPPTP 9 P+P Sbjct: 466 YSPSP 470 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 431 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 490 Query: 23 KPPTP 9 P+P Sbjct: 491 YSPSP 495 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 531 YVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 590 Query: 23 KPPTP 9 P+P Sbjct: 591 YSPSP 595 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 353 PPPYVYSSP 361 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 378 PPPYVYSSP 386 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 403 PPPYVYSSP 411 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 503 PPPYVYSSP 511 Score = 66.2 bits (160), Expect(2) = 7e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 506 YVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 565 Query: 23 KPPTP 9 P+P Sbjct: 566 YSPSP 570 Score = 23.9 bits (50), Expect(2) = 7e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 478 PPPYVYSSP 486 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P V+ PPPYVY SPP Y Sbjct: 456 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPY 515 Query: 23 KPPTP 9 P+P Sbjct: 516 YSPSP 520 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 428 PPPYVYSSP 436 Score = 64.3 bits (155), Expect(2) = 3e-10 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P V+ PPPYVY SPP Y Sbjct: 481 YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPY 540 Query: 23 KPPTP 9 P+P Sbjct: 541 YSPSP 545 Score = 23.9 bits (50), Expect(2) = 3e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 453 PPPYVYSSP 461 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 81 YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 139 Query: 26 YKPPTP 9 Y P+P Sbjct: 140 YYSPSP 145 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 281 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSP-PPPYVYSSPPPP 339 Query: 26 YKPPTP 9 Y P+P Sbjct: 340 YYSPSP 345 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 549 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVYYKSPPPP 605 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 78 PPPYVYSSP 86 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 253 PPPYVYSSP 261 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 528 PPPYVYNSP 536 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 106 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 164 Query: 26 YKPPTP 9 Y P+P Sbjct: 165 YYSPSP 170 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 131 YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYSSPPPP 189 Query: 26 YKPPTP 9 Y P+P Sbjct: 190 YYSPSP 195 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 156 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 214 Query: 26 YKPPTP 9 Y P+P Sbjct: 215 YYSPSP 220 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 181 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 239 Query: 26 YKPPTP 9 Y P+P Sbjct: 240 YYSPSP 245 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 206 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 264 Query: 26 YKPPTP 9 Y P+P Sbjct: 265 YYSPSP 270 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 231 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 289 Query: 26 YKPPTP 9 Y P+P Sbjct: 290 YYSPSP 295 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 103 PPPYVYSSP 111 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 128 PPPYVYNSP 136 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 153 PPPYVYSSP 161 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 178 PPPYVYSSP 186 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 203 PPPYVYSSP 211 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 228 PPPYVYSSP 236 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 306 YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVEYKSPPPPYVYSSPPPP 364 Query: 56 PY------VYES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 365 TYSPSPKVYYKSPPPPYVYSSPPPP 389 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 278 PPPYVYSSP 286 Score = 61.6 bits (148), Expect(2) = 2e-09 Identities = 36/76 (47%), Positives = 38/76 (50%), Gaps = 9/76 (11%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPY------VYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPP 54 PH+C+ PP PP Y VYKSPP YVY P PP Y SP YK P PP Sbjct: 621 PHVCVC-------PPPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPS 673 Query: 53 YVYESPPYVYKPPTPP 6 Y SP YK P PP Sbjct: 674 YYSPSPKVEYKSPPPP 689 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 578 PPPYVYSSP 586 Score = 60.1 bits (144), Expect(2) = 5e-09 Identities = 32/66 (48%), Positives = 32/66 (48%), Gaps = 8/66 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPY SP Y Sbjct: 556 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYY 615 Query: 23 KPPTPP 6 K P P Sbjct: 616 KSPPHP 621 Score = 23.9 bits (50), Expect(2) = 5e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 553 PPPYVYSSP 561 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 449 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVHYKSPPPP 505 Score = 62.4 bits (150), Expect = 2e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 499 YKSP-PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSP-PPPYYSPSPKVYYKSPPPP 555 Score = 61.2 bits (147), Expect = 3e-08 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 256 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPPYVYSSPPPP 314 Query: 56 PYV------YES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 315 TYSPSPKVDYKSPPPPYVYSSPPPP 339 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 124 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV 182 Query: 20 PPTPPP 3 +PPP Sbjct: 183 YSSPPP 188 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 149 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 207 Query: 20 PPTPPP 3 +PPP Sbjct: 208 YSSPPP 213 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 174 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 232 Query: 20 PPTPPP 3 +PPP Sbjct: 233 YSSPPP 238 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 199 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 257 Query: 20 PPTPPP 3 +PPP Sbjct: 258 YSSPPP 263 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 224 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 282 Query: 20 PPTPPP 3 +PPP Sbjct: 283 YSSPPP 288 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 249 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 307 Query: 20 PPTPPP 3 +PPP Sbjct: 308 YSSPPP 313 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/59 (59%), Positives = 36/59 (61%), Gaps = 6/59 (10%) Frame = -3 Query: 167 PPT--PPPYV-YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYVYKPPTP 9 PPT P P V YKSPP YVY P PP Y P V YK P PPPYVY SPP Y P+P Sbjct: 63 PPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSP-PPPYVYSSPPPPYYSPSP 120 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 99 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSP-PPPY-YSPSPKVDYKSPPPP 155 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 156 YVYSSPPPP 164 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/77 (45%), Positives = 36/77 (46%), Gaps = 19/77 (24%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYK-----------PPTPPPY------ 51 YVY P PPPY SP YK P PP Y P VY PP PP Y Sbjct: 581 YVYSSP-PPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKV 639 Query: 50 VYES--PPYVYKPPTPP 6 VY+S PPYVY P PP Sbjct: 640 VYKSPPPPYVYNSPPPP 656 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/66 (50%), Positives = 35/66 (53%), Gaps = 10/66 (15%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPPTPPPYV------YES--PPYVY 24 YK P P PYV SPP Y P Y+S PPYVY P PP Y Y+S PPYVY Sbjct: 50 YKTP-PLPYVDSSPPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVY 108 Query: 23 KPPTPP 6 P PP Sbjct: 109 SSPPPP 114 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/66 (50%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPY-VYKPPTPPPYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 74 YKSP-PPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 132 Query: 20 PPTPPP 3 +PPP Sbjct: 133 YNSPPP 138 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/75 (48%), Positives = 38/75 (50%), Gaps = 18/75 (24%) Frame = -3 Query: 173 YKPPTPPPY------VYKSPPYVYK---PPTPPPYE-SPPYVYKPPTPPPYVYESPP--- 33 YK P PP Y YKSPP+ + PP PP Y SP VYK P PPPYVY SPP Sbjct: 599 YKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP-PPPYVYNSPPPPY 657 Query: 32 -----YVYKPPTPPP 3 VY PPP Sbjct: 658 YSPSPKVYYKSPPPP 672 [52][TOP] >UniRef100_Q41120 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q41120_PHAVU Length = 154 Score = 67.0 bits (162), Expect(2) = 4e-11 Identities = 35/74 (47%), Positives = 36/74 (48%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP----------YVYKPPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKSPP Y + PP P P PPY YK P PPP Sbjct: 37 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPTPHPPYYYKSP-PPPTS 95 Query: 47 YESPPYVYKPPTPP 6 Y PPY Y P PP Sbjct: 96 YPPPPYHYVSPPPP 109 Score = 24.3 bits (51), Expect(2) = 4e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 15 PSPPPPYYYKSP 26 Score = 63.9 bits (154), Expect(2) = 3e-10 Identities = 34/82 (41%), Positives = 39/82 (47%), Gaps = 24/82 (29%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP----------YVYKPPTPPPYESPPYVYKPPTP----- 60 Y + PP P PPY YKSPP + PP P P PPY YK P P Sbjct: 70 YYHSPPPPSPTPHPPYYYKSPPPPTSYPPPPYHYVSPPPPSPSPPPPYYYKSPPPPSPAP 129 Query: 59 -PPYVYESPP---YVYKPPTPP 6 P Y+Y+SPP Y+Y P PP Sbjct: 130 APKYIYKSPPPPAYIYSSPPPP 151 Score = 24.3 bits (51), Expect(2) = 3e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 31 PSPPPPYYYKSP 42 Score = 67.4 bits (163), Expect = 5e-10 Identities = 35/72 (48%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKSPPYVY-KPPTPPPYESPPYVYKPPTPPPYVYE 42 H P H Y YK P PPP Y PPY Y PP P P PPY YK P PPP Sbjct: 72 HSPPPPSPTPHPPYYYKSP-PPPTSYPPPPYHYVSPPPPSPSPPPPYYYKSP-PPPSPAP 129 Query: 41 SPPYVYKPPTPP 6 +P Y+YK P PP Sbjct: 130 APKYIYKSPPPP 141 Score = 66.2 bits (160), Expect = 1e-09 Identities = 40/89 (44%), Positives = 40/89 (44%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 Y YK P PP PY YKS PPY YK PP P P PPY YK P Sbjct: 5 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 64 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPY Y S PPY YK P PP Sbjct: 65 PPPPYYYHSPPPPSPTPHPPYYYKSPPPP 93 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/50 (58%), Positives = 30/50 (60%) Frame = -3 Query: 155 PPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PPY YKSPP PP+P P PPY YK P PPP PPY YK P PP Sbjct: 3 PPYYYKSPP----PPSPSP--PPPYYYKSP-PPPSPSPPPPYYYKSPPPP 45 [53][TOP] >UniRef100_Q01944 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q01944_SOLLC Length = 75 Score = 65.9 bits (159), Expect(2) = 4e-11 Identities = 33/62 (53%), Positives = 33/62 (53%), Gaps = 4/62 (6%) Frame = -3 Query: 179 YVYKPPTPP----PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 Y YK P PP PY YKSPP P PP Y S P KP PPPY Y SPP K P Sbjct: 8 YYYKSPPPPSPPPPYYYKSPPPPSPSPPPPYYYSSPPPPKPSPPPPYYYSSPPPPKKSPP 67 Query: 11 PP 6 PP Sbjct: 68 PP 69 Score = 25.4 bits (54), Expect(2) = 4e-11 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 216 PTPPPYVYESP 184 P+PPPY Y+SP Sbjct: 3 PSPPPYYYKSP 13 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/60 (51%), Positives = 32/60 (53%), Gaps = 6/60 (10%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYESPPYVYK------PPTPPPYVYESPPYVYKPPTPPP 3 P+P P PPY YK P PPP PPY YK P PPPY Y SPP KP PPP Sbjct: 1 PSPSP-----PPYYYKSP-PPPSPPPPYYYKSPPPPSPSPPPPYYYSSPP-PPKPSPPPP 53 Score = 51.6 bits (122), Expect(2) = 1e-06 Identities = 29/61 (47%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 Y YK P PP PY Y SPP PP P P PPY Y P PPP PPY Y Sbjct: 22 YYYKSPPPPSPSPPPPYYYSSPP----PPKPSP--PPPYYYSSP-PPPKKSPPPPYYYSS 74 Query: 17 P 15 P Sbjct: 75 P 75 Score = 24.3 bits (51), Expect(2) = 1e-06 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 16 PSPPPPYYYKSP 27 [54][TOP] >UniRef100_Q9M1H0 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9M1H0_ARATH Length = 951 Score = 67.0 bits (162), Expect(2) = 4e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 450 YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 509 Query: 23 KPPTP 9 P+P Sbjct: 510 YSPSP 514 Score = 67.0 bits (162), Expect(2) = 4e-11 Identities = 36/74 (48%), Positives = 39/74 (52%), Gaps = 8/74 (10%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPY 51 PH+C+ PP PP Y VYKSPP YVY P PP Y P VY PPPY Sbjct: 690 PHVCVC-------PPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPY 742 Query: 50 VYESPPYVYKPPTP 9 VY SPP Y P+P Sbjct: 743 VYSSPPPPYYSPSP 756 Score = 23.9 bits (50), Expect(2) = 4e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 422 PPPYVYSSP 430 Score = 23.9 bits (50), Expect(2) = 4e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 663 PPPYVYSSP 671 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 475 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 534 Query: 23 KPPTP 9 P+P Sbjct: 535 YSPSP 539 Score = 66.6 bits (161), Expect(2) = 6e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 616 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 675 Query: 23 KPPTP 9 P+P Sbjct: 676 YSPSP 680 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 447 PPPYVYSSP 455 Score = 23.9 bits (50), Expect(2) = 6e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 588 PPPYVYSSP 596 Score = 65.9 bits (159), Expect(2) = 1e-10 Identities = 31/57 (54%), Positives = 32/57 (56%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 YVY P PPPY SP YK P PP Y P VY PPPYVY SPP Y P+P Sbjct: 525 YVYSSP-PPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 580 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 497 PPPYVYSSP 505 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 35/66 (53%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY-------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYV 27 YVY P PPPY YKSPP YVY P PP Y P VY PPPYVY SPP Sbjct: 591 YVYSSP-PPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 649 Query: 26 YKPPTP 9 Y P+P Sbjct: 650 YYSPSP 655 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 563 PPPYVYSSP 571 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 150 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPP 208 Query: 26 YKPPTP 9 Y P+P Sbjct: 209 YYSPSP 214 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 375 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPP 433 Query: 26 YKPPTP 9 Y P+P Sbjct: 434 YYSPSP 439 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 33/63 (52%), Positives = 34/63 (53%), Gaps = 8/63 (12%) Frame = -3 Query: 173 YKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 YK P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 543 YKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHS 602 Query: 17 PTP 9 P+P Sbjct: 603 PSP 605 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 122 PPPYVYSSP 130 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 347 PPPYVYSSP 355 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 522 PPPYVYSSP 530 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 200 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSP-PPPYVYSSPPPP 258 Query: 26 YKPPTP 9 Y P+P Sbjct: 259 YYSPSP 264 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 250 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSP-PPPYVYSSPPPP 308 Query: 26 YKPPTP 9 Y P+P Sbjct: 309 YYSPSP 314 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 425 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSP-PPPYVYSSPPPP 483 Query: 26 YKPPTP 9 Y P+P Sbjct: 484 YYSPSP 489 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 493 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVYYKSPPPP 549 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 172 PPPYVYSSP 180 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 222 PPPYVYSSP 230 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 397 PPPYVYSSP 405 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 472 PPPYVYSSP 480 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 37/75 (49%), Positives = 41/75 (54%), Gaps = 9/75 (12%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTP--------PP 54 PH + Y YK P PPPYVY SPP Y P+P Y+SPP Y PTP PP Sbjct: 725 PHYSPSPKVY-YKSP-PPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPP 782 Query: 53 YVYESPPYVYKPPTP 9 YVY SPP Y P+P Sbjct: 783 YVYSSPPPPYYSPSP 797 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 858 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSP-PPPYVYSSPPPP 916 Query: 26 YKPPTP 9 Y P+P Sbjct: 917 YYSPSP 922 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 714 PPPYVYSSP 722 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 830 PPPYVYSSP 838 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 783 YVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYSSPPPP 841 Query: 26 YKPPTP 9 Y P+P Sbjct: 842 YYSPSP 847 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 808 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 866 Query: 26 YKPPTP 9 Y P+P Sbjct: 867 YYSPSP 872 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 833 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 891 Query: 26 YKPPTP 9 Y P+P Sbjct: 892 YYSPSP 897 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 739 PPPYVYSSP 747 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 780 PPPYVYSSP 788 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 805 PPPYVYSSP 813 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 38/76 (50%), Positives = 38/76 (50%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPP-- 33 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 75 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPP 133 Query: 32 -------YVYKPPTPP 6 YK P PP Sbjct: 134 TYSPSPKVEYKSPPPP 149 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 38/76 (50%), Positives = 38/76 (50%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPP-- 33 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 100 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPP 158 Query: 32 -------YVYKPPTPP 6 YK P PP Sbjct: 159 TYSPSPKVEYKSPPPP 174 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 38/76 (50%), Positives = 38/76 (50%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPP-- 33 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 325 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPP 383 Query: 32 -------YVYKPPTPP 6 YK P PP Sbjct: 384 TYSPSPKVEYKSPPPP 399 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 38/76 (50%), Positives = 38/76 (50%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPP-- 33 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 350 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPP 408 Query: 32 -------YVYKPPTPP 6 YK P PP Sbjct: 409 TYSPSPKVEYKSPPPP 424 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 72 PPPYVYSSP 80 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 97 PPPYVYSSP 105 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 297 PPPYVYSSP 305 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 322 PPPYVYSSP 330 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 175 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP-PPPYYSPSPKVEYKSPPPPYVYSSPPPP 233 Query: 56 PYV------YES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 234 TYSPSPKVDYKSPPPPYVYSSPPPP 258 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 225 YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVEYKSPPPPYVYSSPPPP 283 Query: 56 PYV------YES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 284 TYSPSPKVDYKSPPPPYVYSSPPPP 308 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 275 YVYSSPPPPTYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPPYVYSSPPPP 333 Query: 56 PY------VYES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 334 TYSPSPKVEYKSPPPPYVYSSPPPP 358 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 40/85 (47%), Positives = 41/85 (48%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKS--PPYVYKPPTPPPYES-----------PPYVYKPPTPP 57 YVY P PP Y YKS PPYVY P PPPY S PPYVY P PP Sbjct: 400 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP-PPPYYSPSPKVEYKSPPPPYVYSSPPPP 458 Query: 56 PYV------YES--PPYVYKPPTPP 6 Y Y+S PPYVY P PP Sbjct: 459 TYSPSPKVDYKSPPPPYVYSSPPPP 483 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 147 PPPYVYSSP 155 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 197 PPPYVYSSP 205 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 247 PPPYVYSSP 255 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 372 PPPYVYSSP 380 Score = 61.6 bits (148), Expect(2) = 2e-09 Identities = 38/76 (50%), Positives = 38/76 (50%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPP-- 33 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 300 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPP 358 Query: 32 -------YVYKPPTPP 6 YK P PP Sbjct: 359 TYSPSPKVEYKSPPPP 374 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 272 PPPYVYSSP 280 Score = 60.5 bits (145), Expect(2) = 4e-09 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P P Sbjct: 634 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVYYKSPPHP 690 Score = 23.9 bits (50), Expect(2) = 4e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 613 PPPYVYSSP 621 Score = 60.1 bits (144), Expect(2) = 5e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 876 YKSP-PPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSP-PPPY-YSPSPKVEYKSPPPP 932 Query: 32 YVYKPPTPP 6 YVYK P PP Sbjct: 933 YVYKSPPPP 941 Score = 60.1 bits (144), Expect(2) = 5e-09 Identities = 35/66 (53%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY+SPP Sbjct: 883 YVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYKSPPPP 941 Query: 26 YKPPTP 9 P+P Sbjct: 942 SYSPSP 947 Score = 23.9 bits (50), Expect(2) = 5e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 855 PPPYVYSSP 863 Score = 23.9 bits (50), Expect(2) = 5e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 880 PPPYVYSSP 888 Score = 63.5 bits (153), Expect = 7e-09 Identities = 33/66 (50%), Positives = 33/66 (50%), Gaps = 8/66 (12%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPY SP Y Sbjct: 500 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYY 559 Query: 23 KPPTPP 6 K P PP Sbjct: 560 KSPPPP 565 Score = 63.5 bits (153), Expect = 7e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESP-PYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PPPY SP P V PPPYVY SPP Sbjct: 566 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYHSPSPKVQYKSPPPPYVYSSPPPP 624 Query: 26 YKPPTP 9 Y P+P Sbjct: 625 YYSPSP 630 Score = 59.3 bits (142), Expect(2) = 8e-09 Identities = 35/68 (51%), Positives = 40/68 (58%), Gaps = 12/68 (17%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYK---PPTPPPY------VYES--PPY 30 YK P PPPYVY SPP Y P+P Y+SPP+ + PP PP Y VY+S PPY Sbjct: 659 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 717 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 718 VYSSPPPP 725 Score = 23.9 bits (50), Expect(2) = 8e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 638 PPPYVYSSP 646 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 559 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYHSPSPKVQYKSPPPP 615 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/60 (55%), Positives = 35/60 (58%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPPYVY SPP + P+P Y PPYVY P PPPY SP YK P PP Sbjct: 709 VYKSP-PPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVHYKSPPPP 766 Score = 62.8 bits (151), Expect = 1e-08 Identities = 32/63 (50%), Positives = 34/63 (53%), Gaps = 8/63 (12%) Frame = -3 Query: 173 YKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 YK P PP Y YKSPP YVY P PP Y P V+ PPPYVY SPP Y Sbjct: 760 YKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYS 819 Query: 17 PTP 9 P+P Sbjct: 820 PSP 822 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/76 (50%), Positives = 38/76 (50%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPP-- 33 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 125 YVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPP 183 Query: 32 -------YVYKPPTPP 6 YK P PP Sbjct: 184 TYSPSPKVEYKSPPPP 199 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP YK P PP Sbjct: 776 YKSP-PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSP-PPPYYSPSPKVEYKSPPPP 832 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 801 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 859 Query: 20 PPTPPP 3 +PPP Sbjct: 860 YSSPPP 865 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 826 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 884 Query: 20 PPTPPP 3 +PPP Sbjct: 885 YSSPPP 890 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 851 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYV 909 Query: 20 PPTPPP 3 +PPP Sbjct: 910 YSSPPP 915 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/67 (52%), Positives = 36/67 (53%), Gaps = 9/67 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP Y PTP Y+S PPYVY P PPPY SP Sbjct: 742 YVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSP-PPPYYSPSPKVH 800 Query: 26 YKPPTPP 6 YK P PP Sbjct: 801 YKSPPPP 807 Score = 58.5 bits (140), Expect = 2e-07 Identities = 37/77 (48%), Positives = 39/77 (50%), Gaps = 18/77 (23%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPPYVYK---PPTPPPYE-SPPYVYKPPTPPPYVYESPP- 33 YVY P PP Y YKSPP+ + PP PP Y SP VYK P PPPYVY SPP Sbjct: 666 YVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSP-PPPYVYSSPPP 724 Query: 32 -------YVYKPPTPPP 3 VY PPP Sbjct: 725 PHYSPSPKVYYKSPPPP 741 Score = 56.6 bits (135), Expect = 8e-07 Identities = 37/69 (53%), Positives = 37/69 (53%), Gaps = 15/69 (21%) Frame = -3 Query: 167 PPT--PPPYV-YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPP--------- 33 PPT P P V YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 57 PPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPPTYSPSPK 115 Query: 32 YVYKPPTPP 6 YK P PP Sbjct: 116 VEYKSPPPP 124 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 10/66 (15%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPPTPPPY------VYES--PPYVY 24 YK P P PY+ SPP Y P Y+S PPYVY P PP Y Y+S PPYVY Sbjct: 44 YKTP-PLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVY 102 Query: 23 KPPTPP 6 P PP Sbjct: 103 SSPPPP 108 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/67 (46%), Positives = 33/67 (49%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYE----------SPPYV 27 YK P PPPYVY SPP Y P Y+SPP Y +PPP Y PPYV Sbjct: 68 YKSP-PPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV 126 Query: 26 YKPPTPP 6 Y P PP Sbjct: 127 YSSPPPP 133 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/68 (47%), Positives = 32/68 (47%), Gaps = 12/68 (17%) Frame = -3 Query: 173 YKPPTPPPYVYKSPP---------YVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPY 30 YK P PPPYVY SPP YK P PPPY PP Y P Y PPY Sbjct: 93 YKSP-PPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPPTYSPSPKVEYKSPPPPY 150 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 151 VYSSPPPP 158 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/68 (47%), Positives = 32/68 (47%), Gaps = 12/68 (17%) Frame = -3 Query: 173 YKPPTPPPYVYKSPP---------YVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPY 30 YK P PPPYVY SPP YK P PPPY PP Y P Y PPY Sbjct: 118 YKSP-PPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPPTYSPSPKVEYKSPPPPY 175 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 176 VYSSPPPP 183 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/68 (47%), Positives = 32/68 (47%), Gaps = 12/68 (17%) Frame = -3 Query: 173 YKPPTPPPYVYKSPP---------YVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPY 30 YK P PPPYVY SPP YK P PPPY PP Y P Y PPY Sbjct: 318 YKSP-PPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPPTYSPSPKVEYKSPPPPY 375 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 376 VYSSPPPP 383 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/68 (47%), Positives = 32/68 (47%), Gaps = 12/68 (17%) Frame = -3 Query: 173 YKPPTPPPYVYKSPP---------YVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPY 30 YK P PPPYVY SPP YK P PPPY PP Y P Y PPY Sbjct: 343 YKSP-PPPYVYSSPPPPTYSPSPKVEYKSP-PPPYVYSSPPPPTYSPSPKVEYKSPPPPY 400 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 401 VYSSPPPP 408 [55][TOP] >UniRef100_Q01943 Extensin (Class I) (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q01943_SOLLC Length = 181 Score = 66.6 bits (161), Expect(2) = 5e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 23 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 81 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 82 SPPPPYYYKSPPPP 95 Score = 24.3 bits (51), Expect(2) = 5e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 17 PSPPPPYYYKSP 28 Score = 66.2 bits (160), Expect(2) = 6e-11 Identities = 38/80 (47%), Positives = 38/80 (47%), Gaps = 22/80 (27%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK------PP 66 Y YK P PP PY YKS PPY YK PP P P PPY YK P Sbjct: 39 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 98 Query: 65 TPPPYVYESPPYVYKPPTPP 6 PPPY Y SPP K P PP Sbjct: 99 PPPPYYYSSPPPPKKSPPPP 118 Score = 24.3 bits (51), Expect(2) = 6e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 33 PSPPPPYYYKSP 44 Score = 66.6 bits (161), Expect(2) = 2e-10 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 7 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSP 65 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 66 SPPPPYYYKSPPPP 79 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 36/74 (48%), Positives = 36/74 (48%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY Y P PPP Sbjct: 55 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYSSP-PPPKK 113 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 114 SPPPPYYYKSPPPP 127 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 39/89 (43%), Positives = 40/89 (44%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYK-PPTPPPYESPPYVYK------PP 66 Y YK P PP PY Y SPP Y YK PP P P PPY YK P Sbjct: 87 YYYKSPPPPSPSPPPPYYYSSPPPPKKSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 146 Query: 65 TPPPYVYES---------PPYVYKPPTPP 6 PPPY Y+S PPY YK P PP Sbjct: 147 PPPPYYYKSSPPPSPSPPPPYYYKSPPPP 175 Score = 24.3 bits (51), Expect(2) = 2e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 49 PSPPPPYYYKSP 60 Score = 24.3 bits (51), Expect(2) = 2e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 65 PSPPPPYYYKSP 76 Score = 22.3 bits (46), Expect(2) = 2e-10 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y+SP Sbjct: 4 PPPYYYKSP 12 Score = 63.5 bits (153), Expect(2) = 4e-10 Identities = 35/72 (48%), Positives = 37/72 (51%), Gaps = 16/72 (22%) Frame = -3 Query: 170 KPPTPPPYVYKSPP---------YVYK-PPTPPPYESPPYVYK------PPTPPPYVYES 39 K PPPY YKSPP Y YK PP P P PPY YK P PPPY Y+S Sbjct: 112 KKSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSSPPPSPSPPPPYYYKS 171 Query: 38 PPYVYKPPTPPP 3 PP PP+P P Sbjct: 172 PP----PPSPSP 179 Score = 24.3 bits (51), Expect(2) = 4e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 81 PSPPPPYYYKSP 92 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/61 (54%), Positives = 33/61 (54%), Gaps = 10/61 (16%) Frame = -3 Query: 158 PPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 PPPY YKS PPY YK PP P P PPY YK P PPP PPY YK P P Sbjct: 4 PPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYKSPPP 62 Query: 8 P 6 P Sbjct: 63 P 63 Score = 62.8 bits (151), Expect = 1e-08 Identities = 37/75 (49%), Positives = 38/75 (50%), Gaps = 17/75 (22%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYKPPTPPPYES--PPYVYKPPTPPPY 51 Y YK P PP PY YKS PPY Y P PPP +S PPY YK P PPP Sbjct: 71 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYSSP-PPPKKSPPPPYYYKSP-PPPS 128 Query: 50 VYESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 129 PSPPPPYYYKSPPPP 143 [56][TOP] >UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis thaliana RepID=Q9XIL9_ARATH Length = 727 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/66 (53%), Positives = 40/66 (60%), Gaps = 9/66 (13%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYES-PPYVYKPP----TPPPYVYESPPYVY 24 V+ PP +PPP V+ PP VY PP PPP S PP V+ PP +PPP VY PP VY Sbjct: 592 VHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVY 651 Query: 23 KPPTPP 6 PP PP Sbjct: 652 SPPPPP 657 Score = 66.6 bits (161), Expect = 8e-10 Identities = 31/62 (50%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 V+ PP +PPP V+ PP VY PP PP + PP V+ PP P V+ PP VY PP P Sbjct: 563 VHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP---VHSPPPPVYSPPPP 619 Query: 8 PP 3 PP Sbjct: 620 PP 621 Score = 63.9 bits (154), Expect = 5e-09 Identities = 33/65 (50%), Positives = 37/65 (56%), Gaps = 7/65 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYES---PPYVYKPPTPPPYVYESPPYVYKPP--- 15 V+ PP P P PP VY PP PPP S PP VY PP PPP V+ PP V+ PP Sbjct: 498 VHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP-VHSPPPPVHSPPPPV 556 Query: 14 -TPPP 3 +PPP Sbjct: 557 HSPPP 561 Score = 63.9 bits (154), Expect = 5e-09 Identities = 33/64 (51%), Positives = 35/64 (54%), Gaps = 6/64 (9%) Frame = -3 Query: 176 VYKPPTPPPY------VYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 VY PP PPP V+ PP V+ PP PP Y PP VY PP PPP PP VY PP Sbjct: 613 VYSPPPPPPVHSPPPPVFSPPPPVHSPP-PPVYSPPPPVYSPP-PPPVKSPPPPPVYSPP 670 Query: 14 TPPP 3 PP Sbjct: 671 LLPP 674 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 11/71 (15%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPPPYES---PPYVYKPP----TPPPYVYESPPYVY 24 S ++ PP PP Y PP VY PP PPP S PP V+ PP +PPP V+ PP V+ Sbjct: 505 SPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVH 564 Query: 23 KPP----TPPP 3 PP +PPP Sbjct: 565 SPPPPVHSPPP 575 Score = 62.4 bits (150), Expect = 2e-08 Identities = 33/62 (53%), Positives = 38/62 (61%), Gaps = 5/62 (8%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYES-PPYVYKPP----TPPPYVYESPPYVYKPPT 12 VY PP PPP V+ PP V+ PP PP S PP V+ PP +PPP V+ PP VY PP Sbjct: 533 VYSPPPPPP-VHSPPPPVHSPP--PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP 589 Query: 11 PP 6 PP Sbjct: 590 PP 591 Score = 55.8 bits (133), Expect = 1e-06 Identities = 34/93 (36%), Positives = 41/93 (44%), Gaps = 31/93 (33%) Frame = -3 Query: 188 HHSYVYKPP---TPP--PYVYKSPPYVYKP-----------------------PTPPPYE 93 HH V+ PP +PP P V+ +P V+KP P PPP Sbjct: 440 HHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVH 499 Query: 92 SPP---YVYKPPTPPPYVYESPPYVYKPPTPPP 3 SPP ++ PP PP Y PP VY PP PPP Sbjct: 500 SPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/64 (50%), Positives = 37/64 (57%), Gaps = 6/64 (9%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPPTPPPYVYESPPYVYKPP 15 V+ PP +PPP VY PP VY PP PPP +S PP VY PP PP + SPP Sbjct: 629 VFSPPPPVHSPPPPVYSPPPPVYSPP-PPPVKSPPPPPVYSPPLLPPKM-SSPPTQTPVN 686 Query: 14 TPPP 3 +PPP Sbjct: 687 SPPP 690 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/57 (45%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYE--SPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PP + P ++ PP PP Y PP VY PP PPP VY PP PPP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP--------VYSPPPPPP 541 [57][TOP] >UniRef100_B9GWA6 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GWA6_POPTR Length = 202 Score = 69.3 bits (168), Expect(2) = 6e-11 Identities = 39/75 (52%), Positives = 40/75 (53%), Gaps = 16/75 (21%) Frame = -3 Query: 182 SYVYKPPTPP------PYVYKSPP---------YVYK-PPTPPPYESPPYVYKPPTPPPY 51 SYVYK P PP PY Y SPP YVYK PP P P SPPY Y P PPP Sbjct: 72 SYVYKSPPPPSPSPPPPYHYSSPPPPKKSPPPPYVYKSPPPPSPSLSPPYHYSSP-PPPK 130 Query: 50 VYESPPYVYKPPTPP 6 PPY+YK P PP Sbjct: 131 KSPPPPYIYKSPPPP 145 Score = 21.2 bits (43), Expect(2) = 6e-11 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PP YVY+SP Sbjct: 70 PPSYVYKSP 78 Score = 63.9 bits (154), Expect(2) = 3e-10 Identities = 38/89 (42%), Positives = 42/89 (47%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYK-PPTPPPYESPPYVYKPPTPPP-- 54 YVYK P PP PY Y SPP Y+YK PP P P PPY Y P+PP Sbjct: 105 YVYKSPPPPSPSLSPPYHYSSPPPPKKSPPPPYIYKSPPPPSPSPPPPYHYSSPSPPKKS 164 Query: 53 ----YVYES---------PPYVYKPPTPP 6 Y+Y+S PPY YK P PP Sbjct: 165 PPPLYIYKSPPPPSPSPPPPYYYKSPPPP 193 Score = 24.3 bits (51), Expect(2) = 3e-10 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY+SP Sbjct: 102 PPPYVYKSP 110 Score = 66.2 bits (160), Expect = 1e-09 Identities = 38/76 (50%), Positives = 38/76 (50%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----------YVYKPPTPP-PYESPPYVYKPPTPPP 54 YVYK P PP PY Y SPP YVYK P PP P PPY Y P PPP Sbjct: 39 YVYKSPPPPSPSPPPPYHYSSPPPPPLKKSPPPSYVYKSPPPPSPSPPPPYHYSSP-PPP 97 Query: 53 YVYESPPYVYKPPTPP 6 PPYVYK P PP Sbjct: 98 KKSPPPPYVYKSPPPP 113 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/66 (51%), Positives = 37/66 (56%), Gaps = 11/66 (16%) Frame = -3 Query: 170 KPPTPPPYVYK---------SPPYVYKPPTPPPYES--PPYVYKPPTPPPYVYESPPYVY 24 K PPPYVYK SPPY Y P PPP +S PPY+YK P PPP PPY Y Sbjct: 98 KKSPPPPYVYKSPPPPSPSLSPPYHYSSP-PPPKKSPPPPYIYKSP-PPPSPSPPPPYHY 155 Query: 23 KPPTPP 6 P+PP Sbjct: 156 SSPSPP 161 Score = 52.8 bits (125), Expect(2) = 7e-07 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 16/66 (24%) Frame = -3 Query: 179 YVYKPPTPP------PYVY-------KSPP--YVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y+YK P PP PY Y KSPP Y+YK PP P P PPY YK P PPP Sbjct: 137 YIYKSPPPPSPSPPPPYHYSSPSPPKKSPPPLYIYKSPPPPSPSPPPPYYYKSP-PPPTH 195 Query: 47 YESPPY 30 PPY Sbjct: 196 SPPPPY 201 Score = 23.9 bits (50), Expect(2) = 7e-07 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY+Y+SP Sbjct: 134 PPPYIYKSP 142 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -3 Query: 155 PPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP-YVYKPPTPP 6 P YVYKSPP PP+P P PPY Y P PPP PP YVYK P PP Sbjct: 37 PRYVYKSPP----PPSPSP--PPPYHYSSPPPPPLKKSPPPSYVYKSPPPP 81 [58][TOP] >UniRef100_Q01942 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01942_SOLLC Length = 132 Score = 66.2 bits (160), Expect(2) = 6e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYV 48 Y YK P PP PY YKS PPY YK PP P P PPY YK P PPP Sbjct: 10 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPDP 68 Query: 47 YESPPYVYKPPTPP 6 PPY YK P PP Sbjct: 69 SPPPPYYYKSPPPP 82 Score = 24.3 bits (51), Expect(2) = 6e-11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 4 PSPPPPYYYKSP 15 Score = 66.2 bits (160), Expect = 1e-09 Identities = 34/64 (53%), Positives = 34/64 (53%), Gaps = 10/64 (15%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 P PPPY YKS PPY YK PP P P PPY YK P PPP PPY YK Sbjct: 4 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYKS 62 Query: 17 PTPP 6 P PP Sbjct: 63 PPPP 66 Score = 58.2 bits (139), Expect(2) = 1e-08 Identities = 33/70 (47%), Positives = 34/70 (48%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYK-----PPTPPPYVYESPP 33 Y YK P PP PY YKSPP PP P P PPY YK P+PPP PP Sbjct: 42 YYYKSPPPPSPSPPPPYYYKSPP----PPDPSP--PPPYYYKSPPPPSPSPPPPSPSPPP 95 Query: 32 YVYKPPTPPP 3 Y P PPP Sbjct: 96 PTYSSPPPPP 105 Score = 24.3 bits (51), Expect(2) = 1e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 20 PSPPPPYYYKSP 31 Score = 56.6 bits (135), Expect(2) = 4e-08 Identities = 31/70 (44%), Positives = 33/70 (47%), Gaps = 12/70 (17%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYES---PPYV 27 Y YK P PP PY YKSPP P PP PP Y P PPP YE+ PP + Sbjct: 58 YYYKSPPPPDPSPPPPYYYKSPPPPSPSPPPPSPSPPPPTYSSPPPPPPFYENIPLPPVI 117 Query: 26 ---YKPPTPP 6 Y P PP Sbjct: 118 GVSYASPPPP 127 Score = 24.3 bits (51), Expect(2) = 4e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 36 PSPPPPYYYKSP 47 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PP+P P PPY YK PP P P PPY YK P PPP PPY YK P PP Sbjct: 1 PPSPSP----PPPYYYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYKSPPPP 50 [59][TOP] >UniRef100_Q9FG06 Genomic DNA, chromosome 5, BAC clone:F15M7 n=1 Tax=Arabidopsis thaliana RepID=Q9FG06_ARATH Length = 689 Score = 66.2 bits (160), Expect(2) = 7e-11 Identities = 34/65 (52%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P VY PPPYVY SPP Y Sbjct: 282 YVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 341 Query: 23 KPPTP 9 P+P Sbjct: 342 YSPSP 346 Score = 23.9 bits (50), Expect(2) = 7e-11 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 254 PPPYVYSSP 262 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 407 YVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 465 Query: 26 YKPPTP 9 Y P+P Sbjct: 466 YYSPSP 471 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 379 PPPYVYSSP 387 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPY------VYKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 307 YVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 365 Query: 26 YKPPTP 9 Y P+P Sbjct: 366 YYSPSP 371 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 457 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYSSPPPP 515 Query: 26 YKPPTP 9 Y P+P Sbjct: 516 YHSPSP 521 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P V TPPPYVY PP Y Sbjct: 557 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLPY 616 Query: 23 KPPTP 9 P+P Sbjct: 617 YSPSP 621 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 279 PPPYVYNSP 287 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 429 PPPYVYSSP 437 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 554 PPPYVYSSP 562 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 157 YVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSP-PPPYVYSSPPPP 215 Query: 26 YKPPTP 9 Y P+P Sbjct: 216 YYSPSP 221 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 182 YVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 240 Query: 26 YKPPTP 9 Y P+P Sbjct: 241 YYSPSP 246 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 332 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPQ 390 Query: 26 YKPPTP 9 Y P+P Sbjct: 391 YYSPSP 396 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 432 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYSSPPPP 490 Query: 26 YKPPTP 9 Y P+P Sbjct: 491 YYSPSP 496 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 154 PPPYVYSSP 162 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 179 PPPYVYNSP 187 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 304 PPPYVYSSP 312 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 404 PPPYVYSSP 412 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 207 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 265 Query: 26 YKPPTP 9 Y P+P Sbjct: 266 YFSPSP 271 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 37/67 (55%), Positives = 38/67 (56%), Gaps = 10/67 (14%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPY 30 YVY P PPPY YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 257 YVYSSP-PPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSP-PPPYVYSSPPP 314 Query: 29 VYKPPTP 9 Y P+P Sbjct: 315 PYYSPSP 321 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 204 PPPYVYSSP 212 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 229 PPPYVYNSP 237 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 36/67 (53%), Positives = 39/67 (58%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPYV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+S PPYV Sbjct: 375 YKSP-PPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYV 433 Query: 26 YKPPTPP 6 Y P PP Sbjct: 434 YSSPPPP 440 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 35/66 (53%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTP------PPYVYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P P P YKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 382 YVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSP-PPPYVYSSPPPP 440 Query: 26 YKPPTP 9 Y P+P Sbjct: 441 YYSPSP 446 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 329 PPPYVYSSP 337 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 354 PPPYVYSSP 362 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP YK P PP Sbjct: 475 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSP-PPPYHSPSPKVNYKSPPPP 531 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 36/74 (48%), Positives = 37/74 (50%), Gaps = 19/74 (25%) Frame = -3 Query: 173 YKPPTPPPYVYKS------------------PPYVYKPPTPPPYESPPYV-YKPPTPPPY 51 YK P PPPYVY S PPYVY P PP Y P V YK P PPPY Sbjct: 525 YKSP-PPPYVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSP-PPPY 582 Query: 50 VYESPPYVYKPPTP 9 VY SPP Y P+P Sbjct: 583 VYSSPPPPYYSPSP 596 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 454 PPPYVYSSP 462 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 479 PPPYVYSSP 487 Score = 60.1 bits (144), Expect(2) = 5e-09 Identities = 33/59 (55%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P P PYVY SPP +Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 625 YKSP-PLPYVYSSPPPLYYSPSPKVHYKSPPPPYVYNSP-PPPYYSPSPKVTYKSPPPP 681 Score = 23.9 bits (50), Expect(2) = 5e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 579 PPPYVYSSP 587 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 132 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYVYNSPPPP 190 Query: 26 YKPPTP 9 Y P+P Sbjct: 191 YYSPSP 196 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY---ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y PPYVY P PPPY SP YK P PP Sbjct: 300 YKSP-PPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPP 356 Score = 62.8 bits (151), Expect = 1e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 275 YKSP-PPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSP-PPPYYSPSPKVYYKSPPPP 331 Score = 62.4 bits (150), Expect = 2e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P PPPY SP YK P PP Sbjct: 225 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPYFSPSPKVEYKSPPPP 281 Score = 62.0 bits (149), Expect = 2e-08 Identities = 39/67 (58%), Positives = 40/67 (59%), Gaps = 10/67 (14%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESP-PYV-YKPPTPPPYVYESPPY 30 YVY P PP Y YKSPP YVY P PPPY SP P V YK P PPPYVY SPP Sbjct: 232 YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPYFSPSPKVEYKSP-PPPYVYNSPPP 289 Query: 29 VYKPPTP 9 Y P+P Sbjct: 290 PYYSPSP 296 Score = 62.0 bits (149), Expect = 2e-08 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 325 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPP 381 Score = 57.4 bits (137), Expect(2) = 3e-08 Identities = 34/60 (56%), Positives = 36/60 (60%), Gaps = 3/60 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYVYKPPTPPP 3 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y P V TPPP Sbjct: 550 YKSP-PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSP-PPPY-YSPSPMVDYKSTPPP 606 Score = 23.9 bits (50), Expect(2) = 3e-08 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 504 PPPYVYSSP 512 Score = 61.2 bits (147), Expect = 3e-08 Identities = 35/80 (43%), Positives = 39/80 (48%), Gaps = 10/80 (12%) Frame = -3 Query: 218 HQHL-PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTP----- 60 H+H P + YVY P PP Y SP YK P PP Y SPP Y P+P Sbjct: 67 HEHKSPKYAPHPKPYVYISPPPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYK 126 Query: 59 ---PPYVYESPPYVYKPPTP 9 PPYVY SPP Y P+P Sbjct: 127 SPPPPYVYSSPPPPYYSPSP 146 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/66 (53%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P P Y SP YK P PPPYVY SPP Sbjct: 357 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSP-PPPYVYSSPPPP 415 Query: 26 YKPPTP 9 Y P+P Sbjct: 416 YYSPSP 421 Score = 60.8 bits (146), Expect = 4e-08 Identities = 42/86 (48%), Positives = 42/86 (48%), Gaps = 28/86 (32%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESP-PYV-YKPPTPPPYVYES--- 39 YVY P PP Y YKSPP YVY P PPPY SP P V YK P PPPYVY S Sbjct: 482 YVYSSPPPPYYSPSPKVEYKSPPPPYVYSSP-PPPYHSPSPKVNYKSP-PPPYVYSSHPP 539 Query: 38 ---------------PPYVYKPPTPP 6 PPYVY P PP Sbjct: 540 PYYSPSPKVNYKSPPPPYVYSSPPPP 565 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/65 (53%), Positives = 36/65 (55%), Gaps = 9/65 (13%) Frame = -3 Query: 176 VYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYVY 24 VY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Y Sbjct: 108 VYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPPY 166 Query: 23 KPPTP 9 P+P Sbjct: 167 YSPSP 171 Score = 58.9 bits (141), Expect(2) = 7e-08 Identities = 32/69 (46%), Positives = 36/69 (52%), Gaps = 18/69 (26%) Frame = -3 Query: 161 TPPPYVYKSPPYVYKPPTP------PP----YESPPYVYKPPTP--------PPYVYESP 36 TPPPYVY PP Y P+P PP Y SPP +Y P+P PPYVY SP Sbjct: 603 TPPPYVYSFPPLPYYSPSPKVDYKSPPLPYVYSSPPPLYYSPSPKVHYKSPPPPYVYNSP 662 Query: 35 PYVYKPPTP 9 P Y P+P Sbjct: 663 PPPYYSPSP 671 Score = 21.2 bits (43), Expect(2) = 7e-08 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 210 PPPYVYESPLICIQAT 163 PPPY SP++ ++T Sbjct: 588 PPPYYSPSPMVDYKST 603 Score = 59.7 bits (143), Expect = 1e-07 Identities = 36/74 (48%), Positives = 38/74 (51%), Gaps = 19/74 (25%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP--------PPY----ESPPYV-------YKPPTPPPY 51 YK P PPPYVY SPP Y P+P PPY PPY YK P PPPY Sbjct: 500 YKSP-PPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSP-PPPY 557 Query: 50 VYESPPYVYKPPTP 9 VY SPP Y P+P Sbjct: 558 VYSSPPPPYYSPSP 571 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 150 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYV 208 Query: 20 PPTPPP 3 +PPP Sbjct: 209 YSSPPP 214 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 200 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV 258 Query: 20 PPTPPP 3 +PPP Sbjct: 259 YSSPPP 264 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 425 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV 483 Query: 20 PPTPPP 3 +PPP Sbjct: 484 YSSPPP 489 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 450 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV 508 Query: 20 PPTPPP 3 +PPP Sbjct: 509 YSSPPP 514 Score = 57.8 bits (138), Expect(2) = 1e-07 Identities = 34/73 (46%), Positives = 37/73 (50%), Gaps = 18/73 (24%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPP--------TPPPY--ESPPYVYKPPTPP--------PYV 48 YK P PPPYVY SPP Y P TPPPY PP Y P+P PYV Sbjct: 575 YKSP-PPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPPLPYYSPSPKVDYKSPPLPYV 633 Query: 47 YESPPYVYKPPTP 9 Y SPP +Y P+P Sbjct: 634 YSSPPPLYYSPSP 646 Score = 21.2 bits (43), Expect(2) = 1e-07 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 210 PPPYVYES 187 PPPYVY S Sbjct: 529 PPPYVYSS 536 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 250 YKSP-PPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYV 308 Query: 20 PPTPPP 3 +PPP Sbjct: 309 YSSPPP 314 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/67 (47%), Positives = 35/67 (52%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYE----------SPPYV 27 YK P PPPYVY SPP Y P+P Y+SPP Y +PPP Y PPYV Sbjct: 350 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYV 408 Query: 26 YKPPTPP 6 Y P PP Sbjct: 409 YSSPPPP 415 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 125 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPY-YSPSPKVEYKSPPPP 181 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 182 YVYNSPPPP 190 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 175 YKSP-PPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 231 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 232 YVYNSPPPP 240 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 400 YKSP-PPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 456 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 457 YVYSSPPPP 465 Score = 53.9 bits (128), Expect(2) = 4e-07 Identities = 31/59 (52%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = -3 Query: 179 YVYKPPTP------PPYVYKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPY 30 YVY P P P YKSPP YVY P PP Y SP YK P PPPYVY++P Y Sbjct: 632 YVYSSPPPLYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVTYKSP-PPPYVYKAPYY 689 Score = 23.5 bits (49), Expect(2) = 4e-07 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 213 TPPPYVYESP 184 TPPPYVY P Sbjct: 603 TPPPYVYSFP 612 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/66 (50%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPP VY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 100 YKSP-PPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 158 Query: 20 PPTPPP 3 +PPP Sbjct: 159 YSSPPP 164 [60][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 68.6 bits (166), Expect(2) = 8e-11 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPP-YVYESPPYVYKPPTPP 6 +Y PP PPP PP Y PP PPP PP Y PP PPP Y PP Y PP PP Sbjct: 306 AYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPP 365 Query: 5 P 3 P Sbjct: 366 P 366 Score = 21.6 bits (44), Expect(2) = 8e-11 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 291 PPPPPPPAYSPP 302 Score = 63.9 bits (154), Expect = 5e-09 Identities = 31/59 (52%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 176 VYKPPTPPP-YVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 VY PP PPP Y PP Y PP PP Y +PP PP PPP PP Y PP PPP Sbjct: 87 VYAPPPPPPAYAPPPPPPAYAPPPPPAY-APPPPPPPPPPPPSYGPPPPPAYGPPPPPP 144 Score = 62.8 bits (151), Expect(2) = 6e-09 Identities = 31/65 (47%), Positives = 31/65 (47%), Gaps = 8/65 (12%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP--------YVYKP 18 Y PP PPP PP Y PP PPP PP Y PP PP Y PP Y Y P Sbjct: 229 YGPPPPPPP--PPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGP 286 Query: 17 PTPPP 3 P PPP Sbjct: 287 PPPPP 291 Score = 20.8 bits (42), Expect(2) = 6e-09 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 190 PPPPPPPAYGPP 201 Score = 62.0 bits (149), Expect(2) = 8e-09 Identities = 30/60 (50%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYES---PPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PPP PP Y PP PPP + PP Y PP PPP +P VY PP PPP Sbjct: 326 YGPPAPPP--PPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVYGPPAPPP 383 Score = 21.2 bits (43), Expect(2) = 8e-09 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 310 PPPPPPPAYAPP 321 Score = 62.0 bits (149), Expect(2) = 1e-08 Identities = 28/54 (51%), Positives = 28/54 (51%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PP PPP PP Y PP PPP PP Y PP PPP PP Y PP PP Sbjct: 214 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPP--PPPPPAAYGPPPPP 265 Score = 20.8 bits (42), Expect(2) = 1e-08 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 167 PPPPPPPAYGPP 178 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/57 (50%), Positives = 29/57 (50%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PPP PP Y PP PPP PP Y PP PP Y PP PP PPP Sbjct: 97 YAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPP----PPPPPP 149 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 29/61 (47%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPY------VYESPPYVYKPPTPP 6 PP PPP PP Y PP PPP PP Y PP PP Y PP Y PP PP Sbjct: 191 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPP 250 Query: 5 P 3 P Sbjct: 251 P 251 Score = 60.8 bits (146), Expect(2) = 1e-08 Identities = 29/60 (48%), Positives = 30/60 (50%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y Y PP PPP PP Y PP PP Y P PP PPP PP Y PP PPP Sbjct: 281 AYAYGPPPPPPP--PPPPPAYSPPPPPAYGPP-----PPPPPPAYAPPPPPAYGPPAPPP 333 Score = 21.6 bits (44), Expect(2) = 1e-08 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 236 PPPPPPPAYSPP 247 Score = 20.8 bits (42), Expect(2) = 1e-08 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 144 PPPPPPPAYGPP 155 Score = 60.5 bits (145), Expect(2) = 3e-08 Identities = 31/64 (48%), Positives = 31/64 (48%), Gaps = 9/64 (14%) Frame = -3 Query: 167 PPTPPPYVY-KSPPYVYKPPTPPPYESPPYVYK-------PPTPPPYVYE-SPPYVYKPP 15 PP PPP Y PP Y PP PPP PP Y PP PPP Y PP Y PP Sbjct: 251 PPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPP 310 Query: 14 TPPP 3 PPP Sbjct: 311 PPPP 314 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 213 PPPPPPPAYGPP 224 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP Y PP PPP PP Y PP PP Y PP PP PPP Sbjct: 122 PPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPP----PPPPPP 172 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP Y PP PPP PP Y PP PP Y PP PP PPP Sbjct: 145 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPP----PPPPPP 195 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/55 (50%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP Y PP PPP PP Y PP PP Y PP PP PPP Sbjct: 168 PPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPP----PPPPPP 218 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/58 (48%), Positives = 28/58 (48%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 V P P P Y PP VY PP PPP Y PP PPP PP Y PP PPP Sbjct: 70 VLVPGKPAPPAYAPPPPVYAPPPPPP------AYAPPPPPPAYAPPPPPAYAPPPPPP 121 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/57 (50%), Positives = 29/57 (50%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PPP PP Y PP PP Y PP PP PPP PP Y PP PPP Sbjct: 137 YGPPPPPPP--PPPPPAYGPPPPPAY-GPPPPPPPPPPPPAYGPPPPPAYGPPPPPP 190 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/57 (50%), Positives = 29/57 (50%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PPP PP Y PP PP Y PP PP PPP PP Y PP PPP Sbjct: 160 YGPPPPPPP--PPPPPAYGPPPPPAY-GPPPPPPPPPPPPAYGPPPPPAYGPPPPPP 213 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/57 (50%), Positives = 29/57 (50%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PPP PP Y PP PP Y PP PP PPP PP Y PP PPP Sbjct: 183 YGPPPPPPP--PPPPPAYGPPPPPAY-GPPPPPPPPPPPPAYGPPPPPAYGPPPPPP 236 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/57 (50%), Positives = 29/57 (50%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PPP PP Y PP PP Y PP PP PPP PP Y PP PPP Sbjct: 114 YAPPPPPPP--PPPPPSYGPPPPPAY-GPPPPPPPPPPPPAYGPPPPPAYGPPPPPP 167 Score = 56.2 bits (134), Expect(2) = 4e-07 Identities = 30/66 (45%), Positives = 31/66 (46%), Gaps = 11/66 (16%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYES----PPYVYKPPTPP-----P--YVYESPPYVYK 21 PP PPP PP Y PP PPP + PP Y PP PP P Y PP Y Sbjct: 292 PPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYA 351 Query: 20 PPTPPP 3 PP PPP Sbjct: 352 PPPPPP 357 Score = 21.2 bits (43), Expect(2) = 4e-07 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 251 PPPPPPAAYGPP 262 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/57 (49%), Positives = 28/57 (49%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PPP PP Y PP PP Y PP PP P Y Y PP PP PPP Sbjct: 244 YSPPPPPPP--PPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPP----PPPPPP 294 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/57 (49%), Positives = 28/57 (49%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP Y PP PP PPP SPP PP PP PP Y PP PPP Sbjct: 221 YGPPPPPAYGPPPPP---PPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPP 274 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/58 (48%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPP-YVYESPPYVYKPPTPP 6 +PP PPP V P P PP Y PP VY PP PPP Y PP Y PP PP Sbjct: 55 QPPPPPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAPPPPPPAYAPPPPPPAYAPPPPP 112 [61][TOP] >UniRef100_UPI000198347E PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vinifera RepID=UPI000198347E Length = 207 Score = 69.7 bits (169), Expect = 9e-11 Identities = 38/69 (55%), Positives = 39/69 (56%), Gaps = 12/69 (17%) Frame = -3 Query: 179 YVYKPPTP---------PPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP---PPYVYESP 36 Y +KPP P PP YK P VYKPP PP E PP YKPPTP PP V E P Sbjct: 30 YEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPSPPVEKPPPEYKPPTPVYRPPPV-EKP 88 Query: 35 PYVYKPPTP 9 P YKPPTP Sbjct: 89 PPEYKPPTP 97 Score = 69.3 bits (168), Expect = 1e-10 Identities = 40/67 (59%), Positives = 41/67 (61%), Gaps = 9/67 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT----PPPYESPPYVYKPPTP---PPYVYESPPYVYKP 18 VYKPP PP + PP YKPPT PPP E PP YKPPTP PP V E PP YKP Sbjct: 57 VYKPPPSPPV--EKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVYKPPPV-EKPPPEYKP 113 Query: 17 PTP--PP 3 PTP PP Sbjct: 114 PTPVKPP 120 Score = 63.2 bits (152), Expect = 9e-09 Identities = 40/78 (51%), Positives = 40/78 (51%), Gaps = 21/78 (26%) Frame = -3 Query: 173 YKPPTP---PPYVYKSPPYVYKPPTP----PPYESPPYVYKPPTP--------------P 57 YKPPTP PP V K PP YKPPTP PP E PP YKPPTP P Sbjct: 73 YKPPTPVYRPPPVEKPPPE-YKPPTPVYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLP 131 Query: 56 PYVYESPPYVYKPPTPPP 3 P V PP KPPT PP Sbjct: 132 PRVVRPPP-TPKPPTLPP 148 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/54 (55%), Positives = 32/54 (59%), Gaps = 4/54 (7%) Frame = -3 Query: 158 PPPYVYKSPPYVYKPPT----PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 PPPY +K P VYK P PP Y+ P VYKPP PP E PP YKPPTP Sbjct: 27 PPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPSPPV--EKPPPEYKPPTP 78 [62][TOP] >UniRef100_O65760 Extensin (Fragment) n=1 Tax=Cicer arietinum RepID=O65760_CICAR Length = 192 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 36/81 (44%), Positives = 39/81 (48%), Gaps = 22/81 (27%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP----------YVYKPPTPPPYESPPYVYKPPTPP--- 57 Y YK P PP PY YKSPP Y + PP P P PPY YK P PP Sbjct: 20 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYKSPPPPSPS 79 Query: 56 ---PYVYESPPYVYKPPTPPP 3 PY Y+SPP PP+P P Sbjct: 80 PPPPYYYKSPP----PPSPSP 96 Score = 24.3 bits (51), Expect(2) = 1e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 14 PSPPPPYYYKSP 25 Score = 63.9 bits (154), Expect(2) = 3e-10 Identities = 39/89 (43%), Positives = 40/89 (44%), Gaps = 31/89 (34%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYK-PPTPPPYESPPYVYK------PP 66 Y YK P PP PY Y SPP Y YK PP P P PPY YK P Sbjct: 36 YYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 95 Query: 65 TPPPYVYESP---------PYVYKPPTPP 6 PPPY Y+SP PY YK P PP Sbjct: 96 PPPPYHYQSPPPPSPTPRTPYYYKSPPPP 124 Score = 24.3 bits (51), Expect(2) = 3e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 30 PSPPPPYYYKSP 41 Score = 64.3 bits (155), Expect(2) = 1e-09 Identities = 36/79 (45%), Positives = 37/79 (46%), Gaps = 25/79 (31%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVY------KPPTPPPYVYES- 39 P PPPY YKS PPY YK PP P P PPY Y P PPPY Y+S Sbjct: 14 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYKSP 73 Query: 38 --------PPYVYKPPTPP 6 PPY YK P PP Sbjct: 74 PPPSPSPPPPYYYKSPPPP 92 Score = 21.9 bits (45), Expect(2) = 1e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 1 PPPYYYHSP 9 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 40/90 (44%), Positives = 42/90 (46%), Gaps = 32/90 (35%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYESPP----YVYKPP--- 66 Y YK P PP PY Y+SPP Y YK P PPP SPP YV PP Sbjct: 84 YYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYYYKSP-PPPTSSPPPPYHYVSPPPPIK 142 Query: 65 -TPPPYVYESPP---------YVYKPPTPP 6 PPPY Y SPP Y+YK P PP Sbjct: 143 SPPPPYHYTSPPPPSPSPAPTYIYKSPPPP 172 Score = 24.3 bits (51), Expect(2) = 2e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 62 PSPPPPYYYKSP 73 Score = 60.8 bits (146), Expect(2) = 3e-09 Identities = 38/80 (47%), Positives = 39/80 (48%), Gaps = 22/80 (27%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKS---------PPYVYK-PPTPPPYESPPYVYK---PPT-- 63 Y YK P PP PY YKS PPY Y+ PP P P PY YK PPT Sbjct: 68 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYHYQSPPPPSPTPRTPYYYKSPPPPTSS 127 Query: 62 -PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP K P PP Sbjct: 128 PPPPYHYVSPPPPIKSPPPP 147 Score = 23.9 bits (50), Expect(2) = 3e-09 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y SP Sbjct: 46 PSPPPPYYYHSP 57 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/74 (47%), Positives = 35/74 (47%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYK------PPTPPPYVYES------ 39 Y Y P PPP PPY YK PP P P PPY YK P PPPY Y S Sbjct: 4 YYYHSP-PPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSP 62 Query: 38 ---PPYVYKPPTPP 6 PPY YK P PP Sbjct: 63 SPPPPYYYKSPPPP 76 Score = 57.8 bits (138), Expect(2) = 2e-08 Identities = 35/68 (51%), Positives = 38/68 (55%), Gaps = 10/68 (14%) Frame = -3 Query: 179 YVYK---PPT---PPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTP---PPYVYESPPY 30 Y YK PPT PPPY Y SPP K P PP Y SPP PP+P P Y+Y+SPP Sbjct: 116 YYYKSPPPPTSSPPPPYHYVSPPPPIKSPPPPYHYTSPP----PPSPSPAPTYIYKSPPP 171 Query: 29 VYKPPTPP 6 K P PP Sbjct: 172 PVKSPPPP 179 Score = 24.3 bits (51), Expect(2) = 2e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 78 PSPPPPYYYKSP 89 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/58 (51%), Positives = 33/58 (56%), Gaps = 6/58 (10%) Frame = -3 Query: 158 PPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPP------PYVYESPPYVYKPPTPPP 3 PPPY Y SPP PP+P P PPY YK P PP PY Y+SPP PP+P P Sbjct: 1 PPPYYYHSPP----PPSPSP--PPPYYYKSPPPPSPSPPPPYYYKSPP----PPSPSP 48 Score = 50.4 bits (119), Expect(2) = 3e-06 Identities = 29/64 (45%), Positives = 33/64 (51%), Gaps = 13/64 (20%) Frame = -3 Query: 185 HSYVYKPPT----PPPYVYKSPP---------YVYKPPTPPPYESPPYVYKPPTPPPYVY 45 + YV PP PPPY Y SPP Y+YK P PPP +SPP PP Y+Y Sbjct: 132 YHYVSPPPPIKSPPPPYHYTSPPPPSPSPAPTYIYKSP-PPPVKSPP-------PPVYIY 183 Query: 44 ESPP 33 SPP Sbjct: 184 ASPP 187 Score = 23.9 bits (50), Expect(2) = 3e-06 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 94 PSPPPPYHYQSP 105 [63][TOP] >UniRef100_Q9SQF5 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=Q9SQF5_SOYBN Length = 102 Score = 69.3 bits (168), Expect = 1e-10 Identities = 33/60 (55%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYES-PPYVYKPPTPPP 3 Y Y P PP + YKSPP YK P PPP PY Y P PP Y Y+S PP VYK +PPP Sbjct: 7 YKYPSPPPPVHKYKSPPPPYKYPFPPPPPKKPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 66 [64][TOP] >UniRef100_Q38913 Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=EXTN1_ARATH Length = 373 Score = 69.3 bits (168), Expect = 1e-10 Identities = 37/58 (63%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP Y SPP VYK P PP + SPP VYK P PPP Y SPP VYK P PP Sbjct: 158 VYKSP-PPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKYYSPPPVYKSPPPP 213 Score = 69.3 bits (168), Expect = 1e-10 Identities = 37/58 (63%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP Y SPP VYK P PP + SPP VYK P PPP Y SPP VYK P PP Sbjct: 190 VYKSP-PPPVKYYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKYYSPPPVYKSPPPP 245 Score = 67.4 bits (163), Expect(2) = 3e-10 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP Y SPP VYK P PP Sbjct: 126 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKYYSPPPVYKSPPPP 181 Score = 20.8 bits (42), Expect(2) = 3e-10 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 89 SPPPPVYKSP 98 Score = 67.4 bits (163), Expect = 5e-10 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP Y SPP VYK P PP Sbjct: 38 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKYYSPPPVYKSPPPP 93 Score = 67.4 bits (163), Expect = 5e-10 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP Y SPP VYK P PPP + SPP VYK P PP Sbjct: 142 VYKSP-PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 197 Score = 67.4 bits (163), Expect = 5e-10 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP Y SPP VYK P PPP + SPP VYK P PP Sbjct: 174 VYKSP-PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 229 Score = 67.0 bits (162), Expect = 6e-10 Identities = 37/66 (56%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYE---------SPPYVYKPPTPPPYVYESPPYVY 24 VYK P PPP Y SPP VYK P PP Y+ SPP VYK P PPP + SPP VY Sbjct: 70 VYKSP-PPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVY 127 Query: 23 KPPTPP 6 K P PP Sbjct: 128 KSPPPP 133 Score = 66.2 bits (160), Expect = 1e-09 Identities = 35/58 (60%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP Y SPP VYK P PPP Y PP VY P PP Sbjct: 206 VYKSP-PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSP-PPPVHYSPPPVVYHSPPPP 261 Score = 65.5 bits (158), Expect = 2e-09 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 94 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 149 Score = 65.5 bits (158), Expect = 2e-09 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 110 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 165 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/57 (56%), Positives = 33/57 (57%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP Y SPP VYK P PP + SPP V PPP Y PP VY P PP Sbjct: 222 VYKSP-PPPVKYYSPPPVYKSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPP 277 Score = 64.7 bits (156), Expect = 3e-09 Identities = 34/60 (56%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 +Y Y P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 20 NYFYSSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 77 Score = 64.7 bits (156), Expect = 3e-09 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 8/65 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPP-------TPPPYVYESPPYVYK 21 VYK P PPP + SPP VYK P PP Y SPP VYK P PPP + SPP VYK Sbjct: 54 VYKSP-PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYK 112 Query: 20 PPTPP 6 P PP Sbjct: 113 SPPPP 117 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 7/59 (11%) Frame = -3 Query: 161 TPPPYVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPPYVYESP--PYVYKPPTPP 6 +PPP VY SPP Y YK P PP + SPP VY P PP + Y P PY+YK P PP Sbjct: 313 SPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPTVYHSPPPPVHHYSPPHQPYLYKSPPPP 371 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/57 (52%), Positives = 31/57 (54%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP Y PP VY P PP + SPP V PPP Y PP VY P PP Sbjct: 238 VYKSP-PPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPP 293 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/57 (50%), Positives = 30/57 (52%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VY P PPP Y PP VY P PP + SPP V PPP Y PP VY P PP Sbjct: 254 VYHSP-PPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPP 309 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/57 (50%), Positives = 30/57 (52%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VY P PPP Y PP VY P PP + SPP V PPP Y PP VY P PP Sbjct: 270 VYHSP-PPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPP 325 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/68 (47%), Positives = 34/68 (50%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPP----------TPPPYVYESPPY 30 VY P PPP Y PP VY P PP Y PP VY P +PPP V+ SPP Sbjct: 286 VYHSP-PPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPT 344 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 345 VYHSPPPP 352 [65][TOP] >UniRef100_Q39865 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max RepID=Q39865_SOYBN Length = 169 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 Y YK P PPP PPY YK P PP P PPY YK P PPP Y PPY Y P PP Sbjct: 68 YYYKSP-PPPSPSPPPPYYYKSPPPPSPTSHPPYYYKSP-PPPTSYPPPPYHYVSPPPP 124 Score = 23.9 bits (50), Expect(2) = 1e-10 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y SP Sbjct: 30 PSPPPPYYYHSP 41 Score = 64.3 bits (155), Expect(2) = 2e-10 Identities = 33/64 (51%), Positives = 33/64 (51%), Gaps = 10/64 (15%) Frame = -3 Query: 167 PPTPPPYVYKSPP---------YVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKP 18 P PPPY Y SPP Y YK P PP P PPY YK P PPP PPY YK Sbjct: 46 PSPPPPYYYHSPPPPSPSPPSPYYYKSPPPPSPSPPPPYYYKSP-PPPSPTSHPPYYYKS 104 Query: 17 PTPP 6 P PP Sbjct: 105 PPPP 108 Score = 24.3 bits (51), Expect(2) = 2e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 14 PSPPPPYYYKSP 25 Score = 62.4 bits (150), Expect(2) = 8e-10 Identities = 34/73 (46%), Positives = 39/73 (53%), Gaps = 11/73 (15%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPP--------YVYESP 36 +H Y YK P PPP Y PPY Y P PPP SPP Y +PPP Y+Y+SP Sbjct: 96 SHPPYYYKSP-PPPTSYPPPPYHYVSP-PPPSPSPPPPYHYTSPPPPSPAPAPKYIYKSP 153 Query: 35 P---YVYKPPTPP 6 P Y+Y P PP Sbjct: 154 PPPVYIYASPPPP 166 Score = 24.3 bits (51), Expect(2) = 8e-10 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 78 PSPPPPYYYKSP 89 Score = 64.3 bits (155), Expect(2) = 1e-09 Identities = 34/79 (43%), Positives = 36/79 (45%), Gaps = 25/79 (31%) Frame = -3 Query: 167 PPTPPPYVYKSPP----------YVYKPPTPPPYESPPYVYKPPTPP------PYVYES- 39 P PPPY YKSPP Y + PP P P PPY Y P PP PY Y+S Sbjct: 14 PSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPPSPSPPSPYYYKSP 73 Query: 38 --------PPYVYKPPTPP 6 PPY YK P PP Sbjct: 74 PPPSPSPPPPYYYKSPPPP 92 Score = 21.9 bits (45), Expect(2) = 1e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 1 PPPYYYHSP 9 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/74 (45%), Positives = 34/74 (45%), Gaps = 16/74 (21%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK-PPTPPPYESPPYVY------KPPTPPPYVYESP----- 36 Y Y P PPP PPY YK PP P P PPY Y P PPPY Y SP Sbjct: 4 YYYHSP-PPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPPSP 62 Query: 35 ----PYVYKPPTPP 6 PY YK P PP Sbjct: 63 SPPSPYYYKSPPPP 76 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 6/58 (10%) Frame = -3 Query: 158 PPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPP------PYVYESPPYVYKPPTPPP 3 PPPY Y SPP PP+P P PPY YK P PP PY Y SPP PP+P P Sbjct: 1 PPPYYYHSPP----PPSPSP--PPPYYYKSPPPPSPSPPPPYYYHSPP----PPSPSP 48 [66][TOP] >UniRef100_UPI000198347D PREDICTED: hypothetical protein isoform 2 n=1 Tax=Vitis vinifera RepID=UPI000198347D Length = 217 Score = 68.6 bits (166), Expect = 2e-10 Identities = 43/70 (61%), Positives = 43/70 (61%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTP---PPYVYKSPPYVYKPPTP----PPYESPPYVYKPPTP---PPYVYESPPYV 27 V KPPTP PP V K PP YKPPTP PP E PP YKPPTP PP V E PP Sbjct: 63 VEKPPTPVYRPPPVEKPPPE-YKPPTPVYKPPPVEKPPPEYKPPTPVYKPPPV-EKPPPE 120 Query: 26 YKPPTP--PP 3 YKPPTP PP Sbjct: 121 YKPPTPVKPP 130 Score = 65.9 bits (159), Expect = 1e-09 Identities = 40/73 (54%), Positives = 41/73 (56%), Gaps = 16/73 (21%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP----PPYESPPYVYKPPTP---------PPYVYESPP 33 YKPPTP VYK PP V KPPTP PP E PP YKPPTP PP Y+ P Sbjct: 51 YKPPTP---VYKPPP-VEKPPTPVYRPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPT 106 Query: 32 YVYKPP---TPPP 3 VYKPP PPP Sbjct: 107 PVYKPPPVEKPPP 119 Score = 64.7 bits (156), Expect = 3e-09 Identities = 39/79 (49%), Positives = 40/79 (50%), Gaps = 22/79 (27%) Frame = -3 Query: 179 YVYKPPTP---------PPYVYKSPPYVYKPP----------TPPPYESPPYVYKPPTP- 60 Y +KPP P PP YK P VYKPP PPP E PP YKPPTP Sbjct: 30 YEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPTPV 89 Query: 59 --PPYVYESPPYVYKPPTP 9 PP V E PP YKPPTP Sbjct: 90 YKPPPV-EKPPPEYKPPTP 107 Score = 63.2 bits (152), Expect = 9e-09 Identities = 40/78 (51%), Positives = 40/78 (51%), Gaps = 21/78 (26%) Frame = -3 Query: 173 YKPPTP---PPYVYKSPPYVYKPPTP----PPYESPPYVYKPPTP--------------P 57 YKPPTP PP V K PP YKPPTP PP E PP YKPPTP P Sbjct: 83 YKPPTPVYKPPPVEKPPPE-YKPPTPVYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLP 141 Query: 56 PYVYESPPYVYKPPTPPP 3 P V PP KPPT PP Sbjct: 142 PRVVRPPP-TPKPPTLPP 158 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/57 (50%), Positives = 33/57 (57%), Gaps = 10/57 (17%) Frame = -3 Query: 143 YKSPPYVYKPPTP----PPYESPPYVYKPPTP---PPYVYESPPYVYKPP---TPPP 3 +K PPY +KPP P PP PP YKPPTP PP V + P VY+PP PPP Sbjct: 25 HKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPP 81 [67][TOP] >UniRef100_Q9M4I1 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera RepID=Q9M4I1_VITVI Length = 217 Score = 68.6 bits (166), Expect = 2e-10 Identities = 43/70 (61%), Positives = 43/70 (61%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTP---PPYVYKSPPYVYKPPTP----PPYESPPYVYKPPTP---PPYVYESPPYV 27 V KPPTP PP V K PP YKPPTP PP E PP YKPPTP PP V E PP Sbjct: 63 VEKPPTPVYRPPPVEKPPPE-YKPPTPVYKSPPVEKPPPEYKPPTPVYRPPPV-EKPPPE 120 Query: 26 YKPPTP--PP 3 YKPPTP PP Sbjct: 121 YKPPTPVKPP 130 Score = 64.7 bits (156), Expect = 3e-09 Identities = 39/73 (53%), Positives = 41/73 (56%), Gaps = 16/73 (21%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP----PPYESPPYVYKPPTP---------PPYVYESPP 33 YKPPTP VYK PP V KPPTP PP E PP YKPPTP PP Y+ P Sbjct: 51 YKPPTP---VYKPPP-VEKPPTPVYRPPPVEKPPPEYKPPTPVYKSPPVEKPPPEYKPPT 106 Query: 32 YVYKPP---TPPP 3 VY+PP PPP Sbjct: 107 PVYRPPPVEKPPP 119 Score = 63.2 bits (152), Expect = 9e-09 Identities = 38/80 (47%), Positives = 39/80 (48%), Gaps = 23/80 (28%) Frame = -3 Query: 179 YVYKPPTP---------PPYVYKSPPYVYKPP----------TPPPYESPPYVYKPPTP- 60 Y +KPP P PP YK P VYKPP PPP E PP YKPPTP Sbjct: 30 YEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPTPV 89 Query: 59 ---PPYVYESPPYVYKPPTP 9 PP E PP YKPPTP Sbjct: 90 YKSPP--VEKPPPEYKPPTP 107 Score = 62.4 bits (150), Expect = 2e-08 Identities = 40/80 (50%), Positives = 40/80 (50%), Gaps = 23/80 (28%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYV-----YKPPTP----PPYESPPYVYKPPTP------------- 60 YKPPTP VYKSPP YKPPTP PP E PP YKPPTP Sbjct: 83 YKPPTP---VYKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKPPPPPKHKTPT 139 Query: 59 -PPYVYESPPYVYKPPTPPP 3 PP V PP KPPT PP Sbjct: 140 LPPRVVRPPP-TPKPPTLPP 158 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/62 (51%), Positives = 34/62 (54%), Gaps = 12/62 (19%) Frame = -3 Query: 158 PPPYVYKSPPYVYKPP----TPPPYESPPYVYKPP---TPPPYVY-----ESPPYVYKPP 15 PPPY +K P VYK P PP Y+ P VYKPP PP VY E PP YKPP Sbjct: 27 PPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPEYKPP 86 Query: 14 TP 9 TP Sbjct: 87 TP 88 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/57 (50%), Positives = 33/57 (57%), Gaps = 10/57 (17%) Frame = -3 Query: 143 YKSPPYVYKPPTP----PPYESPPYVYKPPTP---PPYVYESPPYVYKPP---TPPP 3 +K PPY +KPP P PP PP YKPPTP PP V + P VY+PP PPP Sbjct: 25 HKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPP 81 [68][TOP] >UniRef100_Q06446 Extensin n=1 Tax=Solanum tuberosum RepID=Q06446_SOLTU Length = 291 Score = 68.6 bits (166), Expect = 2e-10 Identities = 36/66 (54%), Positives = 40/66 (60%), Gaps = 5/66 (7%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPPYVYESPP---YVY 24 H + VYK P PP +YKSPP KP P+P PY P VYK P PP VY+SPP YVY Sbjct: 224 HPAPVYKSPPPPTPIYKSPPPPVKPYHPSPTPYHPKP-VYKSPPPPTPVYKSPPPTHYVY 282 Query: 23 KPPTPP 6 P PP Sbjct: 283 SSPPPP 288 Score = 64.3 bits (155), Expect = 4e-09 Identities = 39/79 (49%), Positives = 42/79 (53%), Gaps = 16/79 (20%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYKSPPY-----------VYKPPTPPP--YESPPY---VYKPPTP 60 +HH VYK P PP VYKSPP VYK P PP Y+SPP VYK P P Sbjct: 125 HHHHPVYKFPPPPTPVYKSPPPPKDPHYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPP 184 Query: 59 PPYVYESPPYVYKPPTPPP 3 P VY+SPP KP P P Sbjct: 185 PTPVYKSPPPPVKPYHPAP 203 Score = 64.3 bits (155), Expect = 4e-09 Identities = 40/81 (49%), Positives = 43/81 (53%), Gaps = 21/81 (25%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPP--YESPP---------YVYKPPTPPPYV 48 H+ VYK P PP VYKSPP VYK P PP Y+SPP VYK P PP V Sbjct: 155 HTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPV 214 Query: 47 YESPPY-------VYKPPTPP 6 Y+SPP VYK P PP Sbjct: 215 YKSPPVKPYHPAPVYKSPPPP 235 Score = 62.8 bits (151), Expect = 1e-08 Identities = 38/81 (46%), Positives = 42/81 (51%), Gaps = 19/81 (23%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPP-----YVYKPPTPPPYVYESP 36 +HH VYK P PP VYKSPP + PP P Y+SPP VYK P PP VY+SP Sbjct: 85 HHHHPVYKSPPPPTPVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYKSP 144 Query: 35 P-----------YVYKPPTPP 6 P VYK P PP Sbjct: 145 PPPKDPHYPPHTPVYKSPPPP 165 Score = 60.1 bits (144), Expect = 7e-08 Identities = 36/76 (47%), Positives = 39/76 (51%), Gaps = 18/76 (23%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP---------YVYKPPTPPP--YESPPY-------VYKPPTPPPY 51 VYK P PP VYKSPP VYK P PP Y+SPP VYK P PP Sbjct: 178 VYKSPPPPTPVYKSPPPPVKPYHPAPVYKSPPPPTPVYKSPPVKPYHPAPVYKSPPPPTP 237 Query: 50 VYESPPYVYKPPTPPP 3 +Y+SPP KP P P Sbjct: 238 IYKSPPPPVKPYHPSP 253 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/71 (49%), Positives = 40/71 (56%), Gaps = 12/71 (16%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPY--VYKPPTP----PPYESPPYVYKPPTPP-PYVYESPP--- 33 +Y Y P PP +VY SPP+ VYK P P P Y+SPP KP PP VY+SPP Sbjct: 27 NYQYSSPPPPVHVYPSPPHHPVYKSPPPHHHHPVYKSPPPSEKPHYPPHTPVYKSPPPHH 86 Query: 32 --YVYKPPTPP 6 VYK P PP Sbjct: 87 HHPVYKSPPPP 97 Score = 56.6 bits (135), Expect = 8e-07 Identities = 40/100 (40%), Positives = 46/100 (46%), Gaps = 29/100 (29%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPP--PY------VYKSPP-------YVYKPPTPPPYESPP 84 H H + + VYK P PP P+ VYKSPP Y + PP P Y+SPP Sbjct: 86 HHHPVYKSPPPPTPVYKSPPPPKTPHYPPHTPVYKSPPPHHHHPVYKFPPPPTPVYKSPP 145 Query: 83 -----------YVYKPPTPPPYVYESPP---YVYKPPTPP 6 VYK P PP VY+SPP VYK P PP Sbjct: 146 PPKDPHYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPP 185 Score = 53.9 bits (128), Expect(2) = 3e-06 Identities = 34/70 (48%), Positives = 37/70 (52%), Gaps = 10/70 (14%) Frame = -3 Query: 185 HSYVYKPPTPPPY--VYKSPPYVYK---PPTPPPYESPP-----YVYKPPTPPPYVYESP 36 H VYK P P + VYKSPP K PP P Y+SPP VYK P PP VY+SP Sbjct: 45 HHPVYKSPPPHHHHPVYKSPPPSEKPHYPPHTPVYKSPPPHHHHPVYKSPPPPTPVYKSP 104 Query: 35 PYVYKPPTPP 6 P P PP Sbjct: 105 PPPKTPHYPP 114 Score = 20.4 bits (41), Expect(2) = 3e-06 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP +VY SP Sbjct: 33 PPPPVHVYPSP 43 [69][TOP] >UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RZI2_RICCO Length = 829 Score = 66.6 bits (161), Expect(2) = 2e-10 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 5/63 (7%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVY-----KPPTPPPYVYESPPYVYKPP 15 Y PP+PPP V+ PP V+ PP PP + PP VY PP+PPP ++ PP VY PP Sbjct: 687 YSPPPPSPPPPVHSPPPPVHSPP-PPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPP 745 Query: 14 TPP 6 PP Sbjct: 746 PPP 748 Score = 21.9 bits (45), Expect(2) = 2e-10 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PPP V+ P Sbjct: 672 PPSPPPPVHSPP 683 Score = 64.3 bits (155), Expect(2) = 1e-09 Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 8/63 (12%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYKPP----T 12 PP+PPP ++ PP VY PP PP PP V+ PP +PPP +Y PP + PP + Sbjct: 727 PPSPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPPPPVHSPPPPIYSPPPPRFSPPPPRFS 786 Query: 11 PPP 3 PPP Sbjct: 787 PPP 789 Score = 21.9 bits (45), Expect(2) = 1e-09 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PPP V+ P Sbjct: 691 PPSPPPPVHSPP 702 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 8/67 (11%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPP--TPPP--YESPPYVYKPP----TPPPYVYESPPYVY 24 Y PP+PPP V+ PP VY PP +PPP + PP V+ PP +PPP VY PP Sbjct: 668 YSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP--P 725 Query: 23 KPPTPPP 3 PP+PPP Sbjct: 726 SPPSPPP 732 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/67 (50%), Positives = 38/67 (56%), Gaps = 12/67 (17%) Frame = -3 Query: 167 PPT--PPPYVYKSPPYVYKPPTP---PPYESPP---YVYKPPTPPPYVYESPPYVYKPP- 15 PPT PPP V PP VY PP P PP SPP Y PP+PPP V+ PP V+ PP Sbjct: 651 PPTQSPPPPVNSPPPPVYSPPPPSPPPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPP 710 Query: 14 ---TPPP 3 +PPP Sbjct: 711 PVHSPPP 717 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/66 (46%), Positives = 36/66 (54%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPP----TPPPYESPPYVYKPP----TPPPYVYESPPYVYK 21 VY PP P P PP V+ PP +PPP PP V+ PP +PPP V+ PP VY Sbjct: 667 VYSPPPPSP-----PPPVHSPPPPVYSPPPPSPPPPVHSPPPPVHSPPPPVHSPPPPVYS 721 Query: 20 PPTPPP 3 PP P P Sbjct: 722 PPPPSP 727 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/78 (42%), Positives = 41/78 (52%), Gaps = 20/78 (25%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPP-------YESPPYVYKPP-----TPPPYVY 45 V+ PP +PPP V+ PP VY PP P P + PP VY PP +PPP V+ Sbjct: 698 VHSPPPPVHSPPPPVHSPPPPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPPVRSPPPPVH 757 Query: 44 ESPPYVYKPP----TPPP 3 PP V+ PP +PPP Sbjct: 758 SPPPPVHSPPPPIYSPPP 775 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/57 (50%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -3 Query: 167 PP--TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP +PPP PP V PP PP SPP PP+PPP V+ PP VY PP P P Sbjct: 644 PPGQSPPPPTQSPPPPVNSPP--PPVYSPP----PPSPPPPVHSPPPPVYSPPPPSP 694 [70][TOP] >UniRef100_Q9STM7 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9STM7_ARATH Length = 707 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 37/66 (56%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 155 YVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 213 Query: 26 YKPPTP 9 Y PTP Sbjct: 214 YYSPTP 219 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 152 PPPYVYSSP 160 Score = 62.0 bits (149), Expect(2) = 3e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKS--PPYVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKS PPYVY P PP Y P V YK P PPPYVY SPP Sbjct: 480 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 538 Query: 26 YKPPTP 9 Y P+P Sbjct: 539 YYSPSP 544 Score = 26.2 bits (56), Expect(2) = 3e-10 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYVY SP Sbjct: 475 PPPPPYVYSSP 485 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 36/74 (48%), Positives = 38/74 (51%), Gaps = 19/74 (25%) Frame = -3 Query: 173 YKPPTPPPYVYKS------------------PPYVYKPPTPPPYESPPYV-YKPPTPPPY 51 YK P PPPY+Y S PPYVY P PP Y P V YKPP PPPY Sbjct: 423 YKSP-PPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPP-PPPY 480 Query: 50 VYESPPYVYKPPTP 9 VY SPP Y P+P Sbjct: 481 VYSSPPPPYYSPSP 494 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYESPPYVYKPPTPP 6 YKPP PPPYVY SPP Y P+P Y+SPP YVY P PPPY SP YK P PP Sbjct: 473 YKPP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFP-PPPYYSPSPKVDYKSPPPP 529 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 402 PPPYVYSSP 410 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 452 PPPYVYSSP 460 Score = 63.5 bits (153), Expect(2) = 5e-10 Identities = 35/66 (53%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 Y+Y P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 580 YIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 638 Query: 26 YKPPTP 9 Y P+P Sbjct: 639 YYSPSP 644 Score = 23.9 bits (50), Expect(2) = 5e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 552 PPPYVYSSP 560 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 180 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP-PPPYVYSSPPPP 238 Query: 26 YKPPTP 9 Y P+P Sbjct: 239 YYSPSP 244 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 205 YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 263 Query: 26 YKPPTP 9 Y P+P Sbjct: 264 YYSPSP 269 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 605 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSP-PPPYVYSSPPPP 663 Query: 26 YKPPTP 9 Y P+P Sbjct: 664 YYSPSP 669 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 177 PPPYVYSSP 185 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 202 PPPYVYSSP 210 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 602 PPPYVYSSP 610 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 35/66 (53%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPY+Y SPP Sbjct: 530 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSP-PPPYIYSSPPPP 588 Query: 26 YKPPTP 9 Y P+P Sbjct: 589 YYAPSP 594 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 527 PPPYVYSSP 535 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 230 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSP-PPPYVYGSPPPP 288 Query: 26 YKPPTP 9 Y P+P Sbjct: 289 YYSPSP 294 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 255 YVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 313 Query: 26 YKPPTP 9 Y P+P Sbjct: 314 YYSPSP 319 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 305 YVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 363 Query: 26 YKPPTP 9 Y P+P Sbjct: 364 YYSPSP 369 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 227 PPPYVYSSP 235 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 252 PPPYVYSSP 260 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 302 PPPYVYSSP 310 Score = 61.6 bits (148), Expect(2) = 2e-09 Identities = 39/67 (58%), Positives = 40/67 (59%), Gaps = 10/67 (14%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESP-PYV-YKPPTPPPYVYESPPY 30 YVY P PP Y YKSPP YVY TPPPY SP P V YK P PPPYVY SPP Sbjct: 355 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSS-TPPPYYSPSPKVDYKSP-PPPYVYSSPPP 412 Query: 29 VYKPPTP 9 Y P+P Sbjct: 413 PYYSPSP 419 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 352 PPPYVYSSP 360 Score = 61.6 bits (148), Expect(2) = 3e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 280 YVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSP-PPPYVYGSPPPP 338 Query: 26 YKPPTP 9 Y P+P Sbjct: 339 YYSPSP 344 Score = 23.1 bits (48), Expect(2) = 3e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 277 PPPYVYGSP 285 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/67 (55%), Positives = 38/67 (56%), Gaps = 9/67 (13%) Frame = -3 Query: 182 SYVYKPPTPPPYV------YKS--PPYVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPY 30 SYVY P PP Y YKS PPYVY P PP Y P V YK P PPPYVY SPP Sbjct: 104 SYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSP-PPPYVYSSPPP 162 Query: 29 VYKPPTP 9 Y P+P Sbjct: 163 PYYSPSP 169 Score = 61.2 bits (147), Expect(2) = 4e-09 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY TPPPY SP YK P PP Sbjct: 348 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS-STPPPYYSPSPKVDYKSPPPP 404 Score = 60.5 bits (145), Expect(2) = 4e-09 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 YVY P PP Y YKSPP YVY P PP Y P V +PP YVY SPP Y Sbjct: 630 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSSPPQYVYSSPPTPY 689 Query: 23 KPPTP 9 P+P Sbjct: 690 YSPSP 694 Score = 23.9 bits (50), Expect(2) = 4e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 627 PPPYVYSSP 635 Score = 23.1 bits (48), Expect(2) = 4e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 327 PPPYVYGSP 335 Score = 62.0 bits (149), Expect(2) = 6e-09 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 505 YVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSP-PPPYVYSSPPPP 563 Query: 26 YKPPTP 9 Y P+P Sbjct: 564 YYSPSP 569 Score = 21.6 bits (44), Expect(2) = 6e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY P Sbjct: 502 PPPYVYSFP 510 Score = 59.3 bits (142), Expect(2) = 1e-08 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 598 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV 656 Query: 20 PPTPPP 3 +PPP Sbjct: 657 YSSPPP 662 Score = 23.5 bits (49), Expect(2) = 1e-08 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY+Y SP Sbjct: 577 PPPYIYSSP 585 Score = 61.6 bits (148), Expect(2) = 1e-08 Identities = 34/61 (55%), Positives = 35/61 (57%), Gaps = 5/61 (8%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP-----PPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 YK P PPPYVY SPP Y P+P PP PPYVY P PPPY SP YK P P Sbjct: 448 YKSP-PPPYVYSSPPPPYYSPSPKVDYKPP--PPPYVYSSP-PPPYYSPSPKVDYKSPPP 503 Query: 8 P 6 P Sbjct: 504 P 504 Score = 20.8 bits (42), Expect(2) = 1e-08 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -2 Query: 210 PPPYVYES 187 PPPY+Y S Sbjct: 427 PPPYIYSS 434 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/66 (53%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP Y+Y P PP Y P V YK P PPPYVY SPP Sbjct: 555 YVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSP-PPPYVYSSPPPP 613 Query: 26 YKPPTP 9 Y P+P Sbjct: 614 YYSPSP 619 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 130 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSP-PPPYVYSSPPPP 188 Query: 26 YKPPTP 9 Y P+P Sbjct: 189 YYSPSP 194 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/67 (52%), Positives = 39/67 (58%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYV------YES--PPYV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+S PPY+ Sbjct: 523 YKSP-PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYI 581 Query: 26 YKPPTPP 6 Y P PP Sbjct: 582 YSSPPPP 588 Score = 59.3 bits (142), Expect(2) = 5e-08 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 10/67 (14%) Frame = -3 Query: 179 YVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPY 30 YVY TPPPY YKSPP YVY P PP Y P V YK P PPPY+Y S P Sbjct: 380 YVYSS-TPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYIYSSTPL 437 Query: 29 VYKPPTP 9 Y P+P Sbjct: 438 PYYSPSP 444 Score = 21.2 bits (43), Expect(2) = 5e-08 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 210 PPPYVYES 187 PPPYVY S Sbjct: 377 PPPYVYSS 384 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/66 (50%), Positives = 35/66 (53%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPT--------PPPYVYESPPYV 27 YVY P PPPY SP YKPP PP Y SPP Y P+ PPPYVY PP Sbjct: 455 YVYSSP-PPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPP 513 Query: 26 YKPPTP 9 Y P+P Sbjct: 514 YYSPSP 519 Score = 60.1 bits (144), Expect = 7e-08 Identities = 39/85 (45%), Positives = 39/85 (45%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYES---- 39 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY S Sbjct: 330 YVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSTPPP 388 Query: 38 --------------PPYVYKPPTPP 6 PPYVY P PP Sbjct: 389 YYSPSPKVDYKSPPPPYVYSSPPPP 413 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/66 (50%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP Y+Y P PP Y Y+SPP Y Sbjct: 548 YKSP-PPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYV 606 Query: 20 PPTPPP 3 +PPP Sbjct: 607 YSSPPP 612 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 148 YKSP-PPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 206 Query: 20 PPTPPP 3 +PPP Sbjct: 207 YSSPPP 212 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 173 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV 231 Query: 20 PPTPPP 3 +PPP Sbjct: 232 YSSPPP 237 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 38/84 (45%), Positives = 39/84 (46%), Gaps = 28/84 (33%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP--------PPY-----------ESPPYVYKPPTPPPY 51 YK P PPPYVY SPP Y P+P PPY SP YK P PPPY Sbjct: 398 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSP-PPPY 455 Query: 50 VYESPP---------YVYKPPTPP 6 VY SPP YKPP PP Sbjct: 456 VYSSPPPPYYSPSPKVDYKPPPPP 479 Score = 20.4 bits (41), Expect(2) = 1e-07 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 213 TPPPYVYESPLI 178 TPPPY SP + Sbjct: 385 TPPPYYSPSPKV 396 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/80 (41%), Positives = 38/80 (47%), Gaps = 10/80 (12%) Frame = -3 Query: 218 HQH-LPHMCMNHHSYVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESPPYVYKP 69 H+H +P + +Y PP Y YKSPP YVY P PP Y P V Sbjct: 65 HEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYK 124 Query: 68 PTPPPYVYESPPYVYKPPTP 9 PPPYVY SPP Y P+P Sbjct: 125 SLPPPYVYSSPPPPYYSPSP 144 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/66 (50%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPY+Y SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 573 YKSP-PPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 631 Query: 20 PPTPPP 3 +PPP Sbjct: 632 YSSPPP 637 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 248 YKSP-PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYV 306 Query: 20 PPTPPP 3 +PPP Sbjct: 307 YSSPPP 312 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 298 YKSP-PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYV 356 Query: 20 PPTPPP 3 +PPP Sbjct: 357 YSSPPP 362 Score = 57.8 bits (138), Expect = 4e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 223 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPY-YSPSPKVNYKSPPPP 279 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 280 YVYGSPPPP 288 Score = 56.6 bits (135), Expect = 8e-07 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 4/60 (6%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYESPPYV-YKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y P V YK P PP Sbjct: 323 YKSP-PPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 379 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/66 (50%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYV------YESPPYVYK 21 YK P PP YVY SPP Y P+P Y+S PPYVY P PP Y Y+SPP Y Sbjct: 98 YKSP-PPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV 156 Query: 20 PPTPPP 3 +PPP Sbjct: 157 YSSPPP 162 Score = 53.9 bits (128), Expect = 5e-06 Identities = 38/69 (55%), Positives = 40/69 (57%), Gaps = 14/69 (20%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVY---------ESPP- 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y SPP Sbjct: 623 YKSP-PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSSPPQ 679 Query: 32 YVY-KPPTP 9 YVY PPTP Sbjct: 680 YVYSSPPTP 688 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/59 (52%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P P PYVY SPP Y P+P Y+S P YVY P P PY SP YK P PP Sbjct: 648 YKSPPP-PYVYSSPPPPYYSPSPKVDYKSSPPQYVYSSP-PTPYYSPSPKVTYKSPPPP 704 [71][TOP] >UniRef100_Q9FH26 Genomic DNA, chromosome 5, TAC clone: K20J1 n=1 Tax=Arabidopsis thaliana RepID=Q9FH26_ARATH Length = 609 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 37/66 (56%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 177 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 235 Query: 26 YKPPTP 9 Y PTP Sbjct: 236 YYSPTP 241 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 37/66 (56%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 302 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 360 Query: 26 YKPPTP 9 Y PTP Sbjct: 361 YYSPTP 366 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 149 PPPYVYSSP 157 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 299 PPPYVYSSP 307 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 152 YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 210 Query: 26 YKPPTP 9 Y P+P Sbjct: 211 YYSPSP 216 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 202 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP-PPPYVYSSPPPP 260 Query: 26 YKPPTP 9 Y P+P Sbjct: 261 YYSPSP 266 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 252 YVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 310 Query: 26 YKPPTP 9 Y P+P Sbjct: 311 YYSPSP 316 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 277 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 335 Query: 26 YKPPTP 9 Y P+P Sbjct: 336 YYSPSP 341 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 327 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP-PPPYVYSSPPPP 385 Query: 26 YKPPTP 9 Y P+P Sbjct: 386 YYSPSP 391 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 352 YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 410 Query: 26 YKPPTP 9 Y P+P Sbjct: 411 YYSPSP 416 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 377 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 435 Query: 26 YKPPTP 9 Y P+P Sbjct: 436 YYSPSP 441 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 402 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 460 Query: 26 YKPPTP 9 Y P+P Sbjct: 461 YYSPSP 466 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 427 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 485 Query: 26 YKPPTP 9 Y P+P Sbjct: 486 YYSPSP 491 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 452 YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 510 Query: 26 YKPPTP 9 Y P+P Sbjct: 511 YYSPSP 516 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 477 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 535 Query: 26 YKPPTP 9 Y P+P Sbjct: 536 YYSPSP 541 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 502 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 560 Query: 26 YKPPTP 9 Y P+P Sbjct: 561 YYSPSP 566 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 527 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 585 Query: 26 YKPPTP 9 Y P+P Sbjct: 586 YYSPSP 591 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 124 PPPYVYSSP 132 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 174 PPPYVYSSP 182 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 224 PPPYVYSSP 232 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 249 PPPYVYSSP 257 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 324 PPPYVYSSP 332 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 349 PPPYVYSSP 357 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 374 PPPYVYSSP 382 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 399 PPPYVYSSP 407 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 424 PPPYVYSSP 432 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 449 PPPYVYNSP 457 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 474 PPPYVYSSP 482 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 499 PPPYVYSSP 507 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 524 PPPYVYSSP 532 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 34/59 (57%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESP--PYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SP PYVY P PPPY SP YK P PP Sbjct: 245 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSP-PPPYYSPSPKVDYKSPPPP 301 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 199 PPPYVYSSP 207 Score = 62.8 bits (151), Expect = 1e-08 Identities = 38/80 (47%), Positives = 41/80 (51%), Gaps = 10/80 (12%) Frame = -3 Query: 218 HQHL-PHMCMNHHSYVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKP 69 HQH P + Y+Y P PP Y YKSPP YVY P PP Y P V YK Sbjct: 38 HQHKSPKYTPHSKPYIYNSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYTPSPKVDYKS 97 Query: 68 PTPPPYVYESPPYVYKPPTP 9 P PPPY Y SPP Y P+P Sbjct: 98 P-PPPYEYSSPPPPYYSPSP 116 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/73 (49%), Positives = 39/73 (53%), Gaps = 18/73 (24%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP--------PPYE--SPPYVYKPPTP--------PPYV 48 YK P PPPYVY SPP Y P+P PPYE SPP Y P+P PPYV Sbjct: 70 YKSP-PPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPYV 128 Query: 47 YESPPYVYKPPTP 9 Y SPP Y P+P Sbjct: 129 YSSPPLPYYSPSP 141 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/73 (49%), Positives = 38/73 (52%), Gaps = 18/73 (24%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP--------PPY--ESPPYVYKPPTP--------PPYV 48 YK P PPPYVY SPP Y P+P PPY SPP Y PTP PPYV Sbjct: 120 YKSP-PPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV 178 Query: 47 YESPPYVYKPPTP 9 Y SPP Y P+P Sbjct: 179 YSSPPPPYYSPSP 191 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/66 (53%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y PTP Y+SPP YVY P PP Y Y+SPP Y Sbjct: 220 YKSP-PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYV 278 Query: 20 PPTPPP 3 +PPP Sbjct: 279 YSSPPP 284 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/73 (47%), Positives = 37/73 (50%), Gaps = 18/73 (24%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP--------PPY--ESPPYVYKPPTP--------PPYV 48 YK P PPPY Y SPP Y P+P PPY SPP Y P+P PPYV Sbjct: 95 YKSP-PPPYEYSSPPPPYYSPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYV 153 Query: 47 YESPPYVYKPPTP 9 Y SPP Y PTP Sbjct: 154 YSSPPPPYYSPTP 166 Score = 55.5 bits (132), Expect(2) = 1e-07 Identities = 29/58 (50%), Positives = 31/58 (53%), Gaps = 8/58 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPY 30 YVY P PP Y YKSPP YVY P PP Y P V PPPYVY++P Y Sbjct: 552 YVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVTYKSLPPPYVYKAPYY 609 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 549 PPPYVYNSP 557 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 170 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 228 Query: 20 PPTPPP 3 +PPP Sbjct: 229 YSSPPP 234 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 295 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 353 Query: 20 PPTPPP 3 +PPP Sbjct: 354 YSSPPP 359 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 320 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV 378 Query: 20 PPTPPP 3 +PPP Sbjct: 379 YSSPPP 384 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 370 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 428 Query: 20 PPTPPP 3 +PPP Sbjct: 429 YSSPPP 434 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 420 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV 478 Query: 20 PPTPPP 3 +PPP Sbjct: 479 YSSPPP 484 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 445 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 503 Query: 20 PPTPPP 3 +PPP Sbjct: 504 YSSPPP 509 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 470 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 528 Query: 20 PPTPPP 3 +PPP Sbjct: 529 YSSPPP 534 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 520 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV 578 Query: 20 PPTPPP 3 +PPP Sbjct: 579 YSSPPP 584 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/64 (54%), Positives = 38/64 (59%), Gaps = 11/64 (17%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPY------VYES--PPYV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+S PPYV Sbjct: 545 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVTYKSLPPPYV 603 Query: 26 YKPP 15 YK P Sbjct: 604 YKAP 607 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 195 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPY-YSPTPKVDYKSPPPP 251 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 252 YVYSSPPPP 260 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 395 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 451 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 452 YVYNSPPPP 460 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y PP Sbjct: 495 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPY-YSPSPKVDYKSPPPP 551 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 552 YVYNSPPPP 560 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/71 (46%), Positives = 36/71 (50%), Gaps = 13/71 (18%) Frame = -3 Query: 182 SYVYKPPTPPPYVY-----KSP-------PYVYKPPTPPPYESPPYV-YKPPTPPPYVYE 42 SY Y P P Y + KSP PY+Y P PP Y P V YK P PPPYVY Sbjct: 22 SYPYSSPQTPQYNFPSHQHKSPKYTPHSKPYIYNSPPPPYYSPSPKVNYKSP-PPPYVYS 80 Query: 41 SPPYVYKPPTP 9 SPP Y P+P Sbjct: 81 SPPPPYYTPSP 91 [72][TOP] >UniRef100_Q9STM8 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9STM8_ARATH Length = 513 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 37/66 (56%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 137 YVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 195 Query: 26 YKPPTP 9 Y PTP Sbjct: 196 YYSPTP 201 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 134 PPPYVYSSP 142 Score = 63.9 bits (154), Expect(2) = 4e-10 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 8/65 (12%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP--------PPYVYESPPYVY 24 YVY P PPPY SP YK P PP Y SPP Y P+P PPYVY SPP Y Sbjct: 237 YVYSSP-PPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPY 295 Query: 23 KPPTP 9 P+P Sbjct: 296 YSPSP 300 Score = 23.9 bits (50), Expect(2) = 4e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 209 PPPYVYSSP 217 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 162 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP-PPPYVYSSPPPP 220 Query: 26 YKPPTP 9 Y P+P Sbjct: 221 YYSPSP 226 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 187 YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 245 Query: 26 YKPPTP 9 Y P+P Sbjct: 246 YYSPSP 251 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 286 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP-PPPYVYSSPPPP 344 Query: 26 YKPPTP 9 Y P+P Sbjct: 345 YYSPSP 350 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 311 YVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPP 369 Query: 26 YKPPTP 9 Y P+P Sbjct: 370 YYSPSP 375 Score = 63.2 bits (152), Expect(2) = 6e-10 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 336 YVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYNSPPPP 394 Query: 26 YKPPTP 9 Y P+P Sbjct: 395 YYSPSP 400 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 159 PPPYVYSSP 167 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 184 PPPYVYSSP 192 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 283 PPPYVYSSP 291 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 308 PPPYVYSSP 316 Score = 23.9 bits (50), Expect(2) = 6e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 333 PPPYVYSSP 341 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 35/66 (53%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPY+Y SPP Sbjct: 361 YVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP-PPPYIYNSPPPP 419 Query: 26 YKPPTP 9 Y P+P Sbjct: 420 YYSPSP 425 Score = 62.8 bits (151), Expect(2) = 8e-10 Identities = 35/66 (53%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP Y+Y P PP Y P V YK P PPPYVY SPP Sbjct: 386 YVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTP-PPPYVYSSPPPP 444 Query: 26 YKPPTP 9 Y P+P Sbjct: 445 YYSPSP 450 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 358 PPPYVYSSP 366 Score = 23.9 bits (50), Expect(2) = 8e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 383 PPPYVYNSP 391 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 38/75 (50%), Positives = 39/75 (52%), Gaps = 16/75 (21%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 436 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSP-PPPYVYSSPPTP 494 Query: 26 YKPP-------TPPP 3 Y P +PPP Sbjct: 495 YYSPSSKVTYKSPPP 509 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 433 PPPYVYSSP 441 Score = 61.6 bits (148), Expect(2) = 2e-09 Identities = 34/66 (51%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYV 27 Y+Y P PP Y YK+PP YVY P PP Y P V YK P PPPYVY SPP Sbjct: 411 YIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSP-PPPYVYSSPPPP 469 Query: 26 YKPPTP 9 Y P+P Sbjct: 470 YYSPSP 475 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 35/64 (54%), Positives = 36/64 (56%), Gaps = 9/64 (14%) Frame = -3 Query: 173 YKPPTPPPYV------YKSPP--YVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPYVYK 21 Y+ P PP Y YKSPP YVY P PP Y P V YK P PPPYVY SPP Y Sbjct: 263 YRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-PPPYVYSSPPPPYY 321 Query: 20 PPTP 9 PTP Sbjct: 322 SPTP 325 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 234 PPPYVYSSP 242 Score = 23.5 bits (49), Expect(2) = 2e-09 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY+Y SP Sbjct: 408 PPPYIYNSP 416 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/67 (55%), Positives = 38/67 (56%), Gaps = 9/67 (13%) Frame = -3 Query: 182 SYVYKPPTPPPYV------YKS--PPYVYKPPTPPPYESPPYV-YKPPTPPPYVYESPPY 30 SYVY P PP Y YKS PPYVY P PP Y P V YK P PPPYVY SPP Sbjct: 86 SYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSP-PPPYVYSSPPP 144 Query: 29 VYKPPTP 9 Y P+P Sbjct: 145 PYYSPSP 151 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/66 (54%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 179 YVYKPPTPPPYV------YKSPP--YVYKPPTPPPYE-SPPYVYKPPTPPPYVYESPPYV 27 YVY P PP Y YKSPP YVY P PP Y SP YK P PPPYVY SPP Sbjct: 112 YVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSP-PPPYVYSSPPPP 170 Query: 26 YKPPTP 9 Y P+P Sbjct: 171 YYSPSP 176 Score = 61.2 bits (147), Expect = 3e-08 Identities = 35/67 (52%), Positives = 39/67 (58%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YES--PPYV 27 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+S PPY+ Sbjct: 354 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYI 412 Query: 26 YKPPTPP 6 Y P PP Sbjct: 413 YNSPPPP 419 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/57 (54%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SPP Y PPPY SP YK P PP Sbjct: 230 YKSP-PPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPP 285 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 130 YKSP-PPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 188 Query: 20 PPTPPP 3 +PPP Sbjct: 189 YSSPPP 194 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 155 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV 213 Query: 20 PPTPPP 3 +PPP Sbjct: 214 YSSPPP 219 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 279 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV 337 Query: 20 PPTPPP 3 +PPP Sbjct: 338 YSSPPP 343 Score = 58.9 bits (141), Expect = 2e-07 Identities = 33/80 (41%), Positives = 38/80 (47%), Gaps = 10/80 (12%) Frame = -3 Query: 218 HQH-LPHMCMNHHSYVYKPPTPPPYV-------YKSPP--YVYKPPTPPPYESPPYVYKP 69 H+H +P + +Y PP Y YKSPP YVY P PP Y P V Sbjct: 47 HEHKIPKYTPHPKPSIYSSSPPPSYYSPSPKVDYKSPPPSYVYSSPPPPYYSPSPKVDYK 106 Query: 68 PTPPPYVYESPPYVYKPPTP 9 PPPYVY SPP Y P+P Sbjct: 107 SLPPPYVYSSPPPPYYSPSP 126 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/66 (51%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 205 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYY 263 Query: 20 PPTPPP 3 PPP Sbjct: 264 RSPPPP 269 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYV------YESPPYVYK 21 YK P PPPYVY SPP Y P+P Y+SPP YVY P PP Y Y+SPP Y Sbjct: 329 YKSP-PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 387 Query: 20 PPTPPP 3 +PPP Sbjct: 388 YNSPPP 393 Score = 58.2 bits (139), Expect = 3e-07 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 13/69 (18%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYESPP--YVYKPPTPPPYVYE----------SPP 33 YK P PPPYVY SPP Y P+P Y+SPP Y+Y P PPPY Y PP Sbjct: 379 YKSP-PPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSP-PPPY-YSPSPKVNYKTPPPP 435 Query: 32 YVYKPPTPP 6 YVY P PP Sbjct: 436 YVYSSPPPP 444 Score = 57.4 bits (137), Expect = 5e-07 Identities = 35/72 (48%), Positives = 37/72 (51%), Gaps = 16/72 (22%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP------PPYESPPYVYKPPTPPPYVYE---------- 42 YK P PPPY+Y SPP Y P+P PP PPYVY P PPPY Y Sbjct: 404 YKSP-PPPYIYNSPPPPYYSPSPKVNYKTPP---PPYVYSSP-PPPY-YSPSPKVNYKSP 457 Query: 41 SPPYVYKPPTPP 6 PPYVY P PP Sbjct: 458 PPPYVYSSPPPP 469 Score = 57.0 bits (136), Expect = 6e-07 Identities = 35/60 (58%), Positives = 37/60 (61%), Gaps = 4/60 (6%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPPTPPPYVYESPPYV-YKPPTPP 6 YK P PPPYVY SPP Y P+P Y+SPP YVY P PPPY Y P V YK P PP Sbjct: 429 YKTP-PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSP-PPPY-YSPSPNVDYKSPPPP 485 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPYVY SPP Y P+P Y+S PPYVY P P PY S YK P PP Sbjct: 454 YKSP-PPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSP-PTPYYSPSSKVTYKSPPPP 510 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/66 (50%), Positives = 37/66 (56%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-PYES--PPYVYKPPTPPPYV------YESPPYVYK 21 YK P PP YVY SPP Y P+P Y+S PPYVY P PP Y Y+SPP Y Sbjct: 80 YKSP-PPSYVYSSPPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV 138 Query: 20 PPTPPP 3 +PPP Sbjct: 139 YSSPPP 144 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPY PP Y P Y+S PPYVY P PPPY SP YK P PP Sbjct: 255 YKSP-PPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSP-PPPYYSPSPKVDYKSPPPP 310 [73][TOP] >UniRef100_Q40502 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40502_TOBAC Length = 280 Score = 68.2 bits (165), Expect = 3e-10 Identities = 38/70 (54%), Positives = 41/70 (58%), Gaps = 10/70 (14%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPY---VYKPPTPPPYVYESP---- 36 H+ VYK P PP VYKSPP Y PP P Y+SPP VYK P PP VY+SP Sbjct: 208 HTPVYKSPPPPTPVYKSPPPSKKPYYPPHTPVYKSPPPPTPVYKSPPPPTPVYKSPPPHH 267 Query: 35 PYVYKPPTPP 6 PYVY P PP Sbjct: 268 PYVYASPPPP 277 Score = 60.8 bits (146), Expect(2) = 1e-08 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY--VYKPPTPP--PYESPPY------VYKPPTPPPYVYESP-P 33 Y+YK P PP +VY SPP+ VYK P PP PY P VYK P PP Y P P Sbjct: 40 YLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHP 99 Query: 32 YVYKPPTPP 6 VYK P PP Sbjct: 100 PVYKSPPPP 108 Score = 21.9 bits (45), Expect(2) = 1e-08 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PY+Y+SP Sbjct: 34 PPPKKPYLYKSP 45 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/74 (48%), Positives = 39/74 (52%), Gaps = 14/74 (18%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYK---PPTPPPYESPP-----------YVYKPPTPPPYV 48 H+ VYK P PP VYKSPP K PP P Y+SPP VYK P PP V Sbjct: 116 HTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTPV 175 Query: 47 YESPPYVYKPPTPP 6 Y+SPP KP PP Sbjct: 176 YKSPPPPKKPHYPP 189 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/74 (48%), Positives = 39/74 (52%), Gaps = 14/74 (18%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKP---PTPPPYESPPY-----------VYKPPTPPPYV 48 H+ VYK P PP VYKSPP KP P P Y+SPP VYK P PP V Sbjct: 162 HTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPV 221 Query: 47 YESPPYVYKPPTPP 6 Y+SPP KP PP Sbjct: 222 YKSPPPSKKPYYPP 235 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 39/87 (44%), Positives = 41/87 (47%), Gaps = 27/87 (31%) Frame = -3 Query: 185 HSYVYKPPTPP--PY-----------VYKSPP---YVYKPPTPPPYESPP---------- 84 H VYK P PP PY VYKSPP Y PP PP Y+SPP Sbjct: 57 HHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYKSPPPPKKPYSLPH 116 Query: 83 -YVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PP VY+SPP KP PP Sbjct: 117 TPVYKSPPPPTPVYKSPPPPKKPHYPP 143 Score = 20.4 bits (41), Expect(2) = 1e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP +VY SP Sbjct: 45 PPPPVHVYPSP 55 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/71 (50%), Positives = 42/71 (59%), Gaps = 12/71 (16%) Frame = -3 Query: 182 SYVYKPPTPP--PYVYKSPP---YVY-KPPTPPPYESPPYVYKP--PTPPPY----VYES 39 +Y Y P PP PY+YKSPP +VY PP P Y+SPP KP P+P PY VY+S Sbjct: 27 NYQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKS 86 Query: 38 PPYVYKPPTPP 6 PP KP PP Sbjct: 87 PPPPKKPYYPP 97 Score = 56.2 bits (134), Expect = 1e-06 Identities = 38/77 (49%), Positives = 41/77 (53%), Gaps = 18/77 (23%) Frame = -3 Query: 185 HSYVYKPPTPP--PY------VYKSPPYVYKPPTP-----PPYESPPY-----VYKPPTP 60 H+ VYK P PP PY VYKSPP PPTP PP + P Y VYK P P Sbjct: 190 HTPVYKSPPPPKKPYYPPHTPVYKSPP----PPTPVYKSPPPSKKPYYPPHTPVYKSPPP 245 Query: 59 PPYVYESPPYVYKPPTP 9 P VY+SPP PPTP Sbjct: 246 PTPVYKSPP----PPTP 258 [74][TOP] >UniRef100_B9IKD0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IKD0_POPTR Length = 190 Score = 65.9 bits (159), Expect(2) = 3e-10 Identities = 35/75 (46%), Positives = 41/75 (54%), Gaps = 13/75 (17%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESP---PYVYKPPTPPPYVYESPP----- 33 HH Y PP PP Y Y+SPP PPTP ++SP P+++K P PPPY Y SPP Sbjct: 66 HHKCKYSPP-PPVYTYRSPP----PPTPMHHKSPPPSPHMFKSPPPPPYRYISPPPPPPH 120 Query: 32 -----YVYKPPTPPP 3 Y Y P PPP Sbjct: 121 PPCHAYKYLSPPPPP 135 Score = 22.3 bits (46), Expect(2) = 3e-10 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP+ Y+SP Sbjct: 52 PPPPPHKYKSP 62 [75][TOP] >UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=O81765_ARATH Length = 699 Score = 67.8 bits (164), Expect = 4e-10 Identities = 31/62 (50%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP----TP 9 VY PP PPP V+ PP V+ PP PP Y PP +PPP V+ PP VY PP +P Sbjct: 530 VYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSP 589 Query: 8 PP 3 PP Sbjct: 590 PP 591 Score = 66.6 bits (161), Expect(2) = 4e-10 Identities = 31/64 (48%), Positives = 37/64 (57%), Gaps = 6/64 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP------PPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 VY PP PPP V+ PP V+ PP P P + PP V+ PP P P V+ PP V+ PP Sbjct: 555 VYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP-VHSPPPPVHSPP 613 Query: 14 TPPP 3 PPP Sbjct: 614 PPPP 617 Score = 21.2 bits (43), Expect(2) = 4e-10 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP V+ P Sbjct: 533 PPPPPPPVHSPP 544 Score = 62.4 bits (150), Expect(2) = 6e-09 Identities = 31/71 (43%), Positives = 37/71 (52%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP-- 15 V+ PP +PPP V+ PP V+ PP P P SPP P PPP VY PP V+ PP Sbjct: 572 VFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPS 631 Query: 14 -------TPPP 3 +PPP Sbjct: 632 QSPPVVYSPPP 642 Score = 21.2 bits (43), Expect(2) = 6e-09 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP V+ P Sbjct: 558 PPPPPPPVHSPP 569 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/71 (45%), Positives = 39/71 (54%), Gaps = 12/71 (16%) Frame = -3 Query: 179 YVYKPP-----TPPPYVYK-SPPYVYKPPTPPP--YESPPYVYKPP----TPPPYVYESP 36 Y PP +PPP V+ PP VY PP PPP + PP V+ PP +PPP V+ P Sbjct: 531 YSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPP 590 Query: 35 PYVYKPPTPPP 3 P V+ PP P P Sbjct: 591 PPVHSPPPPAP 601 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/60 (48%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTP--PPYVYESPPYVYKPPTPP 6 V+ PP P P V+ PP V+ PP PPP Y PP V+ PP PP VY PP K +PP Sbjct: 593 VHSPPPPAP-VHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPP 651 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 15/75 (20%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPY-VYKPPTPPP--YESPPYVYKPPTPPPY--------VYESP 36 S V K +PPP SPP VY PP PPP + PP V+ PP PP Y V+ P Sbjct: 510 SPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPP 569 Query: 35 PYVYKPP----TPPP 3 P V+ PP +PPP Sbjct: 570 PPVFSPPPPVYSPPP 584 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/63 (49%), Positives = 37/63 (58%), Gaps = 6/63 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYV----YESPPY--VYKPP 15 V+ PP PPP VY PP V+ +PPP +SPP VY PP PP + +SPP V K Sbjct: 609 VHSPPPPPP-VYSPPPPVF---SPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKE 664 Query: 14 TPP 6 TPP Sbjct: 665 TPP 667 [76][TOP] >UniRef100_Q40768 Extensin n=1 Tax=Prunus dulcis RepID=Q40768_PRUDU Length = 278 Score = 67.0 bits (162), Expect(2) = 4e-10 Identities = 34/68 (50%), Positives = 36/68 (52%), Gaps = 8/68 (11%) Frame = -3 Query: 185 HSYVYKPPTPP-----PYVYKSPPY---VYKPPTPPPYESPPYVYKPPTPPPYVYESPPY 30 H Y YK P PP PY YKSPP VYKPP P P YKPPTPP + PY Sbjct: 208 HPYHYKSPPPPSPPKKPYHYKSPPPPTPVYKPPVYSPPPPPKKPYKPPTPPVHTAPPHPY 267 Query: 29 VYKPPTPP 6 +Y P PP Sbjct: 268 IYSSPPPP 275 Score = 20.8 bits (42), Expect(2) = 4e-10 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+P P VY P Sbjct: 195 PPSPTPPVYSPP 206 Score = 62.4 bits (150), Expect(2) = 1e-09 Identities = 39/87 (44%), Positives = 40/87 (45%), Gaps = 21/87 (24%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPPPYVYKSP--PYVYKPPTPPPYESP--PYVYKPPTPP------- 57 H H Y YK P PPP Y P PY YK P PP Y P PY YK P PP Sbjct: 61 HYSPPKHPYHYKSP-PPPVHYSPPKHPYHYKSPPPPVYSPPKHPYHYKSPPPPSPSPPKH 119 Query: 56 PYVYESP----------PYVYKPPTPP 6 PY Y+SP PY YK P PP Sbjct: 120 PYHYKSPPPPSPSPPKHPYHYKSPPPP 146 Score = 23.9 bits (50), Expect(2) = 1e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPY Y+SP Sbjct: 40 PPVSPPYHYKSP 51 Score = 65.9 bits (159), Expect = 1e-09 Identities = 43/94 (45%), Positives = 46/94 (48%), Gaps = 33/94 (35%) Frame = -3 Query: 185 HSYVYKPPTPP-------PYVYKSP--------PYVYKPPTPPPYESP--------PYVY 75 H Y YK P PP PY YKSP PY YK P PPP +P PY Y Sbjct: 153 HPYHYKSPPPPSPSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPPSPTPPVYSPPKHPYHY 212 Query: 74 KPPTPP-----PYVYESPP---YVYKPP--TPPP 3 K P PP PY Y+SPP VYKPP +PPP Sbjct: 213 KSPPPPSPPKKPYHYKSPPPPTPVYKPPVYSPPP 246 Score = 63.9 bits (154), Expect = 5e-09 Identities = 38/89 (42%), Positives = 39/89 (43%), Gaps = 29/89 (32%) Frame = -3 Query: 185 HSYVYKPPTPP-----PYVYKSPP----------------YVYKPPTPPPYESPPYVYKP 69 H Y YK P PP PY YKSPP Y YK P PP PY YK Sbjct: 170 HPYHYKSPPPPSPPKKPYHYKSPPPPPSPTPPVYSPPKHPYHYKSPPPPSPPKKPYHYKS 229 Query: 68 PTPPPYVYESPPY--------VYKPPTPP 6 P PP VY+ P Y YKPPTPP Sbjct: 230 PPPPTPVYKPPVYSPPPPPKKPYKPPTPP 258 Score = 63.5 bits (153), Expect = 7e-09 Identities = 43/96 (44%), Positives = 44/96 (45%), Gaps = 35/96 (36%) Frame = -3 Query: 185 HSYVYKPPTPP-------PYVYKSPP----------YVYKPPTPPPYESPP---YVYKPP 66 H Y YK P PP PY YKSPP Y YK P PPP SPP Y YK P Sbjct: 102 HPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSP-PPPSPSPPKHPYHYKSP 160 Query: 65 TPP-------PYVYESPP--------YVYKPPTPPP 3 PP PY Y+SPP Y YK P PPP Sbjct: 161 PPPSPSPPKHPYHYKSPPPPSPPKKPYHYKSPPPPP 196 Score = 63.2 bits (152), Expect = 9e-09 Identities = 38/83 (45%), Positives = 39/83 (46%), Gaps = 23/83 (27%) Frame = -3 Query: 185 HSYVYKPPTPP-------PYVYKSP----------PYVYKPPTPPPYESPPYVYK----P 69 H Y YK P PP PY YKSP PY YK P PP PY YK P Sbjct: 136 HPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSPPPPSPPKKPYHYKSPPPP 195 Query: 68 PTPPPYVYESP--PYVYKPPTPP 6 P+P P VY P PY YK P PP Sbjct: 196 PSPTPPVYSPPKHPYHYKSPPPP 218 Score = 61.2 bits (147), Expect = 3e-08 Identities = 38/86 (44%), Positives = 39/86 (45%), Gaps = 20/86 (23%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESP---PYVYKPPTPP-------P 54 H H Y YK P PP Y PY YK P PPP SP PY YK P PP P Sbjct: 79 HYSPPKHPYHYKSPPPPVYSPPKHPYHYKSP-PPPSPSPPKHPYHYKSPPPPSPSPPKHP 137 Query: 53 YVYESP----------PYVYKPPTPP 6 Y Y+SP PY YK P PP Sbjct: 138 YHYKSPPPPSPSPPKHPYHYKSPPPP 163 Score = 60.8 bits (146), Expect = 4e-08 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 9/67 (13%) Frame = -3 Query: 179 YVYK---PPTPPPYVYKSP---PYVYKPPTPPPYESP---PYVYKPPTPPPYVYESPPYV 27 Y YK PP+P P V+ SP PY YK P PP + SP PY YK P PP Y PY Sbjct: 46 YHYKSPPPPSPTPPVHYSPPKHPYHYKSPPPPVHYSPPKHPYHYKSPPPPVYSPPKHPYH 105 Query: 26 YKPPTPP 6 YK P PP Sbjct: 106 YKSPPPP 112 Score = 60.5 bits (145), Expect = 6e-08 Identities = 40/86 (46%), Positives = 42/86 (48%), Gaps = 25/86 (29%) Frame = -3 Query: 185 HSYVYKPPTPP-------PYVYKSPP----------YVYKPPTPPPYESPP---YVYKPP 66 H Y YK P PP PY YKSPP Y YK P PPP SPP Y YK P Sbjct: 119 HPYHYKSPPPPSPSPPKHPYHYKSPPPPSPSPPKHPYHYKSP-PPPSPSPPKHPYHYKSP 177 Query: 65 TPP-----PYVYESPPYVYKPPTPPP 3 PP PY Y+SPP PP+P P Sbjct: 178 PPPSPPKKPYHYKSPP---PPPSPTP 200 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPP---YVYKPPTPPPYVYESP--PYVYKPPTPP 6 PP PPY YKSPP PTPP + SPP Y YK P PPP Y P PY YK P PP Sbjct: 40 PPVSPPYHYKSPPP--PSPTPPVHYSPPKHPYHYKSP-PPPVHYSPPKHPYHYKSPPPP 95 [77][TOP] >UniRef100_Q3ECC3 Putative uncharacterized protein At1g76930.1 n=1 Tax=Arabidopsis thaliana RepID=Q3ECC3_ARATH Length = 293 Score = 67.4 bits (163), Expect = 5e-10 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP Y SPP VYK P PP Sbjct: 42 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKYYSPPPVYKSPPPP 97 Score = 67.0 bits (162), Expect = 6e-10 Identities = 37/66 (56%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYE---------SPPYVYKPPTPPPYVYESPPYVY 24 VYK P PPP Y SPP VYK P PP Y+ SPP VYK P PPP + SPP VY Sbjct: 74 VYKSP-PPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVY 131 Query: 23 KPPTPP 6 K P PP Sbjct: 132 KSPPPP 137 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 98 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 153 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 93 SPPPPVYKSP 102 Score = 64.7 bits (156), Expect = 3e-09 Identities = 34/60 (56%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 +Y Y P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 24 NYFYSSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 81 Score = 64.7 bits (156), Expect = 3e-09 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 8/65 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPP-------TPPPYVYESPPYVYK 21 VYK P PPP + SPP VYK P PP Y SPP VYK P PPP + SPP VYK Sbjct: 58 VYKSP-PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYK 116 Query: 20 PPTPP 6 P PP Sbjct: 117 SPPPP 121 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPP 33 VYK P PPP + SPP VYK P PP + SPP VYK P PP Y PP Sbjct: 114 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 [78][TOP] >UniRef100_Q304C4 Putative uncharacterized protein At1g76930.2 n=1 Tax=Arabidopsis thaliana RepID=Q304C4_ARATH Length = 256 Score = 67.4 bits (163), Expect = 5e-10 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP Y SPP VYK P PP Sbjct: 42 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKYYSPPPVYKSPPPP 97 Score = 67.0 bits (162), Expect = 6e-10 Identities = 37/66 (56%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYE---------SPPYVYKPPTPPPYVYESPPYVY 24 VYK P PPP Y SPP VYK P PP Y+ SPP VYK P PPP + SPP VY Sbjct: 74 VYKSP-PPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVY 131 Query: 23 KPPTPP 6 K P PP Sbjct: 132 KSPPPP 137 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 98 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 153 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 93 SPPPPVYKSP 102 Score = 64.7 bits (156), Expect = 3e-09 Identities = 34/60 (56%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 +Y Y P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 24 NYFYSSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 81 Score = 64.7 bits (156), Expect = 3e-09 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 8/65 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPP-------TPPPYVYESPPYVYK 21 VYK P PPP + SPP VYK P PP Y SPP VYK P PPP + SPP VYK Sbjct: 58 VYKSP-PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYK 116 Query: 20 PPTPP 6 P PP Sbjct: 117 SPPPP 121 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPP 33 VYK P PPP + SPP VYK P PP + SPP VYK P PP Y PP Sbjct: 114 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 [79][TOP] >UniRef100_Q38913-2 Isoform 2 of Extensin-1 n=1 Tax=Arabidopsis thaliana RepID=Q38913-2 Length = 246 Score = 67.4 bits (163), Expect = 5e-10 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP Y SPP VYK P PP Sbjct: 38 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKYYSPPPVYKSPPPP 93 Score = 67.0 bits (162), Expect = 6e-10 Identities = 37/66 (56%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYE---------SPPYVYKPPTPPPYVYESPPYVY 24 VYK P PPP Y SPP VYK P PP Y+ SPP VYK P PPP + SPP VY Sbjct: 70 VYKSP-PPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVY 127 Query: 23 KPPTPP 6 K P PP Sbjct: 128 KSPPPP 133 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 35/58 (60%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 94 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 149 Score = 20.8 bits (42), Expect(2) = 1e-09 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 89 SPPPPVYKSP 98 Score = 64.7 bits (156), Expect = 3e-09 Identities = 34/60 (56%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 +Y Y P PPP + SPP VYK P PP + SPP VYK P PPP + SPP VYK P PP Sbjct: 20 NYFYSSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP-PPPVKHYSPPPVYKSPPPP 77 Score = 64.7 bits (156), Expect = 3e-09 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 8/65 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPP-------TPPPYVYESPPYVYK 21 VYK P PPP + SPP VYK P PP Y SPP VYK P PPP + SPP VYK Sbjct: 54 VYKSP-PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYK 112 Query: 20 PPTPP 6 P PP Sbjct: 113 SPPPP 117 Score = 64.7 bits (156), Expect = 3e-09 Identities = 33/58 (56%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP + SPP VYK P PP Y PP VY P PP Sbjct: 110 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVVYHSPPPP 166 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 7/59 (11%) Frame = -3 Query: 161 TPPPYVYKSPP-----YVYKPPTPPPYESPPYVYKPPTPPPYVYESP--PYVYKPPTPP 6 +PPP VY SPP Y YK P PP + SPP VY P PP + Y P PY+YK P PP Sbjct: 186 SPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPTVYHSPPPPVHHYSPPHQPYLYKSPPPP 244 Score = 62.8 bits (151), Expect = 1e-08 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP--YESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PPP + SPP VYK P PP Y PP VY P PPP Y PP VY P PP Sbjct: 126 VYKSP-PPPVKHYSPPPVYKSPPPPVKHYSPPPVVYHSP-PPPVHYSPPPVVYHSPPPP 182 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/57 (50%), Positives = 30/57 (52%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PP Y PP VY P PP + SPP V PPP Y PP VY P PP Sbjct: 142 VYKSPPPPVKHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPP 198 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/68 (47%), Positives = 34/68 (50%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPP----------TPPPYVYESPPY 30 VY P PPP Y PP VY P PP Y PP VY P +PPP V+ SPP Sbjct: 159 VYHSP-PPPVHYSPPPVVYHSPPPPVHYSPPPVVYHSPPPPKKHYEYKSPPPPVHYSPPT 217 Query: 29 VYKPPTPP 6 VY P PP Sbjct: 218 VYHSPPPP 225 [80][TOP] >UniRef100_Q76KW2 Hydroxyproline-rich glycoprotein-3 (Fragment) n=1 Tax=Pisum sativum RepID=Q76KW2_PEA Length = 137 Score = 66.6 bits (161), Expect(2) = 5e-10 Identities = 34/62 (54%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKPPT 12 Y YK P PP Y YKSPP VYK +PPP PY Y P PP Y Y SPP Y YK P Sbjct: 44 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPX 103 Query: 11 PP 6 P Sbjct: 104 TP 105 Score = 20.8 bits (42), Expect(2) = 5e-10 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PY Y SP Sbjct: 18 PPVKKPYKYSSP 29 Score = 64.3 bits (155), Expect(2) = 2e-09 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 7/65 (10%) Frame = -3 Query: 179 YVYKPPTPP---PYVYKS-PPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYK 21 Y YK P PP PY Y S PP VYK +PPP P Y YK P PP Y Y+SPP Y YK Sbjct: 11 YKYKSPPPPVKKPYKYSSPPPPVYKYNSPPP---PVYKYKSPPPPVYKYKSPPPPVYKYK 67 Query: 20 PPTPP 6 P PP Sbjct: 68 SPPPP 72 Score = 20.8 bits (42), Expect(2) = 2e-09 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 6 PPPPVYKYKSP 16 Score = 64.3 bits (155), Expect = 4e-09 Identities = 38/71 (53%), Positives = 40/71 (56%), Gaps = 12/71 (16%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---YVYKPPTPP--PYESPP---YVYKPPTPP---PYVYESPP 33 Y Y P PP Y Y SPP Y YK P PP Y+SPP Y YK P PP PY Y SPP Sbjct: 24 YKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVKKPYKYTSPP 83 Query: 32 Y-VYKPPTPPP 3 VYK +PPP Sbjct: 84 PPVYKYNSPPP 94 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKPPTP 9 Y YK P PP Y YKSPP PP PY+ Y P PP Y Y SPP Y YK P P Sbjct: 1 YKYKSPPPPVYKYKSPP----PPVKKPYK-----YSSPPPPVYKYNSPPPPVYKYKSPPP 51 Query: 8 P 6 P Sbjct: 52 P 52 Score = 57.8 bits (138), Expect(2) = 2e-07 Identities = 34/65 (52%), Positives = 36/65 (55%), Gaps = 12/65 (18%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP------YVYKPPTPPPYE--SPP---YVYKPPTPPPYVYES-P 36 Y YK P PP Y YKSPP Y Y P PP Y+ SPP Y YK P P Y Y+S P Sbjct: 54 YKYKSPPPPVYKYKSPPPPVKKPYKYTSPPPPVYKYNSPPPPVYKYKSPXTPIYKYKSPP 113 Query: 35 PYVYK 21 P VYK Sbjct: 114 PXVYK 118 Score = 20.8 bits (42), Expect(2) = 2e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP Y Y+SP Sbjct: 39 PPPPVYKYKSP 49 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 11/67 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPP-----PYESPP---YVYKPPTPPPYVYESPP---YV 27 YK +PPP VYK YK P PP Y SPP Y Y P PP Y Y+SPP Y Sbjct: 1 YKYKSPPPPVYK-----YKSPPPPVKKPYKYSSPPPPVYKYNSPPPPVYKYKSPPPPVYK 55 Query: 26 YKPPTPP 6 YK P PP Sbjct: 56 YKSPPPP 62 [81][TOP] >UniRef100_A3B8S8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3B8S8_ORYSJ Length = 258 Score = 67.0 bits (162), Expect = 6e-10 Identities = 42/84 (50%), Positives = 45/84 (53%), Gaps = 13/84 (15%) Frame = -3 Query: 218 HQHLPH---MCMNHHSYVYKPPTP-----PPYVYKSPPYV--YKPPTPPPYESPPYVYKP 69 H H P C + H Y PPTP PPYV PPYV Y PP PPY PPY+ P Sbjct: 62 HHHKPPPSPRCPSCHP-PYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPY-VPPYI-PP 118 Query: 68 PTP---PPYVYESPPYVYKPPTPP 6 PTP PPY+ SPP PPTPP Sbjct: 119 PTPPYVPPYIPPSPPPYVPPPTPP 142 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/60 (53%), Positives = 36/60 (60%), Gaps = 4/60 (6%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYV----YESPPYVYKPPTPP 6 Y PP PPYV PPY+ PP+PPPY PP PP+PPPYV SPP PP+PP Sbjct: 115 YIPPPTPPYV---PPYI--PPSPPPYVPPP---TPPSPPPYVPPPTPPSPPPYVPPPSPP 166 Score = 57.4 bits (137), Expect = 5e-07 Identities = 37/78 (47%), Positives = 42/78 (53%), Gaps = 16/78 (20%) Frame = -3 Query: 188 HHSYVYKPPTP------PPYVYKSPPYVYKPPTPPPYES-PPYV--YKPPTPPPYV---- 48 HH + PP+P PPY +PP PPTPP S PPYV Y PP PPYV Sbjct: 60 HHHHHKPPPSPRCPSCHPPY---TPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYI 116 Query: 47 -YESPPYV--YKPPTPPP 3 +PPYV Y PP+PPP Sbjct: 117 PPPTPPYVPPYIPPSPPP 134 [82][TOP] >UniRef100_Q9FS16 Extensin-3 n=1 Tax=Arabidopsis thaliana RepID=EXTN3_ARATH Length = 427 Score = 67.0 bits (162), Expect = 6e-10 Identities = 45/94 (47%), Positives = 45/94 (47%), Gaps = 35/94 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 312 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 371 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPPP 3 P P PP VY SPP YVYK P PPP Sbjct: 372 SPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPP 405 Score = 65.9 bits (159), Expect = 1e-09 Identities = 41/85 (48%), Positives = 43/85 (50%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 340 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYK 399 Query: 71 PPTPPPYVYESP---PYVYKPPTPP 6 P PPP + SP PY+YK P PP Sbjct: 400 SPPPPPVHHYSPPHHPYLYKSPPPP 424 Score = 64.3 bits (155), Expect = 4e-09 Identities = 44/93 (47%), Positives = 44/93 (47%), Gaps = 35/93 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 88 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 147 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPP 6 P P PP VY SPP YVYK P PP Sbjct: 148 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 180 Score = 64.3 bits (155), Expect = 4e-09 Identities = 44/93 (47%), Positives = 44/93 (47%), Gaps = 35/93 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 116 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 175 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPP 6 P P PP VY SPP YVYK P PP Sbjct: 176 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 208 Score = 64.3 bits (155), Expect = 4e-09 Identities = 44/93 (47%), Positives = 44/93 (47%), Gaps = 35/93 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 144 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 203 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPP 6 P P PP VY SPP YVYK P PP Sbjct: 204 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 236 Score = 64.3 bits (155), Expect = 4e-09 Identities = 44/93 (47%), Positives = 44/93 (47%), Gaps = 35/93 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 172 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 231 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPP 6 P P PP VY SPP YVYK P PP Sbjct: 232 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 264 Score = 64.3 bits (155), Expect = 4e-09 Identities = 44/93 (47%), Positives = 44/93 (47%), Gaps = 35/93 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 200 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 259 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPP 6 P P PP VY SPP YVYK P PP Sbjct: 260 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 292 Score = 64.3 bits (155), Expect = 4e-09 Identities = 44/93 (47%), Positives = 44/93 (47%), Gaps = 35/93 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 228 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 287 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPP 6 P P PP VY SPP YVYK P PP Sbjct: 288 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 320 Score = 64.3 bits (155), Expect = 4e-09 Identities = 44/93 (47%), Positives = 44/93 (47%), Gaps = 35/93 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 256 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 315 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPP 6 P P PP VY SPP YVYK P PP Sbjct: 316 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 348 Score = 64.3 bits (155), Expect = 4e-09 Identities = 44/93 (47%), Positives = 44/93 (47%), Gaps = 35/93 (37%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 YVYK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 284 YVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYK 343 Query: 71 PPTP------PPYVYESPP-----YVYKPPTPP 6 P P PP VY SPP YVYK P PP Sbjct: 344 SPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 376 Score = 63.5 bits (153), Expect = 7e-09 Identities = 40/76 (52%), Positives = 41/76 (53%), Gaps = 19/76 (25%) Frame = -3 Query: 176 VYKPPTPPP--YVYKSPPYVYKPPTPPP-YESPP-----YVYKPPTP------PPYVYES 39 VY P PP YVYKSPP K +PPP Y SPP YVYK P P PP VY S Sbjct: 77 VYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 136 Query: 38 PP-----YVYKPPTPP 6 PP YVYK P PP Sbjct: 137 PPPPKKHYVYKSPPPP 152 Score = 62.0 bits (149), Expect = 2e-08 Identities = 38/82 (46%), Positives = 42/82 (51%), Gaps = 12/82 (14%) Frame = -3 Query: 212 HLPHMCMNHHSYVYKPPT----PPPYVYKSPP-----YVYKPPTPP-PYESPPYVYKPPT 63 H P H+ Y PP PP VY SPP YVYK P PP + SPP VY P Sbjct: 51 HSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 110 Query: 62 PPP--YVYESPPYVYKPPTPPP 3 PP YVY+SPP K +PPP Sbjct: 111 PPKKHYVYKSPPPPVKHYSPPP 132 Score = 61.2 bits (147), Expect = 3e-08 Identities = 39/76 (51%), Positives = 40/76 (52%), Gaps = 19/76 (25%) Frame = -3 Query: 176 VYKPPTPPP--YVYKSPPYVYKPPTPPP-YESPP-----YVYKPPTP------PPYVYES 39 VY P PP Y YKSPP K +PPP Y SPP YVYK P P PP VY S Sbjct: 49 VYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHS 108 Query: 38 PP-----YVYKPPTPP 6 PP YVYK P PP Sbjct: 109 PPPPKKHYVYKSPPPP 124 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/68 (50%), Positives = 37/68 (54%), Gaps = 11/68 (16%) Frame = -3 Query: 173 YKPPTP---PPYVYKSPP-----YVYKPPTPP-PYESPPYVYKPPTPPP--YVYESPPYV 27 Y PP PP VY SPP Y YK P PP + SPP VY P PP YVY+SPP Sbjct: 37 YTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 96 Query: 26 YKPPTPPP 3 K +PPP Sbjct: 97 VKHYSPPP 104 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/64 (46%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPP-----YVYKPPTPPPYVYESPPYVYKP 18 +Y Y P PP Y P Y PP P Y SPP Y YK P PPP + SPP VY Sbjct: 24 NYFYSSPPPPVKHYTPPVKHYSPP--PVYHSPPPPKKHYEYKSP-PPPVKHYSPPPVYHS 80 Query: 17 PTPP 6 P PP Sbjct: 81 PPPP 84 [83][TOP] >UniRef100_A3KD22 Leucine-rich repeat/extensin 1 n=1 Tax=Nicotiana tabacum RepID=A3KD22_TOBAC Length = 723 Score = 63.5 bits (153), Expect(2) = 8e-10 Identities = 31/62 (50%), Positives = 34/62 (54%), Gaps = 7/62 (11%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVY----ESPPYVY---KPPTP 9 PP PPP Y+ PPY + P PPP P Y P +PPP VY PP VY KPPTP Sbjct: 535 PPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTP 594 Query: 8 PP 3 P Sbjct: 595 TP 596 Score = 23.1 bits (48), Expect(2) = 8e-10 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP YE P Sbjct: 517 PPPPPPVHYEPP 528 Score = 63.2 bits (152), Expect(2) = 6e-09 Identities = 32/66 (48%), Positives = 36/66 (54%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPP------YESPPYV-YKPPTPPPYVYESPPYVYK 21 Y + P PP VY +PP YKP +PPP YE P Y PP PPP YE PPY + Sbjct: 493 YHHPSPPPPQPVYYAPP-TYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQ 551 Query: 20 PPTPPP 3 P PPP Sbjct: 552 SPPPPP 557 Score = 20.4 bits (41), Expect(2) = 6e-09 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP SP Sbjct: 449 PPPPPPVYSSSP 460 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPP---YESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP Y+ P Y + P PPP YE PPY + P PPP YE P Y P +PPP Sbjct: 517 PPPPPPVHYEPPTYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYT--PQSPPP 572 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/59 (49%), Positives = 33/59 (55%), Gaps = 5/59 (8%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPP-----YESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PP PPP V+ PP Y P +PPP YE PPY + P PPP YE P Y + P PP Sbjct: 516 PPPPPPPVHYEPP-TYTPQSPPPPPPVHYEPPPYTPQSPPPPPVHYEPPTYTPQSPPPP 573 Score = 54.7 bits (130), Expect(2) = 4e-07 Identities = 30/71 (42%), Positives = 32/71 (45%), Gaps = 15/71 (21%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPP---------------TPPPYESPPYVYKPPTPPPYVYESP 36 KPPTP P SPP Y PP TPPP S P+ P+PPP SP Sbjct: 590 KPPTPTP----SPPAGYTPPQEPSHPAPPTPPCNETPPPPPSTPHWQPKPSPPPTYNPSP 645 Query: 35 PYVYKPPTPPP 3 Y PP PPP Sbjct: 646 SYTQSPPPPPP 656 Score = 22.7 bits (47), Expect(2) = 4e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P +PPP VYE P Sbjct: 578 PSSPPPPVYEHP 589 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPP---YESPPYVY-KPPTPPPYVYESPPYVYKPPTPPP 3 P+PPP SP Y PP PPP Y SPP PP PP Y Y SPP PP+PPP Sbjct: 635 PSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSSSPP-PPTYYYSSPP--PPPPSPPP 689 Score = 51.2 bits (121), Expect(2) = 3e-06 Identities = 29/65 (44%), Positives = 32/65 (49%), Gaps = 7/65 (10%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPP----PYESPPYVY---KPPTPPPYVYESPPYVYK 21 Y + P PPP Y+ P Y + P PP P PP VY KPPTP P SPP Y Sbjct: 548 YTPQSPPPPPVHYEPPTYTPQSPPPPVYVTPSSPPPPVYEHPKPPTPTP----SPPAGYT 603 Query: 20 PPTPP 6 PP P Sbjct: 604 PPQEP 608 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP YE P Sbjct: 535 PPPPPPVHYEPP 546 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -3 Query: 161 TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPY-VYESPPYVYKPPTPPP 3 +PPP +K P P PPP SP Y + P PPP VY +PP YKP +PPP Sbjct: 466 SPPPPTHKISPVTRHAPPPPPPPSPVYYHHPSPPPPQPVYYAPP-TYKPQSPPP 518 [84][TOP] >UniRef100_Q41848 36.4 kDa proline-rich protein n=1 Tax=Zea mays RepID=Q41848_MAIZE Length = 301 Score = 66.6 bits (161), Expect = 8e-10 Identities = 41/66 (62%), Positives = 41/66 (62%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPPTP---PPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP---PPYVYESPPYVYK 21 Y PPTP PPYV PPYV PPTP PPY PPYV PPTP PPYV PPYV Sbjct: 92 YVPPTPRPSPPYV---PPYVPVPPTPRPSPPYV-PPYVPVPPTPRPSPPYV---PPYVPV 144 Query: 20 PPTPPP 3 PPTP P Sbjct: 145 PPTPRP 150 Score = 65.9 bits (159), Expect = 1e-09 Identities = 41/66 (62%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTP---PPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP----PPYVYESPPYVYK 21 YV PPTP PPYV PPYV PPTP P SPPYV PPTP PPYV +PPYV Sbjct: 124 YVPVPPTPRPSPPYV---PPYVPVPPTPRP--SPPYV--PPTPRPPTPPYVPPTPPYV-- 174 Query: 20 PPTPPP 3 PPTP P Sbjct: 175 PPTPRP 180 Score = 64.3 bits (155), Expect = 4e-09 Identities = 40/65 (61%), Positives = 40/65 (61%), Gaps = 8/65 (12%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYV--YKPPTP---PPYESPPYVYKPPTP---PPYVYESPPYVYKP 18 Y PPTP P SPPYV Y PPTP PPY PPYV PPTP PPYV PPYV P Sbjct: 77 YVPPTPRP----SPPYVPPYVPPTPRPSPPYV-PPYVPVPPTPRPSPPYV---PPYVPVP 128 Query: 17 PTPPP 3 PTP P Sbjct: 129 PTPRP 133 Score = 64.3 bits (155), Expect = 4e-09 Identities = 39/64 (60%), Positives = 40/64 (62%), Gaps = 8/64 (12%) Frame = -3 Query: 173 YKPPTP----PPYVYKSPPYVYKPPTPPPYESPPYV--YKPPTPPPYVYESPPYV--YKP 18 Y PPTP PPYV +PPYV PPTP P PPYV Y PPTP P SPPYV Y P Sbjct: 154 YVPPTPRPPTPPYVPPTPPYV--PPTPRP-SPPPYVPPYVPPTPRP----SPPYVPPYVP 206 Query: 17 PTPP 6 PTPP Sbjct: 207 PTPP 210 [85][TOP] >UniRef100_C6TN18 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TN18_SOYBN Length = 143 Score = 66.6 bits (161), Expect = 8e-10 Identities = 37/66 (56%), Positives = 41/66 (62%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYV---YESPPYVYKPP 15 +YKPP PP VY+ PPY PP PPYE PP VY+PP PPP YE PP VY+PP Sbjct: 58 LYKPPFYPPPVYQ-PPYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPP 116 Query: 14 T--PPP 3 PPP Sbjct: 117 NEKPPP 122 Score = 60.8 bits (146), Expect = 4e-08 Identities = 36/74 (48%), Positives = 43/74 (58%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPT---PPPYVYKSPPYVYKPPT------PPPYESPPYVYKPP--TPPPYV---YES 39 +Y+PP PPP ++PP +YKPP PPYE PP VY+PP PPP YE Sbjct: 40 IYEPPPSYEPPPT--ENPPPLYKPPFYPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPYEK 97 Query: 38 PPYVYKPP--TPPP 3 PP VY+PP PPP Sbjct: 98 PPPVYQPPYEKPPP 111 Score = 57.8 bits (138), Expect = 4e-07 Identities = 33/73 (45%), Positives = 40/73 (54%), Gaps = 18/73 (24%) Frame = -3 Query: 176 VYKPP--TPPPYV---YKSPPYVYKPPTP-------PPYESPPYVYKPPT---PPPY--- 51 VY+PP PPP Y+ PP VY+PP PPYE PP VY+PP PP Y Sbjct: 68 VYQPPYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPNEKPPPEYQPP 127 Query: 50 VYESPPYVYKPPT 12 +Y PPY + PP+ Sbjct: 128 IYNPPPYGHYPPS 140 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/61 (50%), Positives = 37/61 (60%), Gaps = 6/61 (9%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYV----YESPPYVYKPP--TPP 6 PP P +Y+ PP Y+ PPP E+PP +YKPP PP V YE PP VY+PP PP Sbjct: 33 PPIEKPPIYEPPP-SYE---PPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQPPYEKPP 88 Query: 5 P 3 P Sbjct: 89 P 89 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/58 (48%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPT---PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP P + PP +Y+PP PPP E+PP +YKPP PP VY+ PPY PP P Sbjct: 27 PPIYEPPPIEKPP-IYEPPPSYEPPPTENPPPLYKPPFYPPPVYQ-PPYEKPPPVYQP 82 [86][TOP] >UniRef100_Q40402 Extensin (ext) n=1 Tax=Nicotiana plumbaginifolia RepID=Q40402_NICPL Length = 416 Score = 66.2 bits (160), Expect = 1e-09 Identities = 36/64 (56%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 H S VYK P PP VYKSPP KP P+P PY P VYK P PP VY+SPP KP Sbjct: 305 HPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPAP-VYKSPPPPTPVYKSPPPPVKPY 363 Query: 14 TPPP 3 P P Sbjct: 364 HPSP 367 Score = 65.9 bits (159), Expect = 1e-09 Identities = 36/64 (56%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 H S VYK P PP VYKSPP KP P+P PY P VYK P PP VY+SPP KP Sbjct: 239 HPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSP-VYKSPPPPTPVYKSPPPPKKPY 297 Query: 14 TPPP 3 P P Sbjct: 298 HPSP 301 Score = 65.9 bits (159), Expect = 1e-09 Identities = 36/64 (56%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 H S VYK P PP VYKSPP KP P+P PY P VYK P PP VY+SPP KP Sbjct: 272 HPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSP-VYKSPPPPTPVYKSPPPPKKPY 330 Query: 14 TPPP 3 P P Sbjct: 331 HPSP 334 Score = 65.5 bits (158), Expect = 2e-09 Identities = 35/63 (55%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 H+ VYK P PP VYKSPP KP P+P PY P VYK P PP VY+SPP KP Sbjct: 207 HTPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSP-VYKSPPPPTPVYKSPPPPKKPYH 265 Query: 11 PPP 3 P P Sbjct: 266 PSP 268 Score = 65.1 bits (157), Expect = 2e-09 Identities = 39/76 (51%), Positives = 43/76 (56%), Gaps = 15/76 (19%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKP--PTPPPY------ESPP---YVYKPPTPPPYVYE 42 H + VYK P PP VYKSPP KP P+P PY +SPP VYK P PP VY+ Sbjct: 338 HPAPVYKSPPPPTPVYKSPPPPVKPYHPSPTPYHPAPVYKSPPPPTPVYKSPPPPTPVYK 397 Query: 41 SP----PYVYKPPTPP 6 SP PYVY P PP Sbjct: 398 SPPPHHPYVYASPPPP 413 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/60 (53%), Positives = 34/60 (56%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 H+ VYK P PP VYKSPP PP P Y VYK P PP VY+SPP KP PP Sbjct: 77 HTPVYKSPPPPTPVYKSPP----PPKKPHYPPHTPVYKSPPPPTPVYKSPPSPKKPHYPP 132 Score = 60.8 bits (146), Expect = 4e-08 Identities = 36/75 (48%), Positives = 39/75 (52%), Gaps = 14/75 (18%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKP---PTPPPYESPPY-----------VYKPPTPPPYV 48 H+ VYK P PP VYKSPP KP P P Y+SPP VYK P PP V Sbjct: 161 HTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPV 220 Query: 47 YESPPYVYKPPTPPP 3 Y+SPP KP P P Sbjct: 221 YKSPPPPKKPYHPSP 235 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/60 (55%), Positives = 36/60 (60%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 H+ VYK P PP VYKSPP KP PP +P VYK P PP VY+SPP KP PP Sbjct: 105 HTPVYKSPPPPTPVYKSPPSPKKPHYPP--HTP--VYKSPPPPTPVYKSPPPPKKPHYPP 160 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/68 (52%), Positives = 39/68 (57%), Gaps = 8/68 (11%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKP---PTPPPYESPPY---VYKPPTPPPYVYESPPY-- 30 H+ VYK P PP VYKSPP KP P P Y+SPP VYK P PPP PP+ Sbjct: 133 HTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPVYKSPPPPTPVYKSP-PPPKKPHYPPHTP 191 Query: 29 VYKPPTPP 6 VYK P PP Sbjct: 192 VYKSPPPP 199 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/57 (54%), Positives = 32/57 (56%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PP VYKSPP PP P Y VYK P PP VY+SPP KP PP Sbjct: 52 VYKSPPPPIPVYKSPP----PPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPHYPP 104 Score = 53.5 bits (127), Expect = 7e-06 Identities = 37/74 (50%), Positives = 40/74 (54%), Gaps = 17/74 (22%) Frame = -3 Query: 176 VYKPPTPP--PYVYKSPPY----VYKPPTPPP--YESPPYVYKP--PTPPPY----VYES 39 VYK P PP PY PY VYK P PP Y+SPP KP P+P PY VY+S Sbjct: 220 VYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKS 279 Query: 38 PP---YVYKPPTPP 6 PP VYK P PP Sbjct: 280 PPPPTPVYKSPPPP 293 Score = 53.5 bits (127), Expect = 7e-06 Identities = 37/74 (50%), Positives = 40/74 (54%), Gaps = 17/74 (22%) Frame = -3 Query: 176 VYKPPTPP--PYVYKSPPY----VYKPPTPPP--YESPPYVYKP--PTPPPY----VYES 39 VYK P PP PY PY VYK P PP Y+SPP KP P+P PY VY+S Sbjct: 253 VYKSPPPPKKPYHPSPTPYHPSPVYKSPPPPTPVYKSPPPPKKPYHPSPTPYHPSPVYKS 312 Query: 38 PP---YVYKPPTPP 6 PP VYK P PP Sbjct: 313 PPPPTPVYKSPPPP 326 [87][TOP] >UniRef100_Q06802 Extensin n=1 Tax=Nicotiana tabacum RepID=Q06802_TOBAC Length = 318 Score = 66.2 bits (160), Expect = 1e-09 Identities = 37/65 (56%), Positives = 42/65 (64%), Gaps = 6/65 (9%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPY--VYKPPTPP--PYESPPY--VYKPPTPPPYVYESPPYVYK 21 SY+YK P PP +VY SPP+ VYK P PP PY PP+ VYK P PP VY+SPP K Sbjct: 39 SYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPY-YPPHTPVYKSPPPPTPVYKSPPPPKK 97 Query: 20 PPTPP 6 P PP Sbjct: 98 PYYPP 102 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/63 (57%), Positives = 39/63 (61%), Gaps = 7/63 (11%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPPYVYESP----PYVY-KP 18 VYK P PP VYKSPP KP P+P PY P VYK P PP VY+SP PYVY P Sbjct: 254 VYKSPPPPTPVYKSPPPPKKPYYPSPTPYHPAP-VYKSPPPPTPVYKSPPPHHPYVYASP 312 Query: 17 PTP 9 P+P Sbjct: 313 PSP 315 Score = 62.4 bits (150), Expect(2) = 1e-08 Identities = 36/74 (48%), Positives = 39/74 (52%), Gaps = 14/74 (18%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPY-----------VYKPPTPPPYV 48 H+ VYK P PP VYKSPP Y PP P Y+SPP VYK P PP V Sbjct: 75 HTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPV 134 Query: 47 YESPPYVYKPPTPP 6 Y+SPP KP PP Sbjct: 135 YKSPPPPKKPYYPP 148 Score = 20.4 bits (41), Expect(2) = 1e-08 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP +VY SP Sbjct: 45 PPPPVHVYPSP 55 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/74 (48%), Positives = 39/74 (52%), Gaps = 14/74 (18%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPY-----------VYKPPTPPPYV 48 H+ VYK P PP VYKSPP Y PP P Y+SPP VYK P PP V Sbjct: 149 HTPVYKSPPPPTPVYKSPPPHKKPYYPPHTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPV 208 Query: 47 YESPPYVYKPPTPP 6 Y+SPP KP PP Sbjct: 209 YKSPPPPKKPYYPP 222 Score = 62.4 bits (150), Expect = 2e-08 Identities = 40/77 (51%), Positives = 43/77 (55%), Gaps = 17/77 (22%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPY---VYKPPTPP--PY------V 48 H+ VYK P PP VYKSPP Y PP P Y+SPP VYK P PP PY V Sbjct: 195 HTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPYTPV 254 Query: 47 YESPP---YVYKPPTPP 6 Y+SPP VYK P PP Sbjct: 255 YKSPPPPTPVYKSPPPP 271 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/63 (55%), Positives = 37/63 (58%), Gaps = 2/63 (3%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPY--VYKPPTPPPYVYESPPYVYKPPT 12 H+ VYK P PP VYKSPP PP P Y PPY VYK P PP VY+SPP KP Sbjct: 223 HTPVYKSPPPPTPVYKSPP----PPKKPYY--PPYTPVYKSPPPPTPVYKSPPPPKKPYY 276 Query: 11 PPP 3 P P Sbjct: 277 PSP 279 Score = 59.3 bits (142), Expect = 1e-07 Identities = 40/75 (53%), Positives = 43/75 (57%), Gaps = 15/75 (20%) Frame = -3 Query: 185 HSYVYKPPTPP--PY------VYKSPPY---VYKPPTPP--PYESPPY--VYKPPTPPPY 51 H+ VYK P PP PY VYKSPP VYK P PP PY PP+ VYK P PP Sbjct: 177 HTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPY-YPPHTPVYKSPPPPTP 235 Query: 50 VYESPPYVYKPPTPP 6 VY+SPP KP PP Sbjct: 236 VYKSPPPPKKPYYPP 250 Score = 58.9 bits (141), Expect = 2e-07 Identities = 40/75 (53%), Positives = 43/75 (57%), Gaps = 15/75 (20%) Frame = -3 Query: 185 HSYVYKPPTPP--PY------VYKSPPY---VYKPPTPP--PYESPPY--VYKPPTPPPY 51 H+ VYK P PP PY VYKSPP VYK P PP PY PP+ VYK P PP Sbjct: 103 HTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPY-YPPHTPVYKSPPPPTP 161 Query: 50 VYESPPYVYKPPTPP 6 VY+SPP KP PP Sbjct: 162 VYKSPPPHKKPYYPP 176 Score = 58.9 bits (141), Expect = 2e-07 Identities = 37/74 (50%), Positives = 41/74 (55%), Gaps = 14/74 (18%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP---YVYKPPTPPPYESPPY---VYKPPTP------PPY--V 48 H+ VYK P PP VYKSPP Y PP P Y+SPP VYK P P PP+ V Sbjct: 121 HTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPHKKPYYPPHTPV 180 Query: 47 YESPPYVYKPPTPP 6 Y+SPP KP PP Sbjct: 181 YKSPPPPKKPYYPP 194 Score = 55.5 bits (132), Expect = 2e-06 Identities = 44/86 (51%), Positives = 46/86 (53%), Gaps = 26/86 (30%) Frame = -3 Query: 185 HSYVYKPPTPP--PY------VYKSPPY---VYKPPTPP--PYESPPY--VYKPPTPP-- 57 H VYK P PP PY VYKSPP VYK P PP PY PP+ VYK P PP Sbjct: 57 HHPVYKSPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPY-YPPHTPVYKSPPPPKK 115 Query: 56 PY------VYESPP---YVYKPPTPP 6 PY VY+SPP VYK P PP Sbjct: 116 PYYPPHTPVYKSPPPPTPVYKSPPPP 141 [88][TOP] >UniRef100_C5Z4Z5 Putative uncharacterized protein Sb10g004790 n=1 Tax=Sorghum bicolor RepID=C5Z4Z5_SORBI Length = 324 Score = 66.2 bits (160), Expect = 1e-09 Identities = 40/65 (61%), Positives = 40/65 (61%), Gaps = 9/65 (13%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYV--YKPPTPPPYESPPYV--YKPPTP---PPYVYESPPYV--YK 21 Y PP PP SPPYV Y PPTP P SPPYV Y PPTP PP V SPPYV Y Sbjct: 164 YVPPYVPPTPRPSPPYVPPYVPPTPRP--SPPYVPPYVPPTPRPSPPNVPPSPPYVPPYV 221 Query: 20 PPTPP 6 PPTPP Sbjct: 222 PPTPP 226 Score = 62.8 bits (151), Expect = 1e-08 Identities = 45/86 (52%), Positives = 45/86 (52%), Gaps = 14/86 (16%) Frame = -3 Query: 218 HQHLPHMCM---NHHSYVYK-PPTPPPYV----YKSPPYV--YKPPTPPPYESPPYV--Y 75 H H PH HH PP PPYV SPPYV Y PPTP P SPPYV Y Sbjct: 66 HSHPPHHGKPPKRHHGPPSNCPPCNPPYVPPTPRPSPPYVPPYVPPTPRP--SPPYVPPY 123 Query: 74 KPPTPPPYVYESPPYV--YKPPTPPP 3 PPTP P SPPYV Y PPTP P Sbjct: 124 VPPTPRP----SPPYVPPYVPPTPRP 145 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/63 (60%), Positives = 38/63 (60%), Gaps = 6/63 (9%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYV--YKPPTPPPYESPPYV--YKPPTPPPYVYESPPYV--YKPPT 12 Y PP PP SPPYV Y PPTP P SPPYV Y PPTP P SPPYV Y PPT Sbjct: 134 YVPPYVPPTPRPSPPYVPPYVPPTPRP--SPPYVPPYVPPTPRP----SPPYVPPYVPPT 187 Query: 11 PPP 3 P P Sbjct: 188 PRP 190 Score = 61.6 bits (148), Expect = 3e-08 Identities = 42/74 (56%), Positives = 42/74 (56%), Gaps = 17/74 (22%) Frame = -3 Query: 173 YKPPTP---PPYV--------YKSPPYV--YKPPTPPPYESPPYV--YKPPTPPPYVYES 39 Y PPTP PPYV SPPYV Y PPTP P SPPYV Y PPTP P S Sbjct: 93 YVPPTPRPSPPYVPPYVPPTPRPSPPYVPPYVPPTPRP--SPPYVPPYVPPTPRP----S 146 Query: 38 PPYV--YKPPTPPP 3 PPYV Y PPTP P Sbjct: 147 PPYVPPYVPPTPRP 160 Score = 59.7 bits (143), Expect = 1e-07 Identities = 40/76 (52%), Positives = 40/76 (52%), Gaps = 19/76 (25%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYV--YKPPTP---PPY----------ESPPYV--YKPPTPPPYVY 45 Y PP PP SPPYV Y PPTP PPY SPPYV Y PPTP P Sbjct: 104 YVPPYVPPTPRPSPPYVPPYVPPTPRPSPPYVPPYVPPTPRPSPPYVPPYVPPTPRP--- 160 Query: 44 ESPPYV--YKPPTPPP 3 SPPYV Y PPTP P Sbjct: 161 -SPPYVPPYVPPTPRP 175 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/59 (59%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYV--YKPPTPPPYESPPYV-YKPPTPPPYVYESPPYVYKPPTPP 6 Y PP PP SPPYV Y PPTP P SPP V PP PPYV +PPYV PPTPP Sbjct: 179 YVPPYVPPTPRPSPPYVPPYVPPTPRP--SPPNVPPSPPYVPPYVPPTPPYV--PPTPP 233 [89][TOP] >UniRef100_B6TS19 36.4 kDa proline-rich protein n=1 Tax=Zea mays RepID=B6TS19_MAIZE Length = 284 Score = 65.9 bits (159), Expect(2) = 1e-09 Identities = 41/66 (62%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTP---PPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP----PPYVYESPPYVYK 21 YV PPTP PPYV PPYV PPTP P SPPYV PPTP PPYV +PPYV Sbjct: 108 YVPVPPTPRPSPPYV---PPYVPVPPTPRP--SPPYV--PPTPRPPTPPYVPPTPPYV-- 158 Query: 20 PPTPPP 3 PPTP P Sbjct: 159 PPTPRP 164 Score = 20.4 bits (41), Expect(2) = 1e-09 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPYV +P Sbjct: 71 PPCTPPYVPPTP 82 Score = 65.9 bits (159), Expect = 1e-09 Identities = 40/64 (62%), Positives = 41/64 (64%), Gaps = 8/64 (12%) Frame = -3 Query: 173 YKPPTP----PPYVYKSPPYVYKPPTPPPYESPPYV--YKPPTPPPYVYESPPYV--YKP 18 Y PPTP PPYV +PPYV PPTP P SPPYV Y PPTP P SPPYV Y P Sbjct: 138 YVPPTPRPPTPPYVPPTPPYV--PPTPRP--SPPYVPPYVPPTPRP----SPPYVPPYVP 189 Query: 17 PTPP 6 PTPP Sbjct: 190 PTPP 193 Score = 64.7 bits (156), Expect = 3e-09 Identities = 42/76 (55%), Positives = 43/76 (56%), Gaps = 13/76 (17%) Frame = -3 Query: 191 NHHSYVYK-PPTPPPYV----YKSPPYV--YKPPTP---PPYESPPYVYKPPTP---PPY 51 +HH K PP PPYV SPPYV Y PPTP PP PPYV PPTP PPY Sbjct: 62 HHHGKPPKCPPCTPPYVPPTPRPSPPYVPPYVPPTPRPSPPPYVPPYVPVPPTPRPSPPY 121 Query: 50 VYESPPYVYKPPTPPP 3 V PPYV PPTP P Sbjct: 122 V---PPYVPVPPTPRP 134 [90][TOP] >UniRef100_Q9M564 CRANTZ hydroxyproline-rich glycoprotein n=1 Tax=Manihot esculenta RepID=Q9M564_MANES Length = 232 Score = 62.0 bits (149), Expect(2) = 1e-09 Identities = 37/81 (45%), Positives = 39/81 (48%), Gaps = 23/81 (28%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYESPP---YVYKPPTP-- 60 Y YK P PP PY YKSPP Y Y P PPP +SPP Y + PP P Sbjct: 18 YYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSP-PPPVKSPPPPYYYHSPPPPVK 76 Query: 59 ---PPYVYESPPYVYKPPTPP 6 PPY Y SPP K P PP Sbjct: 77 SPPPPYYYHSPPPPVKSPPPP 97 Score = 24.3 bits (51), Expect(2) = 1e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 12 PSPPPPYYYKSP 23 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 51 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 109 Query: 17 PTPP 6 P PP Sbjct: 110 PPPP 113 Score = 24.3 bits (51), Expect(2) = 2e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 28 PSPPPPYYYKSP 39 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 67 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 125 Query: 17 PTPP 6 P PP Sbjct: 126 PPPP 129 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y SP Sbjct: 44 PSPPPPYYYHSP 55 Score = 63.9 bits (154), Expect = 5e-09 Identities = 34/70 (48%), Positives = 34/70 (48%), Gaps = 16/70 (22%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK-PPTPPPYESPPYVYKPP------TPPPYVYESP 36 P PPPY YKS PPY YK PP P P PPY Y P PPPY Y SP Sbjct: 12 PSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPVKSPPPPYYYHSP 71 Query: 35 PYVYKPPTPP 6 P K P PP Sbjct: 72 PPPVKSPPPP 81 Score = 61.2 bits (147), Expect(2) = 8e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 83 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 141 Query: 17 PTPP 6 P PP Sbjct: 142 PPPP 145 Score = 61.2 bits (147), Expect(2) = 8e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 99 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 157 Query: 17 PTPP 6 P PP Sbjct: 158 PPPP 161 Score = 61.2 bits (147), Expect(2) = 8e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 115 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 173 Query: 17 PTPP 6 P PP Sbjct: 174 PPPP 177 Score = 61.2 bits (147), Expect(2) = 8e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 131 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 189 Query: 17 PTPP 6 P PP Sbjct: 190 PPPP 193 Score = 61.2 bits (147), Expect(2) = 8e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 147 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 205 Query: 17 PTPP 6 P PP Sbjct: 206 PPPP 209 Score = 61.2 bits (147), Expect(2) = 8e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 163 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 221 Query: 17 PTPP 6 P PP Sbjct: 222 PPPP 225 Score = 21.9 bits (45), Expect(2) = 8e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 63 PPPYYYHSP 71 Score = 21.9 bits (45), Expect(2) = 8e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 79 PPPYYYHSP 87 Score = 21.9 bits (45), Expect(2) = 8e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 95 PPPYYYHSP 103 Score = 21.9 bits (45), Expect(2) = 8e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 111 PPPYYYHSP 119 Score = 21.9 bits (45), Expect(2) = 8e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 127 PPPYYYHSP 135 Score = 21.9 bits (45), Expect(2) = 8e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 143 PPPYYYHSP 151 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPPY-ESPPYVYKPPTPPPYVYESP 36 Y + PP P PPY Y SPP K P PP Y SPP K P PP Y+Y SP Sbjct: 179 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPVYIYASP 232 Score = 21.9 bits (45), Expect(2) = 2e-06 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 159 PPPYYYHSP 167 [91][TOP] >UniRef100_P06599 Extensin n=1 Tax=Daucus carota RepID=EXTN_DAUCA Length = 306 Score = 65.5 bits (158), Expect(2) = 1e-09 Identities = 34/73 (46%), Positives = 38/73 (52%), Gaps = 14/73 (19%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPP------------YVYKPPTPPPYESPPY--VYKPPTPPPYV 48 H Y YK P PP VYKSPP Y YK P PP + PP VYK +PPP + Sbjct: 219 HHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYKSPPPPMHSPPPPTPVYKYKSPPPPM 278 Query: 47 YESPPYVYKPPTP 9 + PP VY PP P Sbjct: 279 HSPPPPVYSPPPP 291 Score = 20.4 bits (41), Expect(2) = 1e-09 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P Y Y+SP Sbjct: 185 PPPTPVYKYKSP 196 Score = 64.3 bits (155), Expect(2) = 3e-09 Identities = 37/84 (44%), Positives = 41/84 (48%), Gaps = 22/84 (26%) Frame = -3 Query: 191 NHHSYVYKPPTPPP--YVYKSPP-----YVYKPPTPPPYESPP---YVYKPPTPPPYVYE 42 +H+ Y YK P PP Y YKSPP Y YK P PP + P Y YK P PP VY+ Sbjct: 175 HHYKYKYKSPPPPTPVYKYKSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSPPPPTPVYK 234 Query: 41 SPP------------YVYKPPTPP 6 SPP Y YK P PP Sbjct: 235 SPPPPEHSPPPPTPVYKYKSPPPP 258 Score = 20.4 bits (41), Expect(2) = 3e-09 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P Y Y+SP Sbjct: 135 PPPTPVYKYKSP 146 Score = 58.5 bits (140), Expect(2) = 7e-08 Identities = 35/86 (40%), Positives = 40/86 (46%), Gaps = 23/86 (26%) Frame = -3 Query: 194 MNHHSYVYKPPTPPPYVYKSPP-----------YVYKPPTPPPYESPP-----YVYKPPT 63 ++H+ Y PP P Y YKSPP Y YK P PP + P Y YK P Sbjct: 126 VHHYKYKSPPPPTPVYKYKSPPPPKHSPAPEHHYKYKSPPPPKHFPAPEHHYKYKYKSPP 185 Query: 62 PPP--YVYESPP-----YVYKPPTPP 6 PP Y Y+SPP Y YK P PP Sbjct: 186 PPTPVYKYKSPPPPTPVYKYKSPPPP 211 Score = 21.6 bits (44), Expect(2) = 7e-08 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY +ESP Sbjct: 89 PPPYHFESP 97 Score = 53.5 bits (127), Expect(2) = 7e-07 Identities = 32/75 (42%), Positives = 37/75 (49%), Gaps = 17/75 (22%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPY--VYKPPTPPP----------YVYESP 36 Y YK P PPP PPY ++ P PP + PP VYK +PPP Y Y+SP Sbjct: 76 YKYKSP-PPPMHSPPPPYHFESPPPPKHSPPPPTPVYKYKSPPPPKHSPAPVHHYKYKSP 134 Query: 35 P-----YVYKPPTPP 6 P Y YK P PP Sbjct: 135 PPPTPVYKYKSPPPP 149 Score = 23.1 bits (48), Expect(2) = 7e-07 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY YESP Sbjct: 54 PPPYHYESP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/86 (38%), Positives = 36/86 (41%), Gaps = 28/86 (32%) Frame = -3 Query: 179 YVYKPP------TPPPYVYKSPPYVYKPPTPPPYESPP----YVYKPP------TPPPYV 48 Y Y P PPP PPY Y+ P PP + PP Y YK P PPPY Sbjct: 34 YTYSSPPPPEHSPPPPEHSPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPPYH 93 Query: 47 YESPP------------YVYKPPTPP 6 +ESPP Y YK P PP Sbjct: 94 FESPPPPKHSPPPPTPVYKYKSPPPP 119 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/76 (40%), Positives = 37/76 (48%), Gaps = 15/76 (19%) Frame = -3 Query: 185 HSYVYKPPT----PPPYVYKSPPYVYKPPTPPPYESPP----YVYKPPTPP------PYV 48 ++Y PP PPP PPY Y+ P PP + PP Y YK P PP PY Sbjct: 34 YTYSSPPPPEHSPPPPEHSPPPPYHYESPPPPKHSPPPPTPVYKYKSPPPPMHSPPPPYH 93 Query: 47 YESPPYV-YKPPTPPP 3 +ESPP + PP P P Sbjct: 94 FESPPPPKHSPPPPTP 109 [92][TOP] >UniRef100_Q9ZW80 Putative extensin n=1 Tax=Arabidopsis thaliana RepID=Q9ZW80_ARATH Length = 212 Score = 65.9 bits (159), Expect = 1e-09 Identities = 38/75 (50%), Positives = 40/75 (53%), Gaps = 17/75 (22%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP---------YVYKPPTPPPYESPP---YVYKPPTP-----PPY 51 Y Y P PPPY YKSPP Y YK P PPP +SPP Y + PP P PPY Sbjct: 31 YYYSSP-PPPYEYKSPPPPVKSPPPPYEYKSP-PPPVKSPPPPYYYHSPPPPVKSPPPPY 88 Query: 50 VYESPPYVYKPPTPP 6 VY SPP K P PP Sbjct: 89 VYSSPPPPVKSPPPP 103 Score = 63.5 bits (153), Expect(2) = 2e-09 Identities = 34/64 (53%), Positives = 35/64 (54%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPYVY SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 73 YYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 131 Query: 17 PTPP 6 P PP Sbjct: 132 PPPP 135 Score = 61.6 bits (148), Expect(2) = 2e-09 Identities = 34/65 (52%), Positives = 34/65 (52%), Gaps = 7/65 (10%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYK 21 YVY P PP PY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 88 YVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVK 146 Query: 20 PPTPP 6 P PP Sbjct: 147 SPPPP 151 Score = 23.9 bits (50), Expect(2) = 2e-09 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPYVY SP Sbjct: 85 PPPYVYSSP 93 Score = 21.9 bits (45), Expect(2) = 2e-09 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y+SP Sbjct: 37 PPPYEYKSP 45 Score = 62.0 bits (149), Expect(2) = 5e-09 Identities = 33/64 (51%), Positives = 35/64 (54%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPPY-ESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY+Y SPP K Sbjct: 137 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYLYSSPPPPVKS 195 Query: 17 PTPP 6 P PP Sbjct: 196 PPPP 199 Score = 21.9 bits (45), Expect(2) = 5e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 101 PPPYYYHSP 109 Score = 61.2 bits (147), Expect(2) = 8e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 105 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 163 Query: 17 PTPP 6 P PP Sbjct: 164 PPPP 167 Score = 61.2 bits (147), Expect(2) = 8e-09 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 121 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP-PPPYYYHSPPPPVKS 179 Query: 17 PTPP 6 P PP Sbjct: 180 PPPP 183 Score = 21.9 bits (45), Expect(2) = 8e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 69 PPPYYYHSP 77 Score = 21.9 bits (45), Expect(2) = 8e-09 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 117 PPPYYYHSP 125 Score = 62.0 bits (149), Expect = 2e-08 Identities = 38/81 (46%), Positives = 39/81 (48%), Gaps = 23/81 (28%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP---------YVYKPPTPPPYES--PPYVYKPP----- 66 Y YK P PP PY YKSPP Y Y P PPP +S PPYVY P Sbjct: 40 YEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSP-PPPVKSPPPPYVYSSPPPPVK 98 Query: 65 -TPPPYVYESPPYVYKPPTPP 6 PPPY Y SPP K P PP Sbjct: 99 SPPPPYYYHSPPPPVKSPPPP 119 Score = 57.8 bits (138), Expect(2) = 9e-08 Identities = 31/62 (50%), Positives = 33/62 (53%), Gaps = 6/62 (9%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKP 18 Y + PP P PPY Y SPP K P PP Y SPP K P PP Y+Y SPP P Sbjct: 153 YYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPP----P 208 Query: 17 PT 12 PT Sbjct: 209 PT 210 Score = 21.9 bits (45), Expect(2) = 9e-08 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 133 PPPYYYHSP 141 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 10/59 (16%) Frame = -3 Query: 152 PYVYKSPP--YVYKPPTPPPYES--PPYVYKPP------TPPPYVYESPPYVYKPPTPP 6 PY Y SPP Y YK P PPP +S PPY YK P PPPY Y SPP K P PP Sbjct: 30 PYYYSSPPPPYEYKSP-PPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 [93][TOP] >UniRef100_C0PMV5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PMV5_MAIZE Length = 284 Score = 65.9 bits (159), Expect = 1e-09 Identities = 41/66 (62%), Positives = 42/66 (63%), Gaps = 7/66 (10%) Frame = -3 Query: 179 YVYKPPTP---PPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP----PPYVYESPPYVYK 21 YV PPTP PPYV PPYV PPTP P SPPYV PPTP PPYV +PPYV Sbjct: 107 YVPVPPTPRPSPPYV---PPYVPVPPTPRP--SPPYV--PPTPRPPTPPYVPPTPPYV-- 157 Query: 20 PPTPPP 3 PPTP P Sbjct: 158 PPTPRP 163 Score = 64.3 bits (155), Expect = 4e-09 Identities = 40/65 (61%), Positives = 40/65 (61%), Gaps = 8/65 (12%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYV--YKPPTP---PPYESPPYVYKPPTP---PPYVYESPPYVYKP 18 Y PPTP P SPPYV Y PPTP PPY PPYV PPTP PPYV PPYV P Sbjct: 77 YVPPTPRP----SPPYVPPYVPPTPRPSPPYV-PPYVPVPPTPRPSPPYV---PPYVPVP 128 Query: 17 PTPPP 3 PTP P Sbjct: 129 PTPRP 133 Score = 64.3 bits (155), Expect = 4e-09 Identities = 39/64 (60%), Positives = 40/64 (62%), Gaps = 8/64 (12%) Frame = -3 Query: 173 YKPPTP----PPYVYKSPPYVYKPPTPPPYESPPYV--YKPPTPPPYVYESPPYV--YKP 18 Y PPTP PPYV +PPYV PPTP P PPYV Y PPTP P SPPYV Y P Sbjct: 137 YVPPTPRPPTPPYVPPTPPYV--PPTPRP-SPPPYVPPYVPPTPRP----SPPYVPPYVP 189 Query: 17 PTPP 6 PTPP Sbjct: 190 PTPP 193 Score = 62.4 bits (150), Expect = 2e-08 Identities = 41/70 (58%), Positives = 42/70 (60%), Gaps = 14/70 (20%) Frame = -3 Query: 173 YKPPTP---PPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP---PPYVYESP----- 36 Y PPTP PPYV PPYV PPTP PPY PPYV PPTP PPYV +P Sbjct: 92 YVPPTPRPSPPYV---PPYVPVPPTPRPSPPYV-PPYVPVPPTPRPSPPYVPPTPRPPTP 147 Query: 35 PYVYKPPTPP 6 PYV PPTPP Sbjct: 148 PYV--PPTPP 155 [94][TOP] >UniRef100_B9HRV2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HRV2_POPTR Length = 711 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 8/65 (12%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYK 21 VY PP +PPP V+ PP ++ PP PP Y PP V+ PP +PPP + PP V+ Sbjct: 513 VYSPPPLVQSPPPPVHSPPPPLHSPPPPPVYSPPPPVHSPPPPVHSPPPPIQSPPPPVHS 572 Query: 20 PPTPP 6 PP PP Sbjct: 573 PPPPP 577 Score = 63.2 bits (152), Expect = 9e-09 Identities = 32/70 (45%), Positives = 39/70 (55%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTP----PPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYK 21 V+ PP P PP V+ PP V+ PP PP Y PP V+ PP +PPP V PP V+ Sbjct: 470 VHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPVHSPPPPVYSPPPLVQSPPPPVHS 529 Query: 20 PP----TPPP 3 PP +PPP Sbjct: 530 PPPPLHSPPP 539 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 4/63 (6%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYKP 18 HS +PPP ++ PP V+ PP PP + PP +Y PP +PPP V+ PP V+ P Sbjct: 414 HSLPPPAHSPPPSIHFPPPPVHSPPPPPVHSPPPPIYSPPPLVYSPPPPVHSPPPPVHSP 473 Query: 17 PTP 9 P P Sbjct: 474 PPP 476 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/66 (48%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPP-- 15 VY PP +PPP VY PP V PP PP + PP ++ PP PP VY PP V+ PP Sbjct: 499 VYSPPPPVHSPPPPVYSPPPLVQSPP-PPVHSPPPPLHSPPPPP--VYSPPPPVHSPPPP 555 Query: 14 --TPPP 3 +PPP Sbjct: 556 VHSPPP 561 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/77 (41%), Positives = 41/77 (53%), Gaps = 19/77 (24%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTP------PPYESPPYVYKPP-----TPPPYVYE 42 +Y PP +PPP V+ PP V+ PP P P + PP V+ PP +PPP V+ Sbjct: 449 IYSPPPLVYSPPPPVHSPPPPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVYSPPPPVHS 508 Query: 41 SPPYVYKPP----TPPP 3 PP VY PP +PPP Sbjct: 509 PPPPVYSPPPLVQSPPP 525 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/78 (42%), Positives = 40/78 (51%), Gaps = 20/78 (25%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYV--YKPPT----------PPPYVY 45 V+ PP +PPP VY PP V+ PP PP + PP V + PP PPP VY Sbjct: 442 VHSPPPPIYSPPPLVYSPPPPVHSPP-PPVHSPPPPVQSFPPPVHSPPPPVHSPPPPPVY 500 Query: 44 ESPPYVYKPP----TPPP 3 PP V+ PP +PPP Sbjct: 501 SPPPPVHSPPPPVYSPPP 518 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/73 (42%), Positives = 37/73 (50%), Gaps = 15/73 (20%) Frame = -3 Query: 176 VYKPPTP----PPYVYKSPPYVYKPP-----TPPPYESPPYVYKPP--TPPPYVYESPPY 30 V+ PP PP V+ PP + PP PPP SPP PP +PPP +Y PP Sbjct: 399 VHSPPPSSQSLPPLVHSLPPPAHSPPPSIHFPPPPVHSPP---PPPVHSPPPPIYSPPPL 455 Query: 29 VYKPP----TPPP 3 VY PP +PPP Sbjct: 456 VYSPPPPVHSPPP 468 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/79 (35%), Positives = 36/79 (45%), Gaps = 9/79 (11%) Frame = -3 Query: 212 HLPHMCMNHHSYVYKPPTP-----PPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TP 60 H P ++ H P P PP SPP PTPP + P ++ PP +P Sbjct: 608 HSPTSPIHSHPPPVNSPPPPVQSLPPPPVNSPPPPVHSPTPPIHSPSPPLHSPPPPIRSP 667 Query: 59 PPYVYESPPYVYKPPTPPP 3 PP V+ PP + PP PPP Sbjct: 668 PPPVFSPPPVIVSPPPPPP 686 [95][TOP] >UniRef100_O04216 Extensin (Fragment) n=1 Tax=Bromheadia finlaysoniana RepID=O04216_BROFI Length = 71 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/55 (58%), Positives = 33/55 (60%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 P PPPY YKSPP PP+P P PPY YK P PPP PPY YK P PPP Sbjct: 6 PSPPPPYYYKSPP----PPSPSP--PPPYYYKSP-PPPSPSPPPPYYYKSPPPPP 53 Score = 60.8 bits (146), Expect(2) = 2e-09 Identities = 34/66 (51%), Positives = 36/66 (54%), Gaps = 8/66 (12%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP--YVY 24 Y YK P PP PY YKSPP PP+P P PPY YK P PPP SPP Y+Y Sbjct: 12 YYYKSPPPPSPSPPPPYYYKSPP----PPSPSP--PPPYYYKSPPPPP---PSPPPTYIY 62 Query: 23 KPPTPP 6 P PP Sbjct: 63 SSPPPP 68 Score = 24.3 bits (51), Expect(2) = 2e-09 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 6 PSPPPPYYYKSP 17 [96][TOP] >UniRef100_Q76KW3 Hydroxyproline-rich glycoprotein-2 (Fragment) n=1 Tax=Pisum sativum RepID=Q76KW3_PEA Length = 155 Score = 65.1 bits (157), Expect = 2e-09 Identities = 35/77 (45%), Positives = 42/77 (54%), Gaps = 9/77 (11%) Frame = -3 Query: 209 LPHMCMNHHSYVYKPPTPPP--YVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYES 39 L H+ ++ +Y+Y P PPP Y Y+SPP V+ PP P Y SPP P PPPY Y S Sbjct: 21 LSHLAISSBNYLYSSPPPPPKPYYYQSPPPPVHSPPPPYHYSSPPPPVHSP-PPPYHYSS 79 Query: 38 PP------YVYKPPTPP 6 PP Y Y P PP Sbjct: 80 PPPPPKKSYKYSSPPPP 96 Score = 57.4 bits (137), Expect(2) = 2e-08 Identities = 32/72 (44%), Positives = 39/72 (54%), Gaps = 14/72 (19%) Frame = -3 Query: 176 VYKPP------TPPPYVYK-SPPYVYKPPTPPPYES------PPYVYKPPTPPPYVYE-S 39 V+ PP +PPP V+ PPY Y P PPP +S PP +YK +PPP V+ Sbjct: 52 VHSPPPPYHYSSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPIYKYKSPPPPVHSPP 111 Query: 38 PPYVYKPPTPPP 3 PPY Y P PPP Sbjct: 112 PPYHYSSPPPPP 123 Score = 24.6 bits (52), Expect(2) = 2e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P PY Y+SP Sbjct: 37 PPPPKPYYYQSP 48 Score = 57.4 bits (137), Expect = 5e-07 Identities = 36/69 (52%), Positives = 36/69 (52%), Gaps = 14/69 (20%) Frame = -3 Query: 179 YVYKPPTPPP---YVYKSPP---YVYKPPTPPPYES--PPYVYKPPTPPP---YVYESPP 33 Y Y P PPP Y Y SPP Y YK P PPP S PPY Y P PPP Y Y SPP Sbjct: 75 YHYSSPPPPPKKSYKYSSPPPPIYKYKSP-PPPVHSPPPPYHYSSPPPPPKKSYKYSSPP 133 Query: 32 ---YVYKPP 15 Y YK P Sbjct: 134 PPVYKYKSP 142 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/62 (51%), Positives = 34/62 (54%), Gaps = 8/62 (12%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPY-VYKPPTPPPYESPP------YVYKPPTPPPYVYESP-PYV 27 SY Y P PP Y YKSPP V+ PP P Y SPP Y Y P PP Y Y+SP V Sbjct: 87 SYKYSSPPPPIYKYKSPPPPVHSPPPPYHYSSPPPPPKKSYKYSSPPPPVYKYKSPHQQV 146 Query: 26 YK 21 YK Sbjct: 147 YK 148 [97][TOP] >UniRef100_Q01946 Extensin (Class I) n=1 Tax=Solanum lycopersicum RepID=Q01946_SOLLC Length = 67 Score = 65.1 bits (157), Expect = 2e-09 Identities = 33/59 (55%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 Y YK P PPP PPY YK PP P P PPY YK P PPP PPY YK P PP Sbjct: 1 YYYKSP-PPPSPSPPPPYYYKSPPPPSPSPPPPYYYKSP-PPPSPSPPPPYYYKSPPPP 57 [98][TOP] >UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC Length = 620 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/67 (44%), Positives = 31/67 (46%), Gaps = 7/67 (10%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKP-------PTPPPYVYESPPYVY 24 +Y PP PP Y PP Y PP PP Y PP Y P P PPP Y PP Y Sbjct: 422 TYAQPPPLPP--TYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPPPTYSPPPPAY 479 Query: 23 KPPTPPP 3 PP P P Sbjct: 480 SPPPPSP 486 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/64 (48%), Positives = 32/64 (50%), Gaps = 9/64 (14%) Frame = -3 Query: 167 PPT--PPPYVYKSPP--YVYKPPTPPPYESPPYVYKPP-----TPPPYVYESPPYVYKPP 15 PPT PPP Y PP Y PP PP Y PP Y PP +PPP Y PP Y P Sbjct: 406 PPTYSPPPPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQP 465 Query: 14 TPPP 3 PPP Sbjct: 466 PPPP 469 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/78 (42%), Positives = 35/78 (44%), Gaps = 21/78 (26%) Frame = -3 Query: 173 YKPPTPPPY-------VYKSPPYVYKPPTPPPYESPPYVYKPP-----------TPPPYV 48 Y PP PP Y +Y PP VY PP PP Y PP Y PP +PPP Sbjct: 330 YSPP-PPTYLPLPSSPIYSPPPPVYSPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPT 388 Query: 47 YES---PPYVYKPPTPPP 3 YE PP Y PP P P Sbjct: 389 YEQSPPPPPAYSPPLPAP 406 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/60 (48%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = -3 Query: 173 YKPPTP---PPYVYKSPPYVYKP-PTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 + PP P PP Y PP Y P P+ P Y PP VY PP PP Y PP Y PP PP Sbjct: 317 FSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPPPPVYSPPPPPS--YSPPPPTYLPPPPP 374 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/60 (46%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSP-PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 +Y PP PP Y P P Y PP PP Y PP Y P P P Y PP Y PP PP Sbjct: 388 TYEQSPPPPPAYSPPLPAPPTYSPP-PPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPP 446 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/62 (50%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = -3 Query: 167 PPT--PPPYVYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYK-PPT--P 9 PPT PPP Y PP Y PP PP Y PP Y PP P P PP V PPT P Sbjct: 445 PPTYSPPPPTYSPPPPAYAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSP 504 Query: 8 PP 3 PP Sbjct: 505 PP 506 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/70 (41%), Positives = 30/70 (42%), Gaps = 14/70 (20%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-----------PPPYES---PPYVYKPPTPPPYVYES 39 VY PP PP Y P Y+ PP PP YE PP Y PP P P Y Sbjct: 352 VYSPPPPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSP 411 Query: 38 PPYVYKPPTP 9 PP Y PP P Sbjct: 412 PPPTYSPPPP 421 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/74 (43%), Positives = 34/74 (45%), Gaps = 18/74 (24%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKP-----------PTPPPYESPPYVYKPPTPPPY-------V 48 Y PP P P +Y PP Y P P PP Y SPP Y PP PP Y + Sbjct: 289 YSPPPPSP-IYSPPPPAYSPSPPPTPTPTFSPPPPAY-SPPPTYSPP-PPTYLPLPSSPI 345 Query: 47 YESPPYVYKPPTPP 6 Y PP VY PP PP Sbjct: 346 YSPPPPVYSPPPPP 359 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/55 (41%), Positives = 25/55 (45%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 + P PP Y P Y P P Y PP Y PP P P +Y PP Y P PP Sbjct: 258 RQPQPPTYSPPPPAYAQSPQPSPTYSPPPPTYSPPPPSP-IYSPPPPAYSPSPPP 311 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/55 (41%), Positives = 26/55 (47%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 Y P PPP Y PP Y PP P P SPP P PP + P ++ PP P Sbjct: 462 YAQPPPPPPTYSPPPPAYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPP 516 [99][TOP] >UniRef100_A3KD20 Leucine-rich repeat/extensin n=1 Tax=Nicotiana plumbaginifolia RepID=A3KD20_NICPL Length = 725 Score = 61.6 bits (148), Expect(2) = 3e-09 Identities = 33/69 (47%), Positives = 36/69 (52%), Gaps = 7/69 (10%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPP------YESPPYV-YKPPTPPPYVYESPPY 30 HH P PPP VY +PP YKP +PPP YE P Y PP PPP YE P Y Sbjct: 492 HHP---SPSPPPPPVYYAPP-TYKPQSPPPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTY 547 Query: 29 VYKPPTPPP 3 + P PPP Sbjct: 548 TPQSPPPPP 556 Score = 23.1 bits (48), Expect(2) = 3e-09 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 219 PPTPPPYVYES 187 PP+PPP VY S Sbjct: 446 PPSPPPPVYSS 456 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/57 (50%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPP---YESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 P+PPP SP Y PP PPP Y SPP P PP Y Y SPP PP+PPP Sbjct: 632 PSPPPTYNPSPSYTQSPPPPPPTYTYSSPPPPSPSPPPPTYYYSSPP----PPSPPP 684 Score = 56.2 bits (134), Expect(2) = 1e-07 Identities = 30/62 (48%), Positives = 33/62 (53%), Gaps = 7/62 (11%) Frame = -3 Query: 167 PPTPPPYVYKSPPYV-YKPPTPPPYESPPYVYKPPTPPPYVY---ESPP---YVYKPPTP 9 PP PPP Y+ P Y PP PPP P Y P +PPP VY SPP VY+ PTP Sbjct: 534 PPPPPPVHYEPPTYTPQSPPPPPPVHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTP 593 Query: 8 PP 3 P Sbjct: 594 SP 595 Score = 23.1 bits (48), Expect(2) = 1e-07 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP YE P Sbjct: 516 PPPPPPVHYEPP 527 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/60 (48%), Positives = 34/60 (56%), Gaps = 5/60 (8%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPP-----YESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP V+ PP Y P +PPP YE P Y + P PPP V+ PP Y P +PPP Sbjct: 515 PPPPPPPVHYEPP-TYTPQSPPPPPPVHYEPPTYTPQSPPPPPPVHYEPP-TYTPHSPPP 572 Score = 53.5 bits (127), Expect(2) = 7e-07 Identities = 25/57 (43%), Positives = 29/57 (50%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP P + P +PPTPPP S P+ P+PPP SP Y PP PPP Sbjct: 599 YTPPQEPSHPAPPTPPCNEPPTPPP--STPHWQPKPSPPPTYNPSPSYTQSPPPPPP 653 Score = 23.1 bits (48), Expect(2) = 7e-07 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP YE P Sbjct: 552 PPPPPPVHYEPP 563 Score = 50.1 bits (118), Expect(2) = 7e-06 Identities = 30/64 (46%), Positives = 33/64 (51%), Gaps = 8/64 (12%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYV-YKPPTPPPYESPPYVY---KPPTPPPYVYE----SPPYVYKP 18 Y+PPT P PP V Y+PPT P+ PP VY P PP VYE SPP Y P Sbjct: 542 YEPPTYTPQSPPPPPPVHYEPPTYTPHSPPPPVYVTPSSPPPPTPVYEHPTPSPPAGYTP 601 Query: 17 PTPP 6 P P Sbjct: 602 PQEP 605 Score = 23.1 bits (48), Expect(2) = 7e-06 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP YE P Sbjct: 534 PPPPPPVHYEPP 545 Score = 53.1 bits (126), Expect = 9e-06 Identities = 33/75 (44%), Positives = 38/75 (50%), Gaps = 20/75 (26%) Frame = -3 Query: 167 PPTPPPYVYKS---------PPYVYK---------PPTPPPYESPPYVY--KPPTPPPYV 48 PP+PPP VY S PP +K PP PPP SP Y + P PPP V Sbjct: 446 PPSPPPPVYSSSPSHKHRSPPPPTHKISPVTRHASPPPPPP--SPVYYHHPSPSPPPPPV 503 Query: 47 YESPPYVYKPPTPPP 3 Y +PP YKP +PPP Sbjct: 504 YYAPP-TYKPQSPPP 517 [100][TOP] >UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana RepID=Q9LJ64_ARATH Length = 956 Score = 64.7 bits (156), Expect = 3e-09 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYK 21 V+ PP +PPP VY PP V+ PP PP + PP V+ PP +PPP V+ PP V+ Sbjct: 660 VFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 719 Query: 20 PP----TPPP 3 PP +PPP Sbjct: 720 PPPPVHSPPP 729 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 5/63 (7%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYES-PPYVYKPP----TPPPYVYESPPYVYKPPT 12 +Y PP PP V+ PP V+ PP PPP S PP V+ PP +PPP V+ PP V+ PP Sbjct: 748 IYSPPPPP--VHSPPPPVHSPP-PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 804 Query: 11 PPP 3 P P Sbjct: 805 PSP 807 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 15/73 (20%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP------PPYESPPYVYKPP-----TPPPYVYESPPY 30 V+ PP PPP V+ PP V+ PP P P Y PP V+ PP +PPP V+ PP Sbjct: 644 VHSPPPPPP-VHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Query: 29 VYKPP----TPPP 3 V+ PP +PPP Sbjct: 703 VHSPPPPVHSPPP 715 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 6/63 (9%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPY--VYKPPTPPPYVYESPPYVYKPP 15 V+ PP +PPP V+ PP V PP PP + PP +Y PP PP V+ PP V+ PP Sbjct: 710 VHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP--VHSPPPPVHSPP 767 Query: 14 TPP 6 PP Sbjct: 768 PPP 770 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/67 (41%), Positives = 36/67 (53%), Gaps = 9/67 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP-----TPPPYVYESPPYVYKPP- 15 V PP PP + P +Y PP PP + PP V+ PP +PPP V+ PP V+ PP Sbjct: 731 VQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 790 Query: 14 ---TPPP 3 +PPP Sbjct: 791 PVHSPPP 797 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 5/62 (8%) Frame = -3 Query: 176 VYKPP-----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 V+ PP +PPP V+ PP V+ PP PP + PP V+ PP P P +Y PP V+ PP Sbjct: 763 VHSPPPPPVHSPPPPVHSPPPPVHSPP-PPVHSPPPPVHSPPPPSP-IYSPPPPVFSPPP 820 Query: 11 PP 6 P Sbjct: 821 KP 822 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/61 (44%), Positives = 34/61 (55%), Gaps = 4/61 (6%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 V+ PP +PPP V+ PP V+ PP PP + PP V PP PP + P +Y PP P Sbjct: 696 VHSPPPPVHSPPPPVHSPPPPVHSPP-PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754 Query: 8 P 6 P Sbjct: 755 P 755 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/68 (42%), Positives = 36/68 (52%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPP-----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP-----TPPPYVYESPPYV 27 V+ PP +PPP V+ PP V+ PP PP + PP V+ PP PPP PP V Sbjct: 681 VHSPPPPPVHSPPPPVHSPPPPVHSPP-PPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPV 739 Query: 26 YKPPTPPP 3 + PP P P Sbjct: 740 FSPPPPAP 747 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/65 (47%), Positives = 37/65 (56%), Gaps = 10/65 (15%) Frame = -3 Query: 170 KPPTPPPYVYK-----SPPYVYKPPTPPPYES-PPYVYKPP----TPPPYVYESPPYVYK 21 +PP+P K SPP V+ PP PPP S PP V+ PP +PPP VY PP V+ Sbjct: 625 QPPSPSTEETKTTSPQSPP-VHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHS 683 Query: 20 PPTPP 6 PP PP Sbjct: 684 PPPPP 688 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/61 (42%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 V+ PP +PPP V+ PP V+ PP P PP V+ PP P P +Y PP P P Sbjct: 703 VHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP-IYSPPPPPVHSPPP 761 Query: 8 P 6 P Sbjct: 762 P 762 [101][TOP] >UniRef100_Q40358 Repetitive proline-rich cell wall protein n=1 Tax=Medicago sativa RepID=PRP_MEDSA Length = 236 Score = 64.7 bits (156), Expect = 3e-09 Identities = 37/65 (56%), Positives = 38/65 (58%), Gaps = 7/65 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPY---VYKP 18 VYKPP P VYK P P VYKPP PP E PP VYKPP P VY+ P Y VYKP Sbjct: 34 VYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPP-VYKPPVVKPPVYKPPVYKPPVYKP 92 Query: 17 PTPPP 3 P P Sbjct: 93 PVEKP 97 Score = 62.8 bits (151), Expect = 1e-08 Identities = 37/70 (52%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--------VYKPPT-PPPYESPPYVYKPPTPPPYVYESPPY-- 30 VYKPP P VYK P Y VYKPP PP E PP VYKPP P VY+ P Y Sbjct: 109 VYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVYKP 167 Query: 29 -VYKPPTPPP 3 VYKPP P Sbjct: 168 PVYKPPVVKP 177 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/66 (54%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT--PPPYESPPY---VYKPPTPPPYVYESPPYVYK 21 VYKPP P VYK P Y VYKPP PP Y+ P Y VYKPP P VY+ P VYK Sbjct: 149 VYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPP--VYK 206 Query: 20 PPTPPP 3 PP P Sbjct: 207 PPVEKP 212 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/74 (50%), Positives = 39/74 (52%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--------VYKPPT--PPPYESPPY---VYKPPTPPPYVYESP 36 VYKPP P VYK P Y VYKPP PP Y+ P Y VYKPP P VY+ P Sbjct: 44 VYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPP 103 Query: 35 PY---VYKPPTPPP 3 Y VYKPP P Sbjct: 104 VYKPPVYKPPVVKP 117 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/66 (54%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT--PPPYESPPY---VYKPPTPPPYVYESPPYVYK 21 VYKPP P VYK P Y VYKPP PP Y+ P Y VYKPP P VY+ P VYK Sbjct: 69 VYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPP--VYK 126 Query: 20 PPTPPP 3 PP P Sbjct: 127 PPVEKP 132 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/74 (50%), Positives = 39/74 (52%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--------VYKPPT--PPPYESPPY---VYKPPTPPPYVYESP 36 VYKPP P VYK P Y VYKPP PP Y+ P Y VYKPP P VY+ P Sbjct: 124 VYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPP 183 Query: 35 PY---VYKPPTPPP 3 Y VYKPP P Sbjct: 184 VYKPPVYKPPVEKP 197 Score = 61.6 bits (148), Expect = 3e-08 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 139 VYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPP 198 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 199 VYKPPVYKP 207 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYKPP P VYK P Y VYKPP P P VYKPP P VY+ P VYKPP Sbjct: 89 VYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPP--VYKPPVEK 146 Query: 5 P 3 P Sbjct: 147 P 147 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYKPP P VYK P Y VYKPP P P VYKPP P VY+ P VYKPP Sbjct: 169 VYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPP--VYKPPVEK 226 Query: 5 P 3 P Sbjct: 227 P 227 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/61 (59%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 VYKPP P VYK P P VYKPP PP E PP VYKPP P V E PP VY PP Sbjct: 179 VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP-VYKPPVYKPPV-EKPP-VYGPPHH 235 Query: 8 P 6 P Sbjct: 236 P 236 [102][TOP] >UniRef100_Q9FUR6 ENOD2 (Fragment) n=1 Tax=Cladrastis kentukea RepID=Q9FUR6_CLALU Length = 244 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 5/63 (7%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYVYESPPYVYKPPT-- 12 VYKPP PP V+ PP+ PP PPP+E PP VY+PP PP VY+ PP+V PP Sbjct: 33 VYKPPIYPPPVHH-PPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPPPHVKPPPVYQ 91 Query: 11 PPP 3 PPP Sbjct: 92 PPP 94 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPP-TPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPT---PPPYV---YESPPYVYK 21 VY PP PP VY+ PP+ PP PPP+E PP VY+PP PPP +E PP VY+ Sbjct: 113 VYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQ 172 Query: 20 PP---TPPP 3 PP PPP Sbjct: 173 PPPHEKPPP 181 Score = 61.6 bits (148), Expect = 3e-08 Identities = 36/71 (50%), Positives = 44/71 (61%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPP--TPPPYVYKSPPYVYKPPT--PPPYESPPYVYKPPT---PPPYV---YESPPYV 27 VY+PP PP VY+ PP+ KPP+ PPP+E PP VY+PP PPP +E PP V Sbjct: 89 VYQPPPHVKPPPVYQPPPHE-KPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPV 147 Query: 26 YKPP---TPPP 3 Y+PP PPP Sbjct: 148 YQPPPHEKPPP 158 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/62 (53%), Positives = 38/62 (61%), Gaps = 7/62 (11%) Frame = -3 Query: 176 VYKPP-TPPPYVYKSPPY----VYKPP--TPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 VY PP PP VY+ PP+ VYKPP PPP E PP VYKPP P Y+ PPY + P Sbjct: 182 VYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPVEKPP-VYKPPVEKPPSYKPPPYGHYP 240 Query: 17 PT 12 P+ Sbjct: 241 PS 242 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/62 (51%), Positives = 38/62 (61%), Gaps = 8/62 (12%) Frame = -3 Query: 176 VYKPP-TPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPT---PPPYV---YESPPYVYK 21 VY PP PP VY+ PP+ PP PPP+E PP VY+PP PPP +E PP VY+ Sbjct: 136 VYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQ 195 Query: 20 PP 15 PP Sbjct: 196 PP 197 Score = 59.3 bits (142), Expect = 1e-07 Identities = 36/69 (52%), Positives = 41/69 (59%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPT--PPPYVYKSPPYVYKPPT--PPPYESPPYVYKPP-TPPPYVYESPPY----VY 24 VY+PP PP VY PP+ PP PPP+E PP VY PP PP VY+ PP+ VY Sbjct: 147 VYQPPPHEKPPPVY-PPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVY 205 Query: 23 KPP--TPPP 3 KPP PPP Sbjct: 206 KPPGYEPPP 214 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/70 (50%), Positives = 39/70 (55%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPP-TPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP---TPPPYV---YESPPY--- 30 VY PP PP VY+ PP+ PP PPP+E PP VY+PP PP Y YE PP Sbjct: 159 VYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPVEKP 218 Query: 29 -VYKPPTPPP 3 VYKPP P Sbjct: 219 PVYKPPVEKP 228 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/80 (42%), Positives = 41/80 (51%), Gaps = 18/80 (22%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPT----PPPYESPPYVYKPPT--PPPYV------- 48 HH KPP P ++ PP VY+PP PP Y+ PP+V PP PPP+V Sbjct: 44 HHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQ 103 Query: 47 ---YESPPYVYKPP--TPPP 3 +E PP VY PP PPP Sbjct: 104 PPPHEKPPSVYPPPHEKPPP 123 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/63 (50%), Positives = 37/63 (58%), Gaps = 5/63 (7%) Frame = -3 Query: 176 VYKPPT--PPPYVYKSPPYVYKPPT--PPPYESPPYVYKPP-TPPPYVYESPPYVYKPPT 12 VY+PP PP VY PP+ PP PPP+E PP VY PP PP VY+ PP+ PP Sbjct: 124 VYQPPPHEKPPPVY-PPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPV 182 Query: 11 PPP 3 PP Sbjct: 183 YPP 185 [103][TOP] >UniRef100_Q40146 Extensin (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q40146_SOLLC Length = 80 Score = 64.3 bits (155), Expect = 4e-09 Identities = 35/66 (53%), Positives = 38/66 (57%), Gaps = 5/66 (7%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPPYVYESPP---YVY 24 H + VYK P PP VYKSPP KP P+P PY P YK P PP VY+SPP YV Sbjct: 13 HPTPVYKSPPPPTPVYKSPPSPVKPYHPSPTPYHPTP-AYKSPPPPTPVYKSPPPTHYVS 71 Query: 23 KPPTPP 6 P PP Sbjct: 72 SSPPPP 77 [104][TOP] >UniRef100_A9PE91 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PE91_POPTR Length = 182 Score = 64.3 bits (155), Expect = 4e-09 Identities = 37/64 (57%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = -3 Query: 188 HHSYVYKPPT-PPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 H VYKPP P VYK PP VYKPP PP PP VYKPP P VY+ PP VYKPP Sbjct: 49 HKPPVYKPPKIEKPPVYKPPP-VYKPPIEKPPVYKPPPVYKPPIEKPPVYKPPP-VYKPP 106 Query: 14 TPPP 3 P Sbjct: 107 IEKP 110 Score = 64.3 bits (155), Expect = 4e-09 Identities = 35/58 (60%), Positives = 36/58 (62%), Gaps = 4/58 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTPPPYVYESP---PYVYKPP 15 VYKPP P VYK PP VYKPP PP PP VYKPP P VY+ P P VYKPP Sbjct: 70 VYKPPIEKPPVYKPPP-VYKPPIEKPPVYKPPPVYKPPIEKPPVYKPPIEKPPVYKPP 126 Score = 59.3 bits (142), Expect = 1e-07 Identities = 39/71 (54%), Positives = 41/71 (57%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPP--TPPPYESP---PYVYKPP-TPPPYVYESP----PYV 27 VYKPP P VYK PP VYKPP PP Y+ P P VYKPP P VY+ P P V Sbjct: 86 VYKPPIEKPPVYKPPP-VYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPVYKPPKIEKPPV 144 Query: 26 YKPP---TPPP 3 YKPP PPP Sbjct: 145 YKPPKIEKPPP 155 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/70 (45%), Positives = 35/70 (50%), Gaps = 13/70 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESPPYVYKPPT--------PPPYVYESP 36 VYKPP P VYK P P VYKPP PP PP + KPP PPP+ P Sbjct: 102 VYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPVYKPPKIEKPPVYKPPKIEKPPPFHKPLP 161 Query: 35 PYVYKPPTPP 6 PY + P PP Sbjct: 162 PYGHYPGHPP 171 [105][TOP] >UniRef100_Q9ZQI0 Putative uncharacterized protein At2g27380 n=1 Tax=Arabidopsis thaliana RepID=Q9ZQI0_ARATH Length = 761 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/60 (46%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V+K P Y PP PPP PP +Y PP PP V++ P +Y PP PP Sbjct: 212 IYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPP 271 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/58 (46%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V+K P Y PP PP PP +Y PP PP V++ P +Y PP PP Sbjct: 163 YSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPP 220 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/60 (46%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V+K P +Y PP PPP PP Y PP PP V++ P +Y PP PP Sbjct: 195 IYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPP 254 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/58 (46%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P Y PP PPP + P +Y PP PP V++ P +Y PP PP Sbjct: 315 YSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V+K P +Y PP PPP PP +Y PP PP + + P Y PP PP Sbjct: 347 IYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPP 406 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/59 (47%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V+K P +Y PP PPP PP +Y PP PP V P +Y PP PP Sbjct: 230 YSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPP 288 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V+K P +Y PP PPP ++PP +Y PP PP V++ P Y PP P Sbjct: 246 IYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSP 305 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/59 (45%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V+K P Y PP PPP + P Y PP PP V + P Y PP PP Sbjct: 448 IYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPP 506 Score = 60.1 bits (144), Expect = 7e-08 Identities = 33/68 (48%), Positives = 39/68 (57%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP-------PPYVYESPPYV 27 V+KPPTP PP V+KPPTP PP + PP V+KPPTP PP V++ P Sbjct: 575 VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP-VHKPPTPTYSPPIKPPPVHKPPTPT 633 Query: 26 YKPPTPPP 3 Y PP PP Sbjct: 634 YSPPIKPP 641 Score = 60.1 bits (144), Expect = 7e-08 Identities = 33/68 (48%), Positives = 39/68 (57%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP-------PPYVYESPPYV 27 V+KPPTP PP V+KPPTP PP + PP V+KPPTP PP V++ P Sbjct: 592 VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP-VHKPPTPTYSPPIKPPPVHKPPTPT 650 Query: 26 YKPPTPPP 3 Y PP PP Sbjct: 651 YSPPIKPP 658 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/66 (45%), Positives = 36/66 (54%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPP------PYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYK 21 V+KPPTP P V+K P +Y PP PPP PP +Y PP PP V++ P Y Sbjct: 172 VHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYS 231 Query: 20 PPTPPP 3 PP PP Sbjct: 232 PPVKPP 237 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP + K P Y PP PPP + P Y PP PP V++ P Y PP PP Sbjct: 499 YSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 556 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/59 (47%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V+K P Y PP PPP PP Y PP PP V++ P Y PP PP Sbjct: 532 YSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 590 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP-------PPYVYESPPYV 27 V+KPPTP PP ++KPPTP PP + PP V+KPPTP PP V++ P Sbjct: 541 VHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPP-VHKPPTPTYSPPIKPPPVHKPPTPT 599 Query: 26 YKPPTPPP 3 Y PP PP Sbjct: 600 YSPPIKPP 607 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP-------PPYVYESPPYV 27 ++KPPTP PP V+KPPTP PP + PP V+KPPTP PP V++ P Sbjct: 558 IHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP-VHKPPTPTYSPPIKPPPVHKPPTPT 616 Query: 26 YKPPTPPP 3 Y PP PP Sbjct: 617 YSPPIKPP 624 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/68 (48%), Positives = 38/68 (55%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP-------PPYVYESPPYV 27 V+KPPTP PP V+KPPTP PP + PP V+KPPTP PP V + P Sbjct: 609 VHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP-VHKPPTPTYSPPIKPPPVQKPPTPT 667 Query: 26 YKPPTPPP 3 Y PP PP Sbjct: 668 YSPPVKPP 675 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/59 (47%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P +Y PP PPP PP +Y PP PP V++ P +Y PP PP Sbjct: 332 YSPPIKPPPV-KPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 389 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP + K P Y PP PP + P +Y PP PP V++ P +Y PP PP Sbjct: 399 YSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 456 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/59 (47%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V+K P Y PP PPP + PP Y PP PP V P Y PP PP Sbjct: 634 YSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPP 692 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/60 (45%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP-PPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V+K P Y PP PP + PP Y PP PP V + P Y PP PP Sbjct: 280 IYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPP 339 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/60 (46%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V+K P +Y PP PPP PP Y PP PP V + P Y PP PP Sbjct: 431 IYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPV-KPPTPTYSPPVQPP 489 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/59 (45%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP + K P Y PP PPP + PP Y PP PP V++ P Y PP PP Sbjct: 129 YSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 187 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/60 (43%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V+K P +Y PP PPP + PP Y PP PP + + P Y PP P Sbjct: 364 IYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLP 423 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/59 (47%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P Y PP PPP + PP Y PP PP V P Y PP PP Sbjct: 651 YSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPP 709 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/57 (52%), Positives = 35/57 (61%), Gaps = 3/57 (5%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 KPPTP PP V+KPPTP PP + PP ++KPPTP PP V+KPPTP Sbjct: 526 KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP-IHKPPTPTYSPPIKPPPVHKPPTP 581 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/59 (44%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP + K P Y PP PPP + PP Y PP PP + + P Y PP PP Sbjct: 95 YSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPP 153 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/59 (44%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP + K P Y PP PPP + PP Y PP PP + + P Y PP PP Sbjct: 78 YSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 136 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/66 (45%), Positives = 32/66 (48%), Gaps = 11/66 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYE---------SPPYV 27 Y PP PP V K P Y PP PPP + PP Y PP PP V PP V Sbjct: 482 YSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPV 541 Query: 26 YKPPTP 9 +KPPTP Sbjct: 542 HKPPTP 547 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/59 (45%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V P Y PP PPP + PP Y PP PP V P Y PP PP Sbjct: 668 YSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPP 726 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/59 (45%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V P Y PP PPP PP Y PP PP V++ P +Y PP PP Sbjct: 146 YSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP-VHKPPTPIYSPPIKPP 203 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/67 (44%), Positives = 34/67 (50%), Gaps = 9/67 (13%) Frame = -3 Query: 176 VYKPPTP-------PPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVY 24 V+KPPTP PP V K P Y PP PPP + PP Y PP PP + + P Y Sbjct: 458 VHKPPTPTYSPPIKPPPV-KPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTY 516 Query: 23 KPPTPPP 3 PP PP Sbjct: 517 SPPIKPP 523 Score = 53.9 bits (128), Expect = 5e-06 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 5/75 (6%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKS---PPYVYKPPTPPPYESPPYVYKPPTP--PP 54 H H P + SY TPPP +Y PP + KPPT P PP + KPPTP P Sbjct: 42 HAHPPPIYGAPPSYT----TPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSP 97 Query: 53 YVYESPPYVYKPPTP 9 +Y PP + KPPTP Sbjct: 98 PIY--PPPIQKPPTP 110 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/64 (45%), Positives = 33/64 (51%), Gaps = 8/64 (12%) Frame = -3 Query: 170 KPPTP---PPYVY---KSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPP 15 KPPTP PP K P +Y PP PPP PP +Y PP PP V++ P Y PP Sbjct: 410 KPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPP 469 Query: 14 TPPP 3 PP Sbjct: 470 IKPP 473 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/59 (45%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P Y PP PPP PP Y PP PP +++ P Y PP PP Sbjct: 516 YSPPIKPPPV-KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPP 573 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/61 (50%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Frame = -3 Query: 176 VYKPPTPP--PYVYKSPPYVYKPPTP---PPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 + KPPTP P +Y PP + KPPTP PP + PP V PPTP PP V+KPPT Sbjct: 121 IQKPPTPTYSPPIY--PPPIQKPPTPSYSPPVKPPP-VQMPPTPTYSPPIKPPPVHKPPT 177 Query: 11 P 9 P Sbjct: 178 P 178 [106][TOP] >UniRef100_Q40503 Extensin n=1 Tax=Nicotiana tabacum RepID=Q40503_TOBAC Length = 224 Score = 63.9 bits (154), Expect = 5e-09 Identities = 34/64 (53%), Positives = 36/64 (56%), Gaps = 4/64 (6%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESP----PYVYKP 18 H+ VYK P PP VYKSPP PP P Y VYK P PP VY+SP PYVY Sbjct: 162 HTPVYKSPPPPTPVYKSPP----PPKKPHYPPHTPVYKSPPPPTPVYKSPPPHHPYVYAS 217 Query: 17 PTPP 6 P PP Sbjct: 218 PPPP 221 Score = 60.8 bits (146), Expect(2) = 1e-08 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY--VYKPPTPP--PYESPPY------VYKPPTPPPYVYESP-P 33 Y+YK P PP +VY SPP+ VYK P PP PY P VYK P PP Y P P Sbjct: 40 YLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHP 99 Query: 32 YVYKPPTPP 6 VYK P PP Sbjct: 100 PVYKSPPPP 108 Score = 21.9 bits (45), Expect(2) = 1e-08 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PY+Y+SP Sbjct: 34 PPPKKPYLYKSP 45 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/74 (48%), Positives = 39/74 (52%), Gaps = 14/74 (18%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPP---YESPPY-----------VYKPPTPPPYV 48 H+ VYK P PP VYKSPP KP PP Y+SPP VYK P PP V Sbjct: 116 HTPVYKSPPPPTPVYKSPPPPKKPHYPPHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTPV 175 Query: 47 YESPPYVYKPPTPP 6 Y+SPP KP PP Sbjct: 176 YKSPPPPKKPHYPP 189 Score = 58.5 bits (140), Expect(2) = 1e-07 Identities = 39/87 (44%), Positives = 41/87 (47%), Gaps = 27/87 (31%) Frame = -3 Query: 185 HSYVYKPPTPP--PY-----------VYKSPP---YVYKPPTPPPYESPP---------- 84 H VYK P PP PY VYKSPP Y PP PP Y+SPP Sbjct: 57 HHPVYKSPPPPKKPYHPSPTPYHPVPVYKSPPPPKKPYYPPHPPVYKSPPPPKKPYSLPH 116 Query: 83 -YVYKPPTPPPYVYESPPYVYKPPTPP 6 VYK P PP VY+SPP KP PP Sbjct: 117 TPVYKSPPPPTPVYKSPPPPKKPHYPP 143 Score = 20.4 bits (41), Expect(2) = 1e-07 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PP +VY SP Sbjct: 45 PPPPVHVYPSP 55 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/71 (50%), Positives = 42/71 (59%), Gaps = 12/71 (16%) Frame = -3 Query: 182 SYVYKPPTPP--PYVYKSPP---YVY-KPPTPPPYESPPYVYKP--PTPPPY----VYES 39 +Y Y P PP PY+YKSPP +VY PP P Y+SPP KP P+P PY VY+S Sbjct: 27 NYQYSSPPPPKKPYLYKSPPPPVHVYPSPPHHPVYKSPPPPKKPYHPSPTPYHPVPVYKS 86 Query: 38 PPYVYKPPTPP 6 PP KP PP Sbjct: 87 PPPPKKPYYPP 97 [107][TOP] >UniRef100_P08012 Repetitive proline-rich cell wall protein 1 n=1 Tax=Glycine max RepID=PRP1_SOYBN Length = 256 Score = 63.9 bits (154), Expect = 5e-09 Identities = 37/65 (56%), Positives = 38/65 (58%), Gaps = 7/65 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT-PPPYESPPYVYKPPTPPPYVYESPPY---VYKP 18 VYKPP P VYK P Y VYKPP PP E PP VYKPP P VY+ P Y VYKP Sbjct: 83 VYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPP-VYKPPVYKPPVYKPPVYKPPVYKP 141 Query: 17 PTPPP 3 P P Sbjct: 142 PVYKP 146 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/62 (58%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 VYKPP P VYK P Y VYKPP PP E PP VYKPP P VY+ P VYKPP Sbjct: 143 VYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPP-VYKPPVYKPPVYKPP--VYKPPVE 199 Query: 8 PP 3 P Sbjct: 200 KP 201 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/62 (56%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 VYKPP P VYK P Y +YKPP PP E PP VYKPP P VY+ P VYKPP Sbjct: 58 VYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPP-VYKPPVYKPPVYKPP--VYKPPIE 114 Query: 8 PP 3 P Sbjct: 115 KP 116 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/62 (58%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 VYKPP P VYK P Y VYKPP PP E PP VYKPP P VY+ P VYKPP Sbjct: 118 VYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPP-VYKPPVYKPPVYKPP--VYKPPVE 174 Query: 8 PP 3 P Sbjct: 175 KP 176 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/62 (56%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 VYKPP P VYK P P +YKPP PP E PP VYKPP P VY+ P VYKPP Sbjct: 183 VYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPP-VYKPPVYKPPVYKPP--VYKPPVK 239 Query: 8 PP 3 P Sbjct: 240 KP 241 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/62 (54%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 +YKPP P VYK P P VYKPP PP E PP VYKPP P +Y+ P VYKPP Sbjct: 33 IYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPP-VYKPPVYKPPIYKPP--VYKPPVE 89 Query: 8 PP 3 P Sbjct: 90 KP 91 Score = 60.5 bits (145), Expect = 6e-08 Identities = 37/74 (50%), Positives = 39/74 (52%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESPPY--------VYKPPTPPPYVYESP 36 VYKPP P VYK P P VYKPP PP Y+ P Y VYKPP P VY+ P Sbjct: 98 VYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPP 157 Query: 35 PY---VYKPPTPPP 3 Y VYKPP P Sbjct: 158 VYKPPVYKPPVYKP 171 Score = 60.1 bits (144), Expect = 7e-08 Identities = 36/66 (54%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESPPYVYKPPTPPPYVYESPPY---VYK 21 VYKPP P VYK P P VYKPP PP Y+ P VYKPP P VY+ P Y VYK Sbjct: 73 VYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPP--VYKPPIEKPPVYKPPVYKPPVYK 130 Query: 20 PPTPPP 3 PP P Sbjct: 131 PPVYKP 136 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/69 (49%), Positives = 35/69 (50%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--------VYKPPTPPPYESPPYVYKPPTPPPYVYESPPY--- 30 VYKPP P VYK P Y VYKPP P P VYKPP P VY+ P Y Sbjct: 168 VYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPP 227 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 228 VYKPPVYKP 236 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/63 (53%), Positives = 37/63 (58%), Gaps = 5/63 (7%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 VYKPP P VYK P P VYKPP PP Y+ P VYKPP P +Y+ P VYKPP Sbjct: 158 VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPP--VYKPPVEKPPIYKPP--VYKPPI 213 Query: 11 PPP 3 P Sbjct: 214 EKP 216 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 7/65 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT--PPPYESPPY---VYKPPTPPPYVYESPPYVYKPPT 12 VYKPP P +YK P VYKPP PP Y+ P Y VYKPP P V + P +YKPP Sbjct: 193 VYKPPVEKPPIYKPP--VYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPP--IYKPPY 248 Query: 11 P--PP 3 P PP Sbjct: 249 PKYPP 253 [108][TOP] >UniRef100_Q4LB97 Putative extensin (Fragment) n=1 Tax=Nicotiana tabacum RepID=Q4LB97_TOBAC Length = 57 Score = 63.5 bits (153), Expect = 7e-09 Identities = 33/57 (57%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 K P PPP VYKSPP VYK +PPP PP VYK P PP Y PPY Y +PPP Sbjct: 1 KSPPPPPPVYKSPPPPVYKYKSPPP---PPPVYKSPPPPVYKSPPPPYHYYYTSPPP 54 Score = 55.5 bits (132), Expect(2) = 3e-07 Identities = 30/50 (60%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYES-PPYVYKPPTPP-PYVYESPP 33 VYK P PP Y YKSP PP PP Y+S PP VYK P PP Y Y SPP Sbjct: 9 VYKSPPPPVYKYKSP-----PPPPPVYKSPPPPVYKSPPPPYHYYYTSPP 53 Score = 22.7 bits (47), Expect(2) = 3e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPP VY+SP Sbjct: 3 PPPPPPVYKSP 13 [109][TOP] >UniRef100_C3VPW8 Extensin n=1 Tax=Lithospermum erythrorhizon RepID=C3VPW8_LITER Length = 247 Score = 63.5 bits (153), Expect = 7e-09 Identities = 32/61 (52%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 H Y +K P PP VYKSPP ++K P PP Y+SPP PPP Y PP VYK P P Sbjct: 51 HHYHHKSPPPP--VYKSPPPPMHKSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPP 108 Query: 8 P 6 P Sbjct: 109 P 109 Score = 60.8 bits (146), Expect(2) = 2e-08 Identities = 35/72 (48%), Positives = 36/72 (50%), Gaps = 15/72 (20%) Frame = -3 Query: 176 VYKPP------TPPPYVYKSPPYVY--KPPTPPPYESPPYVYKPP-------TPPPYVYE 42 VYK P +PPP VYKSPP PP P Y PP VYK P PPP Y Sbjct: 62 VYKSPPPPMHKSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYS 121 Query: 41 SPPYVYKPPTPP 6 PP VYK P PP Sbjct: 122 PPPPVYKSPPPP 133 Score = 20.8 bits (42), Expect(2) = 2e-08 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 57 SPPPPVYKSP 66 Score = 59.3 bits (142), Expect(2) = 7e-08 Identities = 32/64 (50%), Positives = 33/64 (51%), Gaps = 9/64 (14%) Frame = -3 Query: 170 KPPTPPPYVYKS--PPYVYKPPTPPPYESPPYVYKPP-------TPPPYVYESPPYVYKP 18 K +PPP VYKS PP PP P Y PP VYK P PPP Y PP VYK Sbjct: 94 KKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKS 153 Query: 17 PTPP 6 P PP Sbjct: 154 PPPP 157 Score = 59.3 bits (142), Expect(2) = 7e-08 Identities = 32/64 (50%), Positives = 33/64 (51%), Gaps = 9/64 (14%) Frame = -3 Query: 170 KPPTPPPYVYKS--PPYVYKPPTPPPYESPPYVYKPP-------TPPPYVYESPPYVYKP 18 K +PPP VYKS PP PP P Y PP VYK P PPP Y PP VYK Sbjct: 118 KKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKS 177 Query: 17 PTPP 6 P PP Sbjct: 178 PPPP 181 Score = 20.8 bits (42), Expect(2) = 7e-08 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 73 SPPPPVYKSP 82 Score = 20.8 bits (42), Expect(2) = 7e-08 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 97 SPPPPVYKSP 106 Score = 57.8 bits (138), Expect(2) = 2e-07 Identities = 29/64 (45%), Positives = 33/64 (51%), Gaps = 7/64 (10%) Frame = -3 Query: 176 VYKPPTPP-------PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 VYK P PP P Y PP VYK P PP ++SPP K PPP PP ++K Sbjct: 126 VYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKS 185 Query: 17 PTPP 6 P PP Sbjct: 186 PPPP 189 Score = 20.8 bits (42), Expect(2) = 2e-07 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 121 SPPPPVYKSP 130 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/71 (47%), Positives = 44/71 (61%), Gaps = 10/71 (14%) Frame = -3 Query: 188 HHSYVYKPP-----TPPPYVYKSPPY-VYKPPTPPPYESPPYVYKPP---TPPPYVYES- 39 HH + PP +PPP ++KSPP VYK P PP ++SPP PP +PPP VY+S Sbjct: 51 HHYHHKSPPPPVYKSPPPPMHKSPPPPVYKSPPPPMHKSPP----PPKKYSPPPPVYKSP 106 Query: 38 PPYVYKPPTPP 6 PP ++K P PP Sbjct: 107 PPPMHKSPPPP 117 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/56 (50%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVY--KPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 K +PPP VYKSPP PP P Y PP VYK P PP + PP Y PP P Sbjct: 142 KKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPP 197 Score = 54.3 bits (129), Expect(2) = 2e-06 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPP-------PYVYKSPPYVYKPPTPPPYESPPYVYKPP---TPPPYVYESPPYV 27 VYK P PP P Y PP VYK P PP ++SPP PP +PPP V++ PP+ Sbjct: 150 VYKSPPPPMHKSPPPPKKYSPPPPVYKSPPPPMHKSPP----PPKKYSPPPPVHKPPPHW 205 Query: 26 YKPPTPPP 3 +PPP Sbjct: 206 SHKYSPPP 213 Score = 20.8 bits (42), Expect(2) = 2e-06 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 213 TPPPYVYESP 184 +PPP VY+SP Sbjct: 145 SPPPPVYKSP 154 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 9/59 (15%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVY--KPPTPPPYESPPYVYKPP-------TPPPYVYESPPYVYK 21 K +PPP VYKSPP PP P Y PP V+KPP +PPP V++SPP+ Y+ Sbjct: 166 KKYSPPPPVYKSPPPPMHKSPPPPKKYSPPPPVHKPPPHWSHKYSPPPPVHKSPPHHYR 224 [110][TOP] >UniRef100_UPI0001A7B3CA lipid binding / structural constituent of cell wall n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B3CA Length = 275 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/65 (55%), Positives = 37/65 (56%), Gaps = 10/65 (15%) Frame = -3 Query: 170 KPPT---PPPYV-YKSPPYVYKPPT----PPPYESPPY--VYKPPTPPPYVYESPPYVYK 21 KPPT PPPY+ PPY KPPT PPPY PP KPP PPPYV PP K Sbjct: 62 KPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPP-PPPYVKPPPPPTVK 120 Query: 20 PPTPP 6 PP PP Sbjct: 121 PPPPP 125 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/71 (49%), Positives = 35/71 (49%), Gaps = 13/71 (18%) Frame = -3 Query: 179 YVYKPPT----PPPYVYKSPPYVYKPPTPPPYESPP---YVYKPPTPPPYV------YES 39 Y KPPT PPPYV PP KPP PPPY PP V PP P PY Y Sbjct: 80 YTPKPPTVKPPPPPYVKPPPPPTVKPP-PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP 138 Query: 38 PPYVYKPPTPP 6 PP KPP PP Sbjct: 139 PPPTVKPPPPP 149 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPT---PPPYV-YESPPYVYKPPT--PP 6 PP P P+ K P + KPP PP + P + KPPT PPPY+ PPY KPPT PP Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPP 90 Query: 5 P 3 P Sbjct: 91 P 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = -3 Query: 170 KPPT---PPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 KPPT PP V PPY+ P PPPY P KPP PPPYV PP KPP PP Sbjct: 55 KPPTHTPKPPTVKPPPPYI--PCPPPPYTPKPPTVKPP-PPPYVKPPPPPTVKPPPPP 109 Score = 56.6 bits (135), Expect(2) = 5e-07 Identities = 31/57 (54%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP PPPYV PP KPP PP PY PP P PPP V PP V PP P P Sbjct: 104 KPP-PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP-PPPTVKPPPPPVVTPPPPTP 158 Score = 20.4 bits (41), Expect(2) = 5e-07 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYV P Sbjct: 89 PPPPPYVKPPP 99 Score = 55.1 bits (131), Expect(2) = 2e-06 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP PP PP Y PP P PY PP KPP PP P + P PPP Sbjct: 112 KPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPP 167 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYV P Sbjct: 105 PPPPPYVKPPP 115 [111][TOP] >UniRef100_UPI0001A7B0BB lipid binding / structural constituent of cell wall n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B0BB Length = 370 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/65 (55%), Positives = 37/65 (56%), Gaps = 10/65 (15%) Frame = -3 Query: 170 KPPT---PPPYV-YKSPPYVYKPPT----PPPYESPPY--VYKPPTPPPYVYESPPYVYK 21 KPPT PPPY+ PPY KPPT PPPY PP KPP PPPYV PP K Sbjct: 62 KPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPP-PPPYVKPPPPPTVK 120 Query: 20 PPTPP 6 PP PP Sbjct: 121 PPPPP 125 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/71 (49%), Positives = 35/71 (49%), Gaps = 13/71 (18%) Frame = -3 Query: 179 YVYKPPT----PPPYVYKSPPYVYKPPTPPPYESPP---YVYKPPTPPPYV------YES 39 Y KPPT PPPYV PP KPP PPPY PP V PP P PY Y Sbjct: 80 YTPKPPTVKPPPPPYVKPPPPPTVKPP-PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP 138 Query: 38 PPYVYKPPTPP 6 PP KPP PP Sbjct: 139 PPPTVKPPPPP 149 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPT---PPPYV-YESPPYVYKPPT--PP 6 PP P P+ K P + KPP PP + P + KPPT PPPY+ PPY KPPT PP Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPP 90 Query: 5 P 3 P Sbjct: 91 P 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = -3 Query: 170 KPPT---PPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 KPPT PP V PPY+ P PPPY P KPP PPPYV PP KPP PP Sbjct: 55 KPPTHTPKPPTVKPPPPYI--PCPPPPYTPKPPTVKPP-PPPYVKPPPPPTVKPPPPP 109 Score = 56.6 bits (135), Expect(2) = 5e-07 Identities = 31/57 (54%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP PPPYV PP KPP PP PY PP P PPP V PP V PP P P Sbjct: 104 KPP-PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP-PPPTVKPPPPPVVTPPPPTP 158 Score = 20.4 bits (41), Expect(2) = 5e-07 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYV P Sbjct: 89 PPPPPYVKPPP 99 Score = 55.1 bits (131), Expect(2) = 2e-06 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP PP PP Y PP P PY PP KPP PP P + P PPP Sbjct: 112 KPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPP 167 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYV P Sbjct: 105 PPPPPYVKPPP 115 [112][TOP] >UniRef100_Q9SC42 Proline-rich protein n=1 Tax=Pisum sativum RepID=Q9SC42_PEA Length = 214 Score = 63.2 bits (152), Expect = 9e-09 Identities = 35/65 (53%), Positives = 38/65 (58%), Gaps = 7/65 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT-PPPYESPPYVYKPPTPPPYVYESP---PYVYKP 18 VY+PP P +YK P P VYKPP PP E PP VYKPP P VY+ P P VYKP Sbjct: 28 VYRPPVETPPIYKPPVEKPPVYKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVKKPPVYKP 86 Query: 17 PTPPP 3 P P Sbjct: 87 PVEKP 91 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P Y+ P P Sbjct: 73 VYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPP 132 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 133 VYKPPVEKP 141 Score = 61.6 bits (148), Expect = 3e-08 Identities = 35/66 (53%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PYVYK 21 +YKPP P VYK P VYKPP PP Y+ P P VYKPP P VY+ P P VYK Sbjct: 38 IYKPPVEKPPVYKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYK 95 Query: 20 PPTPPP 3 PP P Sbjct: 96 PPVEKP 101 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/69 (50%), Positives = 37/69 (53%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P YK P P VYKPP PP Y+ P P VYKPP P Y+ P P Sbjct: 93 VYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPP 152 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 153 VYKPPVEKP 161 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/69 (50%), Positives = 37/69 (53%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P YKPP P VY+ P P Sbjct: 63 VYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPP 122 Query: 29 VYKPPTPPP 3 YKPP P Sbjct: 123 TYKPPVERP 131 Score = 58.9 bits (141), Expect = 2e-07 Identities = 34/69 (49%), Positives = 36/69 (52%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P YK P P VYKPP PP Y+ P P VYKPP P Y+ P P Sbjct: 113 VYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPP 172 Query: 29 VYKPPTPPP 3 YKPP P Sbjct: 173 AYKPPVEKP 181 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/69 (49%), Positives = 36/69 (52%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P YKPP PP Y+ P P YKPP P VY+ P P Sbjct: 83 VYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPP 142 Query: 29 VYKPPTPPP 3 YKPP P Sbjct: 143 TYKPPVEKP 151 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/64 (50%), Positives = 34/64 (53%), Gaps = 11/64 (17%) Frame = -3 Query: 173 YKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PYV 27 YKPP P VYK P P YKPP PP Y+ P P YKPP P Y+ P P V Sbjct: 124 YKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPPAYKPPVEKPPV 183 Query: 26 YKPP 15 YKPP Sbjct: 184 YKPP 187 [113][TOP] >UniRef100_Q6PZE9 Putative uncharacterized protein (Fragment) n=1 Tax=Brassica napus var. napus RepID=Q6PZE9_BRANA Length = 225 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/79 (41%), Positives = 39/79 (49%), Gaps = 8/79 (10%) Frame = -3 Query: 215 QHLPHMCMNHHSYVYKPPTP-------PPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTP 60 QH +++H V KPPTP PP V K P Y PP PPP + P +Y PP Sbjct: 1 QHQLIALLSNHHPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVM 60 Query: 59 PPYVYESPPYVYKPPTPPP 3 PP V + P Y PP PP Sbjct: 61 PPPVQQPPTPSYSPPVKPP 79 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/58 (46%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P Y PP PPP + P +Y PP PP V + P Y PP PP Sbjct: 140 YSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPTPTYSPPIKPP 197 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/59 (47%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P Y PP PPP + PP Y PP PP V + P Y PP PP Sbjct: 72 YSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPP 130 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/59 (47%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P Y PP PPP + PP Y PP PP V + P Y PP PP Sbjct: 106 YSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPP 164 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/60 (45%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 +Y PP PP V + P Y PP PPP + PP Y PP PP V + P Y PP PP Sbjct: 54 IYSPPVMPPPVQQPPTPSYSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPP 113 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/68 (48%), Positives = 35/68 (51%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP-------PPYVYESPPYV 27 V KPPTP PP V KPPTP PP + PP V KPPTP PP V + P Sbjct: 81 VQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPP-VQKPPTPTYSPPIKPPPVQKPPTPT 139 Query: 26 YKPPTPPP 3 Y PP PP Sbjct: 140 YSPPVKPP 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/59 (47%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYV-YKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P +Y PP PPP + PP Y PP PP V + P Y PP PP Sbjct: 39 YSPPVKPPPV-KPPTPIYSPPVMPPPVQQPPTPSYSPPVKPPPVQKPPTPTYSPPVKPP 96 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/59 (47%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPY-VYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP PP V K P Y PP PPP + PP Y PP PP V + P +Y PP PP Sbjct: 123 YSPPIKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPV-KPPTPIYSPPVKPP 180 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 V KPPTP PP V KPPTP PP + PP V KPPTP PP V KPPTP Sbjct: 98 VQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPP-VQKPPTPTYSPPVKPPPVQKPPTP 155 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/54 (44%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPP-TPPPYESPPYVYKPPTPPPYVYESPPYVYKP 18 +Y PP PP V K P Y PP PPP + P Y PP PP V + P Y P Sbjct: 172 IYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPTYSPPVKPPPVQKPPTPTYSP 225 [114][TOP] >UniRef100_Q40336 Proline-rich cell wall protein n=1 Tax=Medicago sativa RepID=Q40336_MEDSA Length = 381 Score = 63.2 bits (152), Expect = 9e-09 Identities = 38/83 (45%), Positives = 42/83 (50%), Gaps = 13/83 (15%) Frame = -3 Query: 212 HLPHMCMNHHSYVYKPPTPPPYVYK---------SPPYVYKPPT--PPPYESPPYVYKPP 66 H P + H +V KPP PPYV K PPYV KPP PPPY P V +PP Sbjct: 91 HHPKPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPP 150 Query: 65 --TPPPYVYESPPYVYKPPTPPP 3 PP V +PPYV KPP P Sbjct: 151 YVPKPPVVPVTPPYVPKPPVVRP 173 Score = 57.0 bits (136), Expect = 6e-07 Identities = 41/99 (41%), Positives = 44/99 (44%), Gaps = 29/99 (29%) Frame = -3 Query: 212 HLPHMCMN--HHSYVYKPP-----------TPPPYVYKSPPYVYKPP-TPPPY------- 96 H PH+ H YV KPP P P V K PPYV KPP PPY Sbjct: 99 HPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVPKPPVV 158 Query: 95 -ESPPYVYKPPT-------PPPYVYESPPYVYKPPTPPP 3 +PPYV KPP PP V +PPYV KPP P Sbjct: 159 PVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKP 197 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/74 (44%), Positives = 38/74 (51%), Gaps = 12/74 (16%) Frame = -3 Query: 188 HHSYVYKPP---------TPPPYVYKSPPYVYKP-PTPPPYESP--PYVYKPPTPPPYVY 45 HH + KPP TP P V+K P Y KP P PPP +P P+V KPP P Sbjct: 38 HHPPIVKPPVHKRRKYSPTPKPPVHKPPRYPPKPSPCPPPSSTPKPPHVPKPPHHPKPPV 97 Query: 44 ESPPYVYKPPTPPP 3 PP+V KPP PP Sbjct: 98 VHPPHVPKPPVHPP 111 Score = 56.6 bits (135), Expect = 8e-07 Identities = 35/79 (44%), Positives = 39/79 (49%), Gaps = 21/79 (26%) Frame = -3 Query: 176 VYKPPT--------PPPYVYKSPPYVYKPP--TPPPYESPPYVYKPPTPPPYVYE----- 42 V+KPP PPP PP+V KPP PP PP+V KPP PPYV + Sbjct: 61 VHKPPRYPPKPSPCPPPSSTPKPPHVPKPPHHPKPPVVHPPHVPKPPVHPPYVPKPPIVK 120 Query: 41 ----SPPYVYKPPT--PPP 3 PPYV KPP PPP Sbjct: 121 PPIVHPPYVPKPPVVKPPP 139 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 34/76 (44%), Positives = 35/76 (46%), Gaps = 17/76 (22%) Frame = -3 Query: 179 YVYKPPT---PPPYVYKSP----PYVYKPPT---PPPYESPPYVYKPPTP-------PPY 51 YV KPP PPYV K P PYV KPP PPY P + KPP PP Sbjct: 151 YVPKPPVVPVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVPLPPV 210 Query: 50 VYESPPYVYKPPTPPP 3 V PPYV PP P Sbjct: 211 VPSPPPYVPSPPIVKP 226 Score = 22.3 bits (46), Expect(2) = 4e-06 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 219 PPTPPPYVYESPLI 178 PP PPYV + P++ Sbjct: 106 PPVHPPYVPKPPIV 119 [115][TOP] >UniRef100_Q2YHP5 Proline-rich protein (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q2YHP5_PHAVU Length = 264 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 46 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 105 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 106 VYKPPVEKP 114 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 66 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 125 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 126 VYKPPVEKP 134 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 86 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 145 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 146 VYKPPVEKP 154 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 106 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 166 VYKPPVEKP 174 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 126 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 185 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 186 VYKPPVEKP 194 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 146 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 205 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 206 VYKPPVEKP 214 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 225 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 226 VYKPPVEKP 234 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 176 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 235 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 236 VYKPPVEKP 244 Score = 60.1 bits (144), Expect = 7e-08 Identities = 35/62 (56%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESP---PYVYKPPTP 9 VYKPP P VYK P V KPP PP E PP VYKPP P VY+ P P VYKPP Sbjct: 36 VYKPPVEKPPVYKPP--VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVE 92 Query: 8 PP 3 P Sbjct: 93 KP 94 Score = 58.9 bits (141), Expect = 2e-07 Identities = 38/68 (55%), Positives = 40/68 (58%), Gaps = 10/68 (14%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESPPYVYK 21 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ PPY K Sbjct: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYQ-PPY-GK 253 Query: 20 PPTP--PP 3 PP P PP Sbjct: 254 PPHPKYPP 261 [116][TOP] >UniRef100_O23370 Cell wall protein like n=1 Tax=Arabidopsis thaliana RepID=O23370_ARATH Length = 428 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/65 (55%), Positives = 37/65 (56%), Gaps = 10/65 (15%) Frame = -3 Query: 170 KPPT---PPPYV-YKSPPYVYKPPT----PPPYESPPY--VYKPPTPPPYVYESPPYVYK 21 KPPT PPPY+ PPY KPPT PPPY PP KPP PPPYV PP K Sbjct: 62 KPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPP-PPPYVKPPPPPTVK 120 Query: 20 PPTPP 6 PP PP Sbjct: 121 PPPPP 125 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/71 (49%), Positives = 35/71 (49%), Gaps = 13/71 (18%) Frame = -3 Query: 179 YVYKPPT----PPPYVYKSPPYVYKPPTPPPYESPP---YVYKPPTPPPYV------YES 39 Y KPPT PPPYV PP KPP PPPY PP V PP P PY Y Sbjct: 80 YTPKPPTVKPPPPPYVKPPPPPTVKPP-PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP 138 Query: 38 PPYVYKPPTPP 6 PP KPP PP Sbjct: 139 PPPTVKPPPPP 149 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPT---PPPYV-YESPPYVYKPPT--PP 6 PP P P+ K P + KPP PP + P + KPPT PPPY+ PPY KPPT PP Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPP 90 Query: 5 P 3 P Sbjct: 91 P 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = -3 Query: 170 KPPT---PPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 KPPT PP V PPY+ P PPPY P KPP PPPYV PP KPP PP Sbjct: 55 KPPTHTPKPPTVKPPPPYI--PCPPPPYTPKPPTVKPP-PPPYVKPPPPPTVKPPPPP 109 Score = 56.6 bits (135), Expect(2) = 5e-07 Identities = 31/57 (54%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP PPPYV PP KPP PP PY PP P PPP V PP V PP P P Sbjct: 104 KPP-PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP-PPPTVKPPPPPVVTPPPPTP 158 Score = 20.4 bits (41), Expect(2) = 5e-07 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYV P Sbjct: 89 PPPPPYVKPPP 99 Score = 55.1 bits (131), Expect(2) = 1e-06 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP PP PP Y PP P PY PP KPP PP P + P PPP Sbjct: 112 KPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPP 167 Score = 20.4 bits (41), Expect(2) = 1e-06 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 216 PTPPPYVYESP 184 P PPPYV P Sbjct: 105 PPPPPYVKPPP 115 [117][TOP] >UniRef100_B8BCY9 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BCY9_ORYSI Length = 246 Score = 63.2 bits (152), Expect = 9e-09 Identities = 41/81 (50%), Positives = 44/81 (54%), Gaps = 10/81 (12%) Frame = -3 Query: 218 HQHLPH---MCMNHHSYVYKPPTP-----PPYVYKSPPYV--YKPPTPPPYESPPYVYKP 69 H H P C + H Y PPTP PPYV PPYV Y PP PPY PPY+ P Sbjct: 62 HHHKPPPSPRCPSCHP-PYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYV-PPYI--P 117 Query: 68 PTPPPYVYESPPYVYKPPTPP 6 P PPYV PPY+ PPTPP Sbjct: 118 PPTPPYV---PPYI-PPPTPP 134 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/60 (51%), Positives = 36/60 (60%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 H + +KPP P PPY PPTP P +PPYV P+PPPYV PPY+ PPTPP Sbjct: 60 HHHHHKPPPSPRCPSCHPPYT--PPTPRPPPTPPYV---PSPPPYV---PPYI-PPPTPP 110 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/70 (50%), Positives = 39/70 (55%), Gaps = 9/70 (12%) Frame = -3 Query: 188 HHSYVYKPPTP------PPYVYKSPPYVYKPPTPPPYES-PPYV--YKPPTPPPYVYESP 36 HH + PP+P PPY +PP PPTPP S PPYV Y PP PPYV P Sbjct: 60 HHHHHKPPPSPRCPSCHPPY---TPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYV---P 113 Query: 35 PYVYKPPTPP 6 PY+ PPTPP Sbjct: 114 PYI-PPPTPP 122 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/59 (52%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP---PPYVYESPPYVYKPPTPP 6 Y PP PPYV PPY+ PP PPY PPY+ PPTP PP SPP PP+PP Sbjct: 103 YIPPPTPPYV---PPYI--PPPTPPY-VPPYI-PPPTPPYVPPPTPPSPPPYVPPPSPP 154 [118][TOP] >UniRef100_P13993 Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max RepID=PRP2_SOYBN Length = 230 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 79 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 138 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 139 VYKPPVEKP 147 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 99 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 158 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 159 VYKPPVEKP 167 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 119 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 178 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 179 VYKPPVEKP 187 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 129 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 188 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 189 VYKPPVEKP 197 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P +YKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 39 VYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 98 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 99 VYKPPVEKP 107 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 +YKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 59 IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 118 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 119 VYKPPVEKP 127 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 139 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 198 Query: 29 VYKPPTPPP 3 +YKPP P Sbjct: 199 IYKPPVEKP 207 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/62 (56%), Positives = 38/62 (61%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESP---PYVYKPPTP 9 VYKPPT P VYK P V KPP PP E+PP +YKPP P VY+ P P VYKPP Sbjct: 29 VYKPPTEKPPVYKPP--VEKPPVYKPPVENPP-IYKPPVEKPPVYKPPVEKPPVYKPPVE 85 Query: 8 PP 3 P Sbjct: 86 KP 87 Score = 61.6 bits (148), Expect = 3e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P +Y+ P P Sbjct: 149 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 208 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 209 VYKPPYGKP 217 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 12/67 (17%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYE----SPP 33 VYKPP P VYK P P VYKPP PP Y+ P P +YKPP P VY+ PP Sbjct: 159 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPYGKPP 218 Query: 32 YVYKPPT 12 Y PPT Sbjct: 219 YPKYPPT 225 [119][TOP] >UniRef100_Q40375 Repetitive proline-rich cell wall protein 2 n=1 Tax=Medicago truncatula RepID=PRP2_MEDTR Length = 371 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 44 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 103 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 104 VYKPPVEKP 112 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 64 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 123 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 124 VYKPPVEKP 132 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 84 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 143 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 144 VYKPPVEKP 152 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 104 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 163 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 164 VYKPPVEKP 172 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 124 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 183 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 184 VYKPPVEKP 192 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 144 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 203 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 204 VYKPPVEKP 212 Score = 63.2 bits (152), Expect = 9e-09 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 164 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 223 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 224 VYKPPVEKP 232 Score = 63.2 bits (152), Expect = 9e-09 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESPPY--- 30 +YKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P Y Sbjct: 264 IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPP 323 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 324 VYKPPVEKP 332 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P +Y+ P P Sbjct: 184 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 243 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 244 VYKPPVEKP 252 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P +YKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 244 VYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 303 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 304 VYKPPVEKP 312 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/70 (51%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPTP------PPYESPPYVYKPPTPPPYVYESP---P 33 VYKPP P VYK P P VYKPP PP E PP VYKPP P VY+ P P Sbjct: 204 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP-VYKPPVEKPPVYKPPVEKP 262 Query: 32 YVYKPPTPPP 3 +YKPP P Sbjct: 263 PIYKPPVEKP 272 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/69 (50%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P +YK P P VYKPP PP Y+ P P +YKPP P VY+ P P Sbjct: 224 VYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPP 283 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 284 VYKPPVEKP 292 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 +YKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 234 IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 293 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 294 VYKPPVEKP 302 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/66 (54%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESPPY---VYKPPTPPPYVYESPPYVYK 21 VYKPP P VYK P P VYKPP PP Y+ P Y VYKPP P VY+ P VYK Sbjct: 284 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPP--VYK 341 Query: 20 PPTPPP 3 PP P Sbjct: 342 PPVEKP 347 Score = 61.6 bits (148), Expect = 3e-08 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 274 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPP 333 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 334 VYKPPVYKP 342 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYKPP P VYK P Y VYKPP P P VYKPP P VY+ P VYKPP Sbjct: 304 VYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPP--VYKPPVEK 361 Query: 5 P 3 P Sbjct: 362 P 362 Score = 60.1 bits (144), Expect = 7e-08 Identities = 35/62 (56%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESP---PYVYKPPTP 9 VYKPP P VYK P V KPP PP E PP VYKPP P VY+ P P VYKPP Sbjct: 34 VYKPPVEKPPVYKPP--VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVE 90 Query: 8 PP 3 P Sbjct: 91 KP 92 Score = 57.4 bits (137), Expect = 5e-07 Identities = 38/74 (51%), Positives = 41/74 (55%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPT--PP---PYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP 36 VY+PP PP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P Sbjct: 29 VYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 88 Query: 35 ---PYVYKPPTPPP 3 P VYKPP P Sbjct: 89 VEKPPVYKPPVEKP 102 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/61 (59%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 VYKPP P VYK P P VYKPP PP E PP VYKPP P V E PP VY PP Sbjct: 314 VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP-VYKPPVYKPPV-EKPP-VYGPPHH 370 Query: 8 P 6 P Sbjct: 371 P 371 [120][TOP] >UniRef100_Q9MAW3 TrPRP2 n=1 Tax=Trifolium repens RepID=Q9MAW3_TRIRP Length = 343 Score = 62.8 bits (151), Expect = 1e-08 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 44 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 103 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 104 VYKPPVVKP 112 Score = 62.0 bits (149), Expect = 2e-08 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 64 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPP 123 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 124 VYKPPVYKP 132 Score = 61.6 bits (148), Expect = 3e-08 Identities = 36/65 (55%), Positives = 37/65 (56%), Gaps = 7/65 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT-PPPYESPPYVYKPPTPPPYVYESP---PYVYKP 18 VYKPP P VYK P Y V KPP PP E PP VYKPP P VY+ P P VYKP Sbjct: 254 VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKP 312 Query: 17 PTPPP 3 P P Sbjct: 313 PVEKP 317 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/64 (53%), Positives = 35/64 (54%), Gaps = 6/64 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPY---VYKPP 15 VYKPP P VYK P P VYKPP P P VYKPP P VY+ P Y VYKPP Sbjct: 94 VYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPP 153 Query: 14 TPPP 3 P Sbjct: 154 VVKP 157 Score = 60.8 bits (146), Expect = 4e-08 Identities = 36/66 (54%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESPPYVYK 21 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P VYK Sbjct: 74 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPP--VYK 131 Query: 20 PPTPPP 3 PP P Sbjct: 132 PPVVMP 137 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/64 (53%), Positives = 35/64 (54%), Gaps = 6/64 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPTPPPYESPPYVYKPPTPPPYVYESP---PYVYKPP 15 VYKPP P VYK P Y VYKPP P P VYKPP P VY+ P P VYKPP Sbjct: 129 VYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPP 188 Query: 14 TPPP 3 P Sbjct: 189 VYKP 192 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESP---PYVYKPPTPP 6 VYKPP P VYK P VYKPP P P VYKPP P VY+ P P VYKPP Sbjct: 239 VYKPPVEKPPVYKPP--VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEK 296 Query: 5 P 3 P Sbjct: 297 P 297 Score = 60.5 bits (145), Expect = 6e-08 Identities = 36/68 (52%), Positives = 39/68 (57%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 269 VYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 328 Query: 29 VYKPPTPP 6 VY+PP P Sbjct: 329 VYEPPHHP 336 Score = 60.1 bits (144), Expect = 7e-08 Identities = 35/63 (55%), Positives = 37/63 (58%), Gaps = 5/63 (7%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT--PPPYESPPY---VYKPPTPPPYVYESPPYVYKPPT 12 VYKPP P VYK P VYKPP PP Y+ P Y VYKPP P VY+ P VYKPP Sbjct: 114 VYKPPVVKPPVYKPP--VYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPP--VYKPPV 169 Query: 11 PPP 3 P Sbjct: 170 VKP 172 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/61 (52%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESP---PYVYKPPTPP 6 VYKPP P VYK P VYKPP P P VYKPP P +Y+ P P VYKPP Sbjct: 189 VYKPPVVKPPVYKPP--VYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEK 246 Query: 5 P 3 P Sbjct: 247 P 247 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/63 (55%), Positives = 37/63 (58%), Gaps = 5/63 (7%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESPPYVYKPPT 12 VYKPP P VYK P VYKPP PP Y+ P P VYKPP P VY+ P VYKPP Sbjct: 204 VYKPPVVKPPVYKPP--VYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPP--VYKPPV 259 Query: 11 PPP 3 P Sbjct: 260 VKP 262 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/61 (52%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYKPP P +YK P P VYKPP P P VYKPP P VY+ P VYKPP Sbjct: 219 VYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPP--VYKPPVVK 276 Query: 5 P 3 P Sbjct: 277 P 277 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/58 (55%), Positives = 33/58 (56%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 VYKPP P VYK P VYKPP P P VYKPP P VY+ P VYKPP P Sbjct: 174 VYKPPVVKPPVYKPP--VYKPPVVKPPVYKPPVYKPPVVKPPVYKPP--VYKPPVVKP 227 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/66 (50%), Positives = 34/66 (51%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--------VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYK 21 VYKPP P VYK P Y VYKPP P P VYKPP P VY+ P VYK Sbjct: 149 VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP--VYK 206 Query: 20 PPTPPP 3 PP P Sbjct: 207 PPVVKP 212 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/62 (53%), Positives = 35/62 (56%), Gaps = 8/62 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESPPYVYK 21 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VYE P + Sbjct: 279 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYEPPHHPKY 338 Query: 20 PP 15 PP Sbjct: 339 PP 340 Score = 57.0 bits (136), Expect = 6e-07 Identities = 34/62 (54%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESP---PYVYKPPTP 9 VY PP P VYK P V KPP PP E PP VYKPP P VY+ P P VYKPP Sbjct: 34 VYTPPIVKPPVYKPP--VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVE 90 Query: 8 PP 3 P Sbjct: 91 KP 92 Score = 56.6 bits (135), Expect = 8e-07 Identities = 38/74 (51%), Positives = 40/74 (54%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPT--PP---PYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP 36 VY PP PP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P Sbjct: 29 VYTPPVYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 88 Query: 35 ---PYVYKPPTPPP 3 P VYKPP P Sbjct: 89 VEKPPVYKPPVEKP 102 [121][TOP] >UniRef100_Q43414 Proline rich protein (Fragment) n=1 Tax=Cicer arietinum RepID=Q43414_CICAR Length = 227 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 +YKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 62 IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 121 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 122 VYKPPVEKP 130 Score = 62.8 bits (151), Expect = 1e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 82 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 141 Query: 29 VYKPPTPPP 3 +YKPP P Sbjct: 142 IYKPPVEKP 150 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 2 VYKPPVEKPPVYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPP 61 Query: 29 VYKPPTPPP 3 +YKPP P Sbjct: 62 IYKPPVEKP 70 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P +Y+ P P Sbjct: 12 VYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPP 71 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 72 VYKPPVEKP 80 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPP--TPPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P +YKPP P VY+ P P Sbjct: 22 VYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPP 81 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 82 VYKPPVEKP 90 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P +YKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 42 VYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 101 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 102 VYKPPVEKP 110 Score = 61.2 bits (147), Expect = 3e-08 Identities = 37/69 (53%), Positives = 38/69 (55%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY P P Sbjct: 112 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPP 171 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 172 VYKPPIEEP 180 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P +YKPP P VY+ P P Sbjct: 102 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPP 161 Query: 29 VYKPPTPPP 3 VY PP P Sbjct: 162 VYTPPVEKP 170 Score = 58.2 bits (139), Expect = 3e-07 Identities = 35/70 (50%), Positives = 37/70 (52%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT------PPPYESPPYVYKPPTPPPYVYESP---P 33 VYKPP P +YK P P VYKPP PP E PP VYKPP P VY+ P P Sbjct: 132 VYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPP-VYKPPIEEPPVYKPPVEKP 190 Query: 32 YVYKPPTPPP 3 VY PP P Sbjct: 191 PVYGPPYEKP 200 [122][TOP] >UniRef100_Q43564 Repetitive proline-rich cell wall protein 1 n=1 Tax=Medicago truncatula RepID=PRP1_MEDTR Length = 206 Score = 62.8 bits (151), Expect = 1e-08 Identities = 37/69 (53%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESPPY---VYKPPTPPPYVYESPPY--- 30 VYKPP P VYK P P VYKPP PP Y+ P Y VYKPP P VY+ P Y Sbjct: 34 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 93 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 94 VYKPPVYKP 102 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/67 (53%), Positives = 37/67 (55%), Gaps = 9/67 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--------VYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVY 24 VYKPP P VYK P Y VYKPP PP E PP VYKPP P VY+ P VY Sbjct: 99 VYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPP-VYKPPVVKPPVYKPP--VY 155 Query: 23 KPPTPPP 3 KPP P Sbjct: 156 KPPVVKP 162 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/63 (55%), Positives = 37/63 (58%), Gaps = 5/63 (7%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT--PPPYESPPY---VYKPPTPPPYVYESPPYVYKPPT 12 VYKPP P VYK P VYKPP PP Y+ P Y VYKPP P VY+ P VYKPP Sbjct: 139 VYKPPVVKPPVYKPP--VYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPP--VYKPPV 194 Query: 11 PPP 3 P Sbjct: 195 EKP 197 Score = 60.5 bits (145), Expect = 6e-08 Identities = 36/71 (50%), Positives = 38/71 (53%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT-------PPPYESPPY---VYKPPTPPPYVYESP 36 VYKPP P VYK P Y VYKPP PP Y+ P Y VYKPP P VY+ P Sbjct: 54 VYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPP 113 Query: 35 PYVYKPPTPPP 3 VYKPP P Sbjct: 114 --VYKPPVVKP 122 Score = 60.1 bits (144), Expect = 7e-08 Identities = 34/69 (49%), Positives = 35/69 (50%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--------VYKPPTPPPYESPPYVYKPPTPPPYVYESPPY--- 30 VYKPP P VYK P Y VYKPP P P VYKPP P VY+ P Y Sbjct: 114 VYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPP 173 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 174 VYKPPVEKP 182 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/58 (55%), Positives = 33/58 (56%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 VYKPP P VYK P VYKPP P P VYKPP P VY+ P VYKPP P Sbjct: 84 VYKPPVYKPPVYKPP--VYKPPVEKPPVYKPPVYKPPVVKPPVYKPP--VYKPPVEKP 137 Score = 56.6 bits (135), Expect = 8e-07 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 11/67 (16%) Frame = -3 Query: 170 KPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PYVY 24 KPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P VY Sbjct: 26 KPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVY 85 Query: 23 KPPTPPP 3 KPP P Sbjct: 86 KPPVYKP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/58 (60%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VYKPP P VYK P VYKPP PP E PP VYKPP P V E PP VY PP P Sbjct: 154 VYKPPVVKPPVYKPP--VYKPPVYKPPVEKPP-VYKPPVYKPPV-EKPP-VYGPPHHP 206 [123][TOP] >UniRef100_Q8LK15 Extensin n=1 Tax=Brassica napus RepID=Q8LK15_BRANA Length = 259 Score = 62.4 bits (150), Expect = 2e-08 Identities = 38/75 (50%), Positives = 39/75 (52%), Gaps = 18/75 (24%) Frame = -3 Query: 176 VYKPPTPPP--YVYKSPPYVYKPPTPPPYESPP-----YVYKPPTPP------PYVYESP 36 VY P PP YVYKSPP K TPP Y S P Y+YK P PP P VY SP Sbjct: 135 VYHSPPPPKNQYVYKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSP 194 Query: 35 P-----YVYKPPTPP 6 P YVYK P PP Sbjct: 195 PPPKKHYVYKSPPPP 209 Score = 58.9 bits (141), Expect = 2e-07 Identities = 39/85 (45%), Positives = 42/85 (49%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPP------PYVYKSPP-----YVYKPPTPPP--------YESPP-----YVYK 72 Y+YK P PP P VY SPP YVYK P PP Y SPP YVYK Sbjct: 173 YMYKSPPPPVMHYSLPQVYHSPPPPKKHYVYKSPPPPVKHYSPRLVYHSPPPPKKKYVYK 232 Query: 71 PPTPPPYVYESPP---YVYKPPTPP 6 P PPP + PP Y+YK P PP Sbjct: 233 SP-PPPVRHYFPPHHLYLYKSPPPP 256 Score = 57.8 bits (138), Expect = 4e-07 Identities = 38/85 (44%), Positives = 40/85 (47%), Gaps = 27/85 (31%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP----YVYKPPTPPP--------YESPP-----YVYKPP----- 66 YVYK P PP Y SPP YVY+ P PP Y SPP YVYK P Sbjct: 97 YVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPPPKNQYVYKSPPPPVK 156 Query: 65 --TPPPYVYESPP---YVYKPPTPP 6 TPP Y PP Y+YK P PP Sbjct: 157 HYTPPVYHSGPPPKKHYMYKSPPPP 181 Score = 57.8 bits (138), Expect = 4e-07 Identities = 41/94 (43%), Positives = 43/94 (45%), Gaps = 34/94 (36%) Frame = -3 Query: 185 HSYVYKPPTPP-----PYVYKSPP-----YVYKPPTPP--------PYESPP-----YVY 75 + YVYK P PP P VY S P Y+YK P PP Y SPP YVY Sbjct: 144 NQYVYKSPPPPVKHYTPPVYHSGPPPKKHYMYKSPPPPVMHYSLPQVYHSPPPPKKHYVY 203 Query: 74 KPPTP------PPYVYESPP-----YVYKPPTPP 6 K P P P VY SPP YVYK P PP Sbjct: 204 KSPPPPVKHYSPRLVYHSPPPPKKKYVYKSPPPP 237 Score = 57.0 bits (136), Expect = 6e-07 Identities = 37/80 (46%), Positives = 41/80 (51%), Gaps = 24/80 (30%) Frame = -3 Query: 173 YKPP---TPPP----YVYKSPP--------------YVYKPPTPP-PYESPPYVYKPPTP 60 Y PP +PPP YVYKSPP YVY+ P PP + SPP VY P P Sbjct: 82 YSPPWLRSPPPPRKDYVYKSPPPPVKQYSSPPPNKYYVYQSPPPPVKHYSPPSVYHSPPP 141 Query: 59 P--PYVYESPPYVYKPPTPP 6 P YVY+SPP K TPP Sbjct: 142 PKNQYVYKSPPPPVKHYTPP 161 [124][TOP] >UniRef100_C6TGK1 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TGK1_SOYBN Length = 161 Score = 62.4 bits (150), Expect = 2e-08 Identities = 35/62 (56%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY---VYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 VYKPP P VYK P Y +YKPP PP E PP VYKPP P VY+ P VYKPP Sbjct: 58 VYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPP-VYKPPVYKPPVYKPP--VYKPPIE 114 Query: 8 PP 3 P Sbjct: 115 KP 116 Score = 61.2 bits (147), Expect = 3e-08 Identities = 34/62 (54%), Positives = 37/62 (59%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 +YKPP P VYK P P VYKPP PP E PP VYKPP P +Y+ P VYKPP Sbjct: 33 IYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPP-VYKPPVYKPPIYKPP--VYKPPVE 89 Query: 8 PP 3 P Sbjct: 90 KP 91 Score = 60.8 bits (146), Expect = 4e-08 Identities = 38/76 (50%), Positives = 41/76 (53%), Gaps = 18/76 (23%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY--------VYKPP--TPPPYESPPY---VYKPPTPPPYVYESP 36 VYKPP P VYK P Y VYKPP PP Y+ P Y VYKPP P VY+ P Sbjct: 83 VYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPP 142 Query: 35 ---PYVYKPPTP--PP 3 P +YKPP P PP Sbjct: 143 VKKPPIYKPPYPKYPP 158 Score = 60.1 bits (144), Expect = 7e-08 Identities = 38/70 (54%), Positives = 40/70 (57%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPT--PP---PYVYKSPPY---VYKPPT-PPPYESPPYVYKPPTPPPYVYESPPY-- 30 +YKPP PP P VYK P Y VYKPP PP E PP VYKPP P VY+ P Y Sbjct: 78 IYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPP-VYKPPVYKPPVYKPPVYKP 136 Query: 29 -VYKPPTPPP 3 VYKPP P Sbjct: 137 PVYKPPVKKP 146 [125][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPP---TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VY PP +PPP V SPP PP P P PP VY PP PPP VY PP PP PP Sbjct: 426 VYSPPPVFSPPPPVLSSPPPP-SPPPPSPSPPPPPVYSPPPPPP-VYSPPPPPPPPPPPP 483 Query: 5 P 3 P Sbjct: 484 P 484 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/59 (49%), Positives = 32/59 (54%), Gaps = 5/59 (8%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPP-----TPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 P+PPP SPP V+ PP +PPP PP PP PP Y PP VY PP PPP Sbjct: 419 PSPPPTPVYSPPPVFSPPPPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPP 477 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 7/65 (10%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPP--YVYKPPTPPPYVYESP-PYV----YKP 18 VY PP PPP VY PP PP PPP SPP +Y+ P PP VYE P P + Y Sbjct: 460 VYSPPPPPP-VYSPPPPPPPPPPPPPVXSPPPPIIYESPPPPTPVYEGPLPPIFGVSYAS 518 Query: 17 PTPPP 3 P PPP Sbjct: 519 PPPPP 523 Score = 60.1 bits (144), Expect = 7e-08 Identities = 27/55 (49%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 P PPP PP VY PP PPP Y PP PP PPP PP +Y+ P PP Sbjct: 446 PSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPPVXSPPPPIIYESPPPP 500 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/70 (44%), Positives = 33/70 (47%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP-----------TPPPYVYESPP 33 +V PTPPP SPP PP P Y SPP V+ PP PPP PP Sbjct: 403 FVPSLPTPPP---PSPPVFPSPPPTPVY-SPPPVFSPPPPVLSSPPPPSPPPPSPSPPPP 458 Query: 32 YVYKPPTPPP 3 VY PP PPP Sbjct: 459 PVYSPPPPPP 468 [126][TOP] >UniRef100_Q5VRF4 Os06g0168700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5VRF4_ORYSJ Length = 246 Score = 62.0 bits (149), Expect = 2e-08 Identities = 41/84 (48%), Positives = 43/84 (51%), Gaps = 13/84 (15%) Frame = -3 Query: 218 HQHLPH---MCMNHHSYVYKPPTP-----PPYVYKSPPYV--YKPPTPPPYESPPYVYKP 69 H H P C + H Y PPTP PPYV PPYV Y PP PPY PPY+ P Sbjct: 62 HHHKPPPSPRCPSCHP-PYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPY-VPPYI-PP 118 Query: 68 PTP---PPYVYESPPYVYKPPTPP 6 PTP PP SPP PPTPP Sbjct: 119 PTPPYVPPPTPPSPPPYVPPPTPP 142 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/60 (51%), Positives = 36/60 (60%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 H + +KPP P PPY PPTP P +PPYV P+PPPYV PPY+ PPTPP Sbjct: 60 HHHHHKPPPSPRCPSCHPPYT--PPTPRPPPTPPYV---PSPPPYV---PPYI-PPPTPP 110 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/64 (50%), Positives = 36/64 (56%), Gaps = 11/64 (17%) Frame = -3 Query: 164 PTPPPYV-----YKSPPYV--YKPPTPPPYESPPYVYKPPTPPPYV----YESPPYVYKP 18 P+PPPYV +PPYV Y PP PPY PP PP+PPPYV SPP P Sbjct: 94 PSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPP---TPPSPPPYVPPPTPPSPPPYVPP 150 Query: 17 PTPP 6 P+PP Sbjct: 151 PSPP 154 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/70 (50%), Positives = 39/70 (55%), Gaps = 9/70 (12%) Frame = -3 Query: 188 HHSYVYKPPTP------PPYVYKSPPYVYKPPTPPPYES-PPYV--YKPPTPPPYVYESP 36 HH + PP+P PPY +PP PPTPP S PPYV Y PP PPYV P Sbjct: 60 HHHHHKPPPSPRCPSCHPPY---TPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYV---P 113 Query: 35 PYVYKPPTPP 6 PY+ PPTPP Sbjct: 114 PYI-PPPTPP 122 [127][TOP] >UniRef100_Q43504 Extensin-like protein Dif10 (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q43504_SOLLC Length = 396 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSP-PY-VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 Y YK P+P Y YKSP PY YK P P Y P YK P PP YE P YK P PP Sbjct: 224 YYYKSPSPSKY-YKSPAPYKYYKSPAPQKYYKSPVYYKSPPPPTTYYEKSPSYYKSPPPP 282 Query: 5 P 3 P Sbjct: 283 P 283 Score = 61.6 bits (148), Expect = 3e-08 Identities = 34/59 (57%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP--YESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 YK P P Y YKSP Y YK P PP YE P YK P PPPY ES PY YK P P P Sbjct: 244 YKSPAPQKY-YKSPVY-YKSPPPPTTYYEKSPSYYKSPPPPPYYKESTPY-YKSPPPSP 299 Score = 60.1 bits (144), Expect = 7e-08 Identities = 26/57 (45%), Positives = 29/57 (50%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 YK P PPPY + P PP PP Y+ YK P PPP Y+ P Y P PPP Sbjct: 305 YKSPPPPPYYEEFTPSYKSPPPPPYYKESTPSYKSPPPPPKHYDQSPTSYNSPPPPP 361 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/72 (48%), Positives = 35/72 (48%), Gaps = 13/72 (18%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPY-ESPPYVYKPPTPPPYVYES------PPYV-- 27 Y PP P Y KSP Y PP PP Y ES PY YK P P PY ES PPY Sbjct: 258 YYKSPPPPTTYYEKSPSYYKSPPPPPYYKESTPY-YKSPPPSPYYKESYKSPPPPPYYEE 316 Query: 26 ----YKPPTPPP 3 YK P PPP Sbjct: 317 FTPSYKSPPPPP 328 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/74 (48%), Positives = 37/74 (50%), Gaps = 14/74 (18%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPTPPPY--------ESPPYV------YKPPTPPPYVY 45 SY PP PPPY +S PY YK P P PY PPY YK P PPPY Sbjct: 274 SYYKSPP-PPPYYKESTPY-YKSPPPSPYYKESYKSPPPPPYYEEFTPSYKSPPPPPYYK 331 Query: 44 ESPPYVYKPPTPPP 3 ES P YK P PPP Sbjct: 332 ESTP-SYKSPPPPP 344 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/58 (46%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPP--YESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPPY +S P YK P PPP Y+ P Y P PPP Y Y P PP Sbjct: 321 YKSPPPPPYYKESTPS-YKSPPPPPKHYDQSPTSYNSPPPPPPAYYKQTPTYASPPPP 377 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/66 (46%), Positives = 35/66 (53%), Gaps = 11/66 (16%) Frame = -3 Query: 173 YKPPTPPPYVYKSP---PYVYKPPTPPPYESPP----YVYKPPTPPPYVYESPP----YV 27 YK PTP Y YKSP Y YK P+P Y P Y YK P+P Y Y+SP Y Sbjct: 167 YKAPTPSKYYYKSPAPSKYYYKSPSPAKYYKSPAPSKYYYKSPSPRKY-YKSPAPSKHYY 225 Query: 26 YKPPTP 9 YK P+P Sbjct: 226 YKSPSP 231 [128][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/61 (54%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -3 Query: 176 VYKPP---TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 VY PP +PPP V SPP PP P P PP VY PP PPP VY PP PP PP Sbjct: 426 VYSPPPVFSPPPPVLSSPPPP-SPPPPSPSPPPPPVYSPPPPPP-VYSPPPPPPPPPPPP 483 Query: 5 P 3 P Sbjct: 484 P 484 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/59 (49%), Positives = 32/59 (54%), Gaps = 5/59 (8%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPP-----TPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 P+PPP SPP V+ PP +PPP PP PP PP Y PP VY PP PPP Sbjct: 419 PSPPPTPVYSPPPVFSPPPPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPP 477 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/70 (44%), Positives = 33/70 (47%), Gaps = 11/70 (15%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP-----------TPPPYVYESPP 33 +V PTPPP SPP PP P Y SPP V+ PP PPP PP Sbjct: 403 FVPSLPTPPP---PSPPVFPSPPPTPVY-SPPPVFSPPPPVLSSPPPPSPPPPSPSPPPP 458 Query: 32 YVYKPPTPPP 3 VY PP PPP Sbjct: 459 PVYSPPPPPP 468 [129][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 57.8 bits (138), Expect(2) = 2e-08 Identities = 28/56 (50%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKP-PTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP P P PPP PP PP+PPP V+E PP PP P P Sbjct: 1154 PPSPPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPNPSP 1209 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PPP V+E P Sbjct: 1118 PPSPPPPVHEPP 1129 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP PPP PP PP+PPP V+E PP PP+PPP Sbjct: 1091 PPSPPP-----PPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPP 1140 [130][TOP] >UniRef100_Q7DMV8 Hydroxyproline-rich glycoprotein (HRGP) (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q7DMV8_PHAVU Length = 230 Score = 57.0 bits (136), Expect(2) = 2e-08 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 60 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 119 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 120 PPPYYYHSPPPPKHSPPPP 138 Score = 24.6 bits (52), Expect(2) = 2e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P PY Y+SP Sbjct: 37 PPPPKPYYYQSP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/77 (41%), Positives = 37/77 (48%), Gaps = 18/77 (23%) Frame = -3 Query: 182 SYVYKPPTPPP--YVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----TPP 57 +Y+Y P PPP Y Y+SPP Y Y P PP + PP Y + PP PP Sbjct: 30 NYIYSSPPPPPKPYYYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPP 89 Query: 56 PYVYESPPYVYKPPTPP 6 PY Y SPP P PP Sbjct: 90 PYYYHSPPPPKHSPPPP 106 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 76 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 135 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 136 PPPYYYHSPPPPKHSPPPP 154 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 92 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 151 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 152 PPPYYYHSPPPPKHSPPPP 170 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 108 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 167 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 168 PPPYYYHSPPPPKHSPPPP 186 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 124 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 183 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 184 PPPYYYHSPPPPKHSPPPP 202 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 32/79 (40%), Positives = 35/79 (44%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y + PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 140 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 199 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 200 PPPYYYHSPPPPKHSPPPP 218 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 56 PPPYYYHSP 64 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 72 PPPYYYHSP 80 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 88 PPPYYYHSP 96 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 104 PPPYYYHSP 112 Score = 21.9 bits (45), Expect(2) = 1e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 120 PPPYYYHSP 128 Score = 56.6 bits (135), Expect(2) = 2e-07 Identities = 29/72 (40%), Positives = 31/72 (43%), Gaps = 14/72 (19%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPPYVYKPPTPPPYVYE 42 Y + PP P PPY Y SPP Y Y P PP + PP Y PPP Sbjct: 156 YYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 215 Query: 41 SPPYVYKPPTPP 6 PPY Y P PP Sbjct: 216 PPPYYYHSPPPP 227 Score = 21.9 bits (45), Expect(2) = 2e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 136 PPPYYYHSP 144 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/79 (40%), Positives = 34/79 (43%), Gaps = 21/79 (26%) Frame = -3 Query: 179 YVYKPPTP-----PPYVYKSPP---------YVYKPPTPPPYESPP--YVYKPP-----T 63 Y PP P PPY Y SPP Y Y P PP + PP Y + PP Sbjct: 44 YYQSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSP 103 Query: 62 PPPYVYESPPYVYKPPTPP 6 PPPY Y SPP P PP Sbjct: 104 PPPYYYHSPPPPKHSPPPP 122 [131][TOP] >UniRef100_O49870 Extensin (Fragment) n=1 Tax=Hordeum vulgare RepID=O49870_HORVU Length = 330 Score = 60.5 bits (145), Expect(2) = 3e-08 Identities = 33/66 (50%), Positives = 38/66 (57%), Gaps = 10/66 (15%) Frame = -3 Query: 170 KPPTPPPYVYKSP---PYVYKPPTP-PPYESP----PYVYKPPTPPPYVYE--SPPYVYK 21 KPPTP P YK P P +KPPTP PP P P +KPPTP P ++ +P YK Sbjct: 228 KPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPPAHKPTTPTPAYK 287 Query: 20 PPTPPP 3 PPTP P Sbjct: 288 PPTPTP 293 Score = 20.8 bits (42), Expect(2) = 3e-08 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 216 PTPPPYVYESP 184 PTPPPY +P Sbjct: 212 PTPPPYKPPTP 222 Score = 57.0 bits (136), Expect(2) = 2e-07 Identities = 30/64 (46%), Positives = 38/64 (59%), Gaps = 7/64 (10%) Frame = -3 Query: 173 YKPPTPPPYVYK--SPPYVYKPPTP-PPYESP----PYVYKPPTPPPYVYESPPYVYKPP 15 +KPPTP P +K +P YKPPTP PP + P P +KPPTP P Y++P P Sbjct: 267 HKPPTPTPPAHKPTTPTPAYKPPTPTPPADKPPTPTPLAHKPPTPTPPAYKAP-----TP 321 Query: 14 TPPP 3 +PPP Sbjct: 322 SPPP 325 Score = 21.2 bits (43), Expect(2) = 2e-07 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PPTP P Y+ P Sbjct: 229 PPTPTPPAYKPP 240 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/66 (48%), Positives = 36/66 (54%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKP-PTPPPYVYKSPPYVYKPPTP-PPYESPPY----VYKPPTPPPYVYESP---PYVYK 21 YKP P P P K P YKPPTP PP + PP YKPPTP P ++ P P +K Sbjct: 199 YKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHK 258 Query: 20 PPTPPP 3 P TP P Sbjct: 259 PATPTP 264 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/67 (44%), Positives = 36/67 (53%), Gaps = 10/67 (14%) Frame = -3 Query: 173 YKPPTPPPYVYK---SPPYVYKPPTPPP----YESPPYVYKPPTPPPYVYESP---PYVY 24 +KPPTP P +K P +KPPTP P +P YKPPTP P + P P + Sbjct: 247 HKPPTPTPPAHKPATPTPPAHKPPTPTPPAHKPTTPTPAYKPPTPTPPADKPPTPTPLAH 306 Query: 23 KPPTPPP 3 KPPTP P Sbjct: 307 KPPTPTP 313 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/63 (47%), Positives = 36/63 (57%), Gaps = 9/63 (14%) Frame = -3 Query: 164 PTPPPYVYKSP-PYVYKP--PTPPPYESP---PYVYKPPTPPPYVYE---SPPYVYKPPT 12 PTPPPY +P P KP PTPP Y+ P P +KPPTP P ++ P +KPPT Sbjct: 212 PTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPT 271 Query: 11 PPP 3 P P Sbjct: 272 PTP 274 [132][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/55 (58%), Positives = 35/55 (63%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP V PPTPPP SPP + PPTPPP SPP + PPTPPP Sbjct: 2112 PPSPPPL---PPPPVPPPPTPPP--SPPPLPPPPTPPP----SPPPLPPPPTPPP 2157 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/57 (45%), Positives = 34/57 (59%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 + P PPP + SPP PP+PPP PP + PP+PPP + PP + PP+PPP Sbjct: 355 FSPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPL--PPPPIPPPPSPPP 409 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/55 (54%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PPTPPP SPP PPTPPP Sbjct: 761 PPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPPPPTPPPSPPPSPP----PPTPPP 810 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PPTPPP PP PP+PPP + PP PP PPP Sbjct: 966 PPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPP 1020 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/55 (56%), Positives = 34/55 (61%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PPTPPP SPP + PPTPPP SPP + PPTPPP +SPP PP PP Sbjct: 2126 PPTPPP----SPPPLPPPPTPPP--SPPPLPPPPTPPP---QSPPLPSPPPPSPP 2171 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PPTPPP SPP PPTPPP PP PP+PPP + PP PP PPP Sbjct: 792 PPTPPPSPPPSPP----PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPP 842 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/62 (48%), Positives = 32/62 (51%), Gaps = 7/62 (11%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYV-------YKPPTPPPYVYESPPYVYKPPTP 9 PP+PPP SPP PPTPPP PP PP+PPP SPP PPTP Sbjct: 726 PPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPSPPPPTP 785 Query: 8 PP 3 PP Sbjct: 786 PP 787 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESP---PYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PPTPPP SPP + PPTPPP P P PPTPPP SP + PP PPP Sbjct: 2139 PPTPPP----SPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPP 2192 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP PPP SPP PPTPPP Sbjct: 852 PPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP----PPTPPP 901 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP PPP SPP PPTPPP Sbjct: 1030 PPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP----PPTPPP 1079 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP PPP SPP PPTPPP Sbjct: 1121 PPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPPPPAPPPSPPPSPP----PPTPPP 1170 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/60 (51%), Positives = 35/60 (58%), Gaps = 5/60 (8%) Frame = -3 Query: 167 PPTPPPYVYKS-----PPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + S PP PP+PPP PP V PPTPPP SPP + PPTPPP Sbjct: 2090 PPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPP-VPPPPTPPP----SPPPLPPPPTPPP 2144 Score = 55.8 bits (133), Expect(2) = 5e-07 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP PP PPP PP + PP+PPP SPP PP+PPP Sbjct: 820 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPP-PSPPPSPPP 873 Score = 54.7 bits (130), Expect(2) = 5e-07 Identities = 28/58 (48%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Frame = -3 Query: 167 PPTPPPYVYKSPPY---VYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP + PP+PPP PP V PP+PPP PP + PP+PPP Sbjct: 1590 PPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPL---PPPPLPPPPSPPP 1644 Score = 22.3 bits (46), Expect(2) = 5e-07 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 219 PPTPPPYVYESPL 181 PP PPP V SPL Sbjct: 1568 PPLPPPPVPPSPL 1580 Score = 21.2 bits (43), Expect(2) = 5e-07 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PPTPPP SP Sbjct: 792 PPTPPPSPPPSP 803 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PPTPPP PP PP+PPP + PP PP PPP Sbjct: 883 PPAPPPSPPPSPP----PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPP 933 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PPTPPP PP PP+PPP + PP PP PPP Sbjct: 1061 PPAPPPSPPPSPP----PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPP 1111 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP + PP PPP PP PP+PPP SPP PPTPPP Sbjct: 938 PPVPPP---PSPPPLPPPPLPPP-PLPPPPSPPPSPPPSPPPSPPPSPPPPTPPP 988 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PP PP PP+PPP SPP PPTPPP Sbjct: 698 PPSPPP----SPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPP 748 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP PP PPP PP V PP+PPP PP + PP PPP Sbjct: 911 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPL---PPPPLPPPPLPPP 962 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP PP PPP PP + PP+PPP SPP PP+PPP Sbjct: 998 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPP-PSPPPSPPP 1051 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP PP PPP PP + PP+PPP SPP PP+PPP Sbjct: 1089 PPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPP-PSPPPSPPP 1142 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP + PP PPP PP PP+PPP SPP PPTPPP Sbjct: 1210 PPSPPPL---PPPPLPPPPLPPPPSPPP--SPPPSPPPSPPPSPPPSPPPPTPPP 1259 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PPTPPP +PP PPTPPP SPP PPTPPP Sbjct: 1237 PPSPPPSPPPSPPPSPPPPTPPP-PAPP----PPTPPP----SPP----PPTPPP 1278 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP P P SPP PP+PPP PP + PP PPP + P PP+PPP Sbjct: 685 PPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPP 739 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PP+PPP PP PP PPP SPP PP+PPP Sbjct: 722 PPLPPPSPPPSPP-PSPPPSPPPPTPPPPAPPPPAPPPAPPPSPP-PSPPPSPPP 774 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PPTPPP PP PP+PPP + PP PP PPP Sbjct: 1152 PPAPPPSPPPSPP----PPTPPPPAPPPPNPPPPSPPPPL--PPPPSPPPPLPPP 1200 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/55 (47%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP PPP PP + PP+PPP + PP + PP PPP Sbjct: 1160 PPSPPPPT--PPPPAPPPPNPPPPSPPPPLPPPPSPPPPL--PPPPLPPPPVPPP 1210 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/57 (49%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKP--PTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP P P PPP PP + PP PPP SPP + PP PPP Sbjct: 1586 PPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPP---PSPPPLPPPPLPPP 1639 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/55 (50%), Positives = 34/55 (61%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP V PP+PPP PP + PP+PPP SPP PP+PPP Sbjct: 1610 PPSPPPPL--PPPPVPPPPSPPPLPPPP-LPPPPSPPPSPPPSPP-PSPPPSPPP 1660 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/57 (49%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPY--VYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP + PP PPP PP PP+PPP SP + PPTPPP Sbjct: 1620 PPVPPP---PSPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPP 1673 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP + PP PPP PP PP+PPP SPP PPTPPP Sbjct: 832 PPSPPPPL--PPPPLPPPPLPPPPSPPP--SPPPSPPPSPPPSPP----PPTPPP 878 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP + PP PPP PP PP+PPP SPP PPTPPP Sbjct: 1010 PPSPPPPL--PPPPLPPPPLPPPPSPPP--SPPPSPPPSPPPSPP----PPTPPP 1056 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP + PP PPP PP PP+PPP SPP PPTPPP Sbjct: 1101 PPSPPPPL--PPPPLPPPPLPPPPSPPP--SPPPSPPPSPPPSPP----PPTPPP 1147 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP V PP PP PPP PP + PP+PPP SPP PP+PPP Sbjct: 1200 PPLPPPPV---PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPP-PSPPPSPPP 1250 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP P + PP+PPP PP + PP PPP SPP + PP PPP Sbjct: 906 PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPP---PSPPPLPPPPLPPP 957 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP PPP P + PP+PPP Sbjct: 962 PPSPPPSPPPSPP-PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPP 1015 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/56 (48%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -3 Query: 167 PPTPPPYVYKSP-PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PPTPPP P P PP+PPP PP PP PPP PP + PP+PPP Sbjct: 1142 PPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP--SPPPPLPPPPSPPP 1195 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PPTPPP PP PP+PPP PP PP PPP + PP V PP+PPP Sbjct: 1165 PPTPPPPA--PPPPNPPPPSPPPPLPPPPSPPPPLPPPPL--PPPPVPPPPSPPP 1215 [133][TOP] >UniRef100_O24443 Cell wall type 2 proline rich protein PvPRP2-37 (Fragment) n=1 Tax=Phaseolus vulgaris RepID=O24443_PHAVU Length = 81 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/69 (52%), Positives = 38/69 (55%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VY PP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 4 VYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 63 Query: 29 VYKPPTPPP 3 VYKPP P Sbjct: 64 VYKPPVEKP 72 Score = 61.2 bits (147), Expect = 3e-08 Identities = 36/65 (55%), Positives = 38/65 (58%), Gaps = 11/65 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PY 30 VYKPP P VYK P P VYKPP PP Y+ P P VYKPP P VY+ P P Sbjct: 14 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 73 Query: 29 VYKPP 15 VYKPP Sbjct: 74 VYKPP 78 Score = 53.1 bits (126), Expect = 9e-06 Identities = 33/64 (51%), Positives = 35/64 (54%), Gaps = 8/64 (12%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT--PPPYESP---PYVYKPPTPPPYVYESP---PYVYKPP 15 KPP P V K P VYKPP PP Y+ P P VYKPP P VY+ P P VYKPP Sbjct: 1 KPPVYNPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 58 Query: 14 TPPP 3 P Sbjct: 59 VEKP 62 [134][TOP] >UniRef100_UPI00001631D5 LRX2 (LEUCINE-RICH REPEAT/EXTENSIN 2); protein binding / structural constituent of cell wall n=1 Tax=Arabidopsis thaliana RepID=UPI00001631D5 Length = 826 Score = 55.5 bits (132), Expect(2) = 4e-08 Identities = 34/70 (48%), Positives = 36/70 (51%), Gaps = 15/70 (21%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYK-PPT-----PPPYE---SPPYVYKPPTPPPYVYES--PPYVY- 24 P PPPY+Y SPP V PPT PP YE SP Y P+PP Y Y S PP Y Sbjct: 554 PSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYY 613 Query: 23 ---KPPTPPP 3 PP PPP Sbjct: 614 ATQSPPPPPP 623 Score = 25.4 bits (54), Expect(2) = 4e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y SP Sbjct: 538 PSPPPPYIYSSP 549 Score = 52.4 bits (124), Expect(2) = 3e-07 Identities = 28/61 (45%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -3 Query: 173 YKPPTPPPYVYKS---PPYVYKPPTPPPYESPPY--VYKPPTPPPYVYESPPYVYKPPTP 9 Y P+PP Y Y S PP Y +PPP P Y V PP PPP Y PP PP P Sbjct: 593 YPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYY--PPVTASPPPP 650 Query: 8 P 6 P Sbjct: 651 P 651 Score = 25.4 bits (54), Expect(2) = 3e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y SP Sbjct: 554 PSPPPPYIYSSP 565 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/76 (40%), Positives = 34/76 (44%), Gaps = 8/76 (10%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPP--------YVYKPPTPPPYESPPYVYKPPTPPPY 51 P M+ Y PP PPP SPP V P PPP PP P PPPY Sbjct: 489 PSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPP----PSPPPPY 544 Query: 50 VYESPPYVYKPPTPPP 3 +Y SPP PP+P P Sbjct: 545 IYSSPP----PPSPSP 556 Score = 52.4 bits (124), Expect(2) = 9e-06 Identities = 31/74 (41%), Positives = 35/74 (47%), Gaps = 15/74 (20%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYK--------PPT---PPPYVYE- 42 +Y PP PP PPY+Y PP P P PPY+Y PPT PPP YE Sbjct: 526 AYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQ 585 Query: 41 --SPPYVYKPPTPP 6 SP Y P+PP Sbjct: 586 TPSPREYYPSPSPP 599 Score = 20.4 bits (41), Expect(2) = 9e-06 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 Query: 219 PPTPPPYVYE 190 PP PPP YE Sbjct: 501 PPPPPPPEYE 510 [135][TOP] >UniRef100_O48809 F24O1.18 n=1 Tax=Arabidopsis thaliana RepID=O48809_ARATH Length = 786 Score = 55.5 bits (132), Expect(2) = 4e-08 Identities = 34/70 (48%), Positives = 36/70 (51%), Gaps = 15/70 (21%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYK-PPT-----PPPYE---SPPYVYKPPTPPPYVYES--PPYVY- 24 P PPPY+Y SPP V PPT PP YE SP Y P+PP Y Y S PP Y Sbjct: 514 PSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYY 573 Query: 23 ---KPPTPPP 3 PP PPP Sbjct: 574 ATQSPPPPPP 583 Score = 25.4 bits (54), Expect(2) = 4e-08 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y SP Sbjct: 498 PSPPPPYIYSSP 509 Score = 52.4 bits (124), Expect(2) = 3e-07 Identities = 28/61 (45%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -3 Query: 173 YKPPTPPPYVYKS---PPYVYKPPTPPPYESPPY--VYKPPTPPPYVYESPPYVYKPPTP 9 Y P+PP Y Y S PP Y +PPP P Y V PP PPP Y PP PP P Sbjct: 553 YPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYY--PPVTASPPPP 610 Query: 8 P 6 P Sbjct: 611 P 611 Score = 25.4 bits (54), Expect(2) = 3e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY+Y SP Sbjct: 514 PSPPPPYIYSSP 525 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/76 (40%), Positives = 34/76 (44%), Gaps = 8/76 (10%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPP--------YVYKPPTPPPYESPPYVYKPPTPPPY 51 P M+ Y PP PPP SPP V P PPP PP P PPPY Sbjct: 449 PSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPP----PSPPPPY 504 Query: 50 VYESPPYVYKPPTPPP 3 +Y SPP PP+P P Sbjct: 505 IYSSPP----PPSPSP 516 Score = 52.4 bits (124), Expect(2) = 9e-06 Identities = 31/74 (41%), Positives = 35/74 (47%), Gaps = 15/74 (20%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYK--------PPT---PPPYVYE- 42 +Y PP PP PPY+Y PP P P PPY+Y PPT PPP YE Sbjct: 486 AYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQ 545 Query: 41 --SPPYVYKPPTPP 6 SP Y P+PP Sbjct: 546 TPSPREYYPSPSPP 559 Score = 20.4 bits (41), Expect(2) = 9e-06 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 Query: 219 PPTPPPYVYE 190 PP PPP YE Sbjct: 461 PPPPPPPEYE 470 [136][TOP] >UniRef100_Q8RWX5 Putative uncharacterized protein At3g19020 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q8RWX5_ARATH Length = 712 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/67 (47%), Positives = 39/67 (58%), Gaps = 9/67 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP-----TPPPYVYESPPYVYKPP- 15 V+ PP PPP V+ PP V+ PP PP + PP VY PP PPP V+ PP V+ PP Sbjct: 644 VHSPPPPPP-VHSPPPPVFSPP-PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPP 701 Query: 14 ---TPPP 3 +PPP Sbjct: 702 PVHSPPP 708 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/65 (47%), Positives = 37/65 (56%), Gaps = 10/65 (15%) Frame = -3 Query: 170 KPPTPPPYVYK-----SPPYVYKPPTPPPYES-PPYVYKPP----TPPPYVYESPPYVYK 21 +PP+P K SPP V+ PP PPP S PP V+ PP +PPP VY PP V+ Sbjct: 625 QPPSPSTEETKTTSPQSPP-VHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHS 683 Query: 20 PPTPP 6 PP PP Sbjct: 684 PPPPP 688 [137][TOP] >UniRef100_B9RQU4 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RQU4_RICCO Length = 154 Score = 59.7 bits (143), Expect(2) = 5e-08 Identities = 34/71 (47%), Positives = 41/71 (57%), Gaps = 13/71 (18%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPP------YVYKPPTPPPYESPP-YVYKPPTPPPYVYE--SPP-- 33 Y Y+ P+PP + K P Y YK P PPP SPP Y +K P PPP+VY+ SPP Sbjct: 40 YKYESPSPPHHKCKHTPLAPLPFYTYKSPPPPP--SPPVYEHKSPPPPPFVYKYWSPPPP 97 Query: 32 --YVYKPPTPP 6 Y Y+PP PP Sbjct: 98 PVYRYEPPPPP 108 Score = 20.8 bits (42), Expect(2) = 5e-08 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P Y YESP Sbjct: 34 PPPPFHYKYESP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 39/91 (42%), Positives = 42/91 (46%), Gaps = 29/91 (31%) Frame = -3 Query: 188 HHSYVYKPPTPPP-YVYKSPPYVYKPPTPPPYE-----SPPYVYK---PPTPPPYVYESP 36 HH + P P P Y YKSPP PP+PP YE PP+VYK PP PP Y YE P Sbjct: 49 HHKCKHTPLAPLPFYTYKSPP---PPPSPPVYEHKSPPPPPFVYKYWSPPPPPVYRYEPP 105 Query: 35 -------------------PYV-YKPPTPPP 3 PYV YK P PPP Sbjct: 106 PPPKHHHHHHHHKHKWSPYPYVTYKSPPPPP 136 Score = 54.7 bits (130), Expect(2) = 5e-07 Identities = 36/76 (47%), Positives = 40/76 (52%), Gaps = 18/76 (23%) Frame = -3 Query: 179 YVYKPPTPPPYVYK--SPP----YVYKPPTPPPYE----------SP-PYV-YKPPTPPP 54 Y +K P PPP+VYK SPP Y Y+PP PP + SP PYV YK P PPP Sbjct: 77 YEHKSPPPPPFVYKYWSPPPPPVYRYEPPPPPKHHHHHHHHKHKWSPYPYVTYKSPPPPP 136 Query: 53 YVYESPPYVYKPPTPP 6 E P Y Y P PP Sbjct: 137 K-QEYPVYHYISPAPP 151 Score = 22.3 bits (46), Expect(2) = 5e-07 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+PP Y ++SP Sbjct: 71 PPSPPVYEHKSP 82 [138][TOP] >UniRef100_Q9XIB6 F13F21.7 protein n=1 Tax=Arabidopsis thaliana RepID=Q9XIB6_ARATH Length = 847 Score = 60.5 bits (145), Expect = 6e-08 Identities = 37/81 (45%), Positives = 45/81 (55%), Gaps = 21/81 (25%) Frame = -3 Query: 182 SYVYKPP----TPPPYVYKSPP--YVYKPP----TPPPYESPPYVYKPP-----TPPPYV 48 S +Y PP +PPP VY SPP +VY PP +PPP PP V+ PP +PPP V Sbjct: 547 SPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPV 606 Query: 47 YESPP--YVYKPP----TPPP 3 + PP VY PP +PPP Sbjct: 607 FSPPPPSPVYSPPPPSHSPPP 627 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PP SPP P PP + PP VY P PPP+VY PP V PP P P Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSP-PPPHVYSPPPPVASPPPPSP 587 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/71 (42%), Positives = 37/71 (52%), Gaps = 12/71 (16%) Frame = -3 Query: 179 YVYKPPTP--PPYVYKSPPYVYKPPTPPPYESPPYVYKPP------TPPPYVYESPPYVY 24 +VY PP P P PP V+ PP PP + PP V+ PP +PPP + PP VY Sbjct: 571 HVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVY 630 Query: 23 KPP----TPPP 3 PP +PPP Sbjct: 631 SPPPPTFSPPP 641 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/73 (41%), Positives = 36/73 (49%), Gaps = 19/73 (26%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPP-----------------TPPPYVYE 42 P+PP +Y PP V+ PP PP Y S PP+VY PP PPP V+ Sbjct: 543 PSPPSPIYSPPPPVHSPP-PPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFS 601 Query: 41 SPPYVYKPPTPPP 3 PP V+ PP P P Sbjct: 602 PPPPVFSPPPPSP 614 [139][TOP] >UniRef100_C7J344 Os05g0397650 protein n=1 Tax=Oryza sativa Japonica Group RepID=C7J344_ORYSJ Length = 334 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/62 (43%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -3 Query: 188 HHSYVYKPPTPPP-YVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 HH Y Y PP PPP + + PP PP PPP+ + Y+PP PP + S Y Y P Sbjct: 25 HHYYTYPPPPPPPPHHHHHPP----PPPPPPHHHHQHPYRPPPPPHHATSSSSYYYHHPP 80 Query: 11 PP 6 PP Sbjct: 81 PP 82 [140][TOP] >UniRef100_B9MST9 GASA-like protein n=1 Tax=Gossypium hirsutum RepID=B9MST9_GOSHI Length = 264 Score = 60.5 bits (145), Expect = 6e-08 Identities = 33/61 (54%), Positives = 37/61 (60%), Gaps = 4/61 (6%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTP---PPYVYESPPYVYKPPTPP 6 YKPP P P K+P YKPP P PP ++P YKPPTP PP +PP YKPPTP Sbjct: 91 YKPPAPAPPT-KAPTPPYKPPAPAPPTKAPTPPYKPPTPAPAPPVKAPTPP--YKPPTPA 147 Query: 5 P 3 P Sbjct: 148 P 148 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTP-PPYVYESPPYVYKPPTPPP 3 YKPP P P K+P YKPP P PP ++P YKPP P PP +PPY KPPTP P Sbjct: 75 YKPPAPAPPT-KAPTPPYKPPAPAPPTKAPTPPYKPPAPAPPTKAPTPPY--KPPTPAP 130 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTP-PPYVYESPPYVYKPPTPPP 3 YK PTP P K+P YKPP P PP ++P YKPP P PP +PP YKPP P P Sbjct: 59 YKAPTPAPPT-KAPTPPYKPPAPAPPTKAPTPPYKPPAPAPPTKAPTPP--YKPPAPAP 114 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/74 (44%), Positives = 37/74 (50%), Gaps = 17/74 (22%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP---PPYESPPYVYKPPTP--------------PPYVY 45 YKPP P P K+P YKPPTP PP ++P YKPPTP PP Sbjct: 107 YKPPAPAPPT-KAPTPPYKPPTPAPAPPVKAPTPPYKPPTPAPAPPTKAPTPAPAPPTKA 165 Query: 44 ESPPYVYKPPTPPP 3 +PP YKPP P P Sbjct: 166 PTPP--YKPPVPTP 177 [141][TOP] >UniRef100_B9FPG8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FPG8_ORYSJ Length = 309 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/62 (43%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -3 Query: 188 HHSYVYKP-PTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 HH Y Y P P PPP+ + PP PP PPP+ + Y+PP PP + S Y Y P Sbjct: 25 HHYYTYPPAPPPPPHHHHHPP----PPPPPPHHHHQHPYRPPPPPHHATSSSSYYYHHPP 80 Query: 11 PP 6 PP Sbjct: 81 PP 82 [142][TOP] >UniRef100_A5AGJ1 Putative uncharacterized protein (Fragment) n=1 Tax=Vitis vinifera RepID=A5AGJ1_VITVI Length = 155 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/69 (50%), Positives = 36/69 (52%), Gaps = 19/69 (27%) Frame = -3 Query: 158 PPPYVYK------------SPPYVYKPPTP---PPYESPPYVYKPPTP----PPYVYESP 36 PPPY +K PP YKPPTP PP E PP YKPPTP PP E P Sbjct: 26 PPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPPVEKPPPEYKPPTPVYKSPP--VEKP 83 Query: 35 PYVYKPPTP 9 P YKPPTP Sbjct: 84 PPEYKPPTP 92 Score = 58.9 bits (141), Expect = 2e-07 Identities = 36/62 (58%), Positives = 37/62 (59%), Gaps = 8/62 (12%) Frame = -3 Query: 173 YKPPTPPPYVYK----SPPYVYKPPTP----PPYESPPYVYKPPTPPPYVYESPPYVYKP 18 YKPPTP VYK PP YKPPTP PP E PP YKPPTP VY PP V KP Sbjct: 50 YKPPTP---VYKPPVEKPPPEYKPPTPVYKSPPVEKPPPEYKPPTP---VYXXPP-VEKP 102 Query: 17 PT 12 P+ Sbjct: 103 PS 104 Score = 57.8 bits (138), Expect = 4e-07 Identities = 37/77 (48%), Positives = 39/77 (50%), Gaps = 18/77 (23%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY-----VYKPPTP---PPYESPPYVYKPPTP---------PPY 51 Y +KPP P VYKSPP YKPPTP PP E PP YKPPTP PP Sbjct: 29 YEHKPPLP---VYKSPPLGKPPPEYKPPTPVYKPPVEKPPPEYKPPTPVYKSPPVEKPPP 85 Query: 50 VYESPPYVY-KPPTPPP 3 Y+ P VY PP P Sbjct: 86 EYKPPTPVYXXPPVEKP 102 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/52 (55%), Positives = 31/52 (59%), Gaps = 7/52 (13%) Frame = -3 Query: 143 YKSPPYVYKPPTP----PPYESPPYVYKPPTP---PPYVYESPPYVYKPPTP 9 +K PPY +KPP P PP PP YKPPTP PP E PP YKPPTP Sbjct: 24 HKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPP--VEKPPPEYKPPTP 73 [143][TOP] >UniRef100_A2Y4E4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2Y4E4_ORYSI Length = 359 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/62 (43%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -3 Query: 188 HHSYVYKPPTPP-PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 HH Y Y PP PP P+ + PP PP PPP+ + Y+PP PP + S Y Y P Sbjct: 29 HHYYTYPPPPPPAPHHHHHPP----PPPPPPHHHHQHPYRPPPPPHHATSSSSYYYHHPP 84 Query: 11 PP 6 PP Sbjct: 85 PP 86 [144][TOP] >UniRef100_Q9FLQ7 Formin-like protein 20 n=1 Tax=Arabidopsis thaliana RepID=FH20_ARATH Length = 1615 Score = 58.2 bits (139), Expect(2) = 6e-08 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP Y SPP PP PP Y SPP PP PPP Y SPP PP PPP Sbjct: 958 PPPPPPPSYGSPP--PPPPPPPGYGSPP----PPPPPPPSYGSPP----PPPPPP 1002 Score = 21.9 bits (45), Expect(2) = 6e-08 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y SP Sbjct: 945 PPPPPPPSYGSP 956 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/55 (56%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP Y SPP PP PP Y SPP PP PPP Y SPP PP PPP Sbjct: 945 PPPPPPPSYGSPP--PPPPPPPSYGSPP----PPPPPPPGYGSPP----PPPPPP 989 Score = 53.1 bits (126), Expect(2) = 2e-06 Identities = 26/55 (47%), Positives = 29/55 (52%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP Y SPP PP PPP+ + PP PPP +PP PP PPP Sbjct: 984 PPPPPPPSYGSPP----PPPPPPFSHVSSIPPPPPPPPMHGGAPP----PPPPPP 1030 Score = 21.9 bits (45), Expect(2) = 2e-06 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y SP Sbjct: 958 PPPPPPPSYGSP 969 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/63 (50%), Positives = 34/63 (53%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 N HS + +PPP Y SPP PP PP Y SPP PP PPP Y SPP PP Sbjct: 928 NAHSVL----SPPPPSYGSPP--PPPPPPPSYGSPP----PPPPPPPSYGSPP----PPP 973 Query: 11 PPP 3 PPP Sbjct: 974 PPP 976 [145][TOP] >UniRef100_UPI000023E328 hypothetical protein FG01070.1 n=1 Tax=Gibberella zeae PH-1 RepID=UPI000023E328 Length = 217 Score = 55.1 bits (131), Expect(2) = 7e-08 Identities = 26/57 (45%), Positives = 28/57 (49%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 +Y+PP PPP PP Y PP PPP P PP PPP P V KP PP Sbjct: 47 IYRPPLPPP----PPPQFYPPPPPPPVIEVPCSPPPPPPPPVEKPKPKPVPKPSPPP 99 Score = 25.0 bits (53), Expect(2) = 7e-08 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 219 PPTPPPYVYESPL 181 PP PPP +Y PL Sbjct: 40 PPPPPPVIYRPPL 52 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/58 (48%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYE--SPPYVYKPPTPPP 3 + P+PPP PP +Y+PP PPP PP Y PP PPP + SPP PP PPP Sbjct: 36 REPSPPP----PPPVIYRPPLPPP--PPPQFYPPPPPPPVIEVPCSPP----PPPPPP 83 [146][TOP] >UniRef100_Q4RSI9 Chromosome 13 SCAF15000, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RSI9_TETNG Length = 307 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 5/60 (8%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPP----PYVYESPPYVYKP-PTPPP 3 PP+PPP ++ PP+ PP+ PP PPY P PP P+++ PP+ + P P PPP Sbjct: 205 PPSPPPSLFSPPPFFSPPPSFPPLPPPPYFSPLPLPPFFLLPFLFPPPPFFFPPKPNPPP 264 [147][TOP] >UniRef100_Q9SPM1 Extensin-like protein n=1 Tax=Solanum lycopersicum RepID=Q9SPM1_SOLLC Length = 711 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/66 (46%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYK 21 V+ PP +PPP V+ PP V PP PP + PP V+ PP +PPP V PP V+ Sbjct: 534 VHSPPPPVHSPPPPVHSPPPPVASPP-PPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHS 592 Query: 20 PPTPPP 3 PP PPP Sbjct: 593 PPPPPP 598 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYES-PPYVYKPP----TPPPYVYESPPYVY 24 V+ PP +PPP V PP V+ PP PPP S PP V+ PP +PPP V+ PP V Sbjct: 569 VHSPPPPVHSPPPPVASPPPPVHSPPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVA 628 Query: 23 KPP----TPPP 3 PP +PPP Sbjct: 629 SPPPPVHSPPP 639 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/65 (46%), Positives = 37/65 (56%), Gaps = 10/65 (15%) Frame = -3 Query: 167 PP--TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYKPP--- 15 PP +PPP V PP V+ PP PP PP V+ PP +PPP V+ PP V+ PP Sbjct: 454 PPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPPV 513 Query: 14 -TPPP 3 +PPP Sbjct: 514 ASPPP 518 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYK 21 V+ PP +PPP V+ PP V+ PP PP + PP V+ PP +PPP V PP V+ Sbjct: 506 VHSPPPPVASPPPPVHSPPPPVHSPP-PPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHS 564 Query: 20 PP----TPPP 3 PP +PPP Sbjct: 565 PPPPVHSPPP 574 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/71 (43%), Positives = 40/71 (56%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPP-----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVY 24 V+ PP +PPP V+ PP V PP PP + PP V+ PP +PPP V+ PP V+ Sbjct: 470 VHSPPPPPVASPPPPVHSPPPPVASPP-PPVHSPPPPVHSPPPPVASPPPPVHSPPPPVH 528 Query: 23 KPP----TPPP 3 PP +PPP Sbjct: 529 SPPPPVHSPPP 539 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/72 (45%), Positives = 40/72 (55%), Gaps = 14/72 (19%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTP-----PPYESPPY-VYKPPTPPPYVYESPPYV 27 V+ PP +PPP V+ PP V+ PP P PP SPP V+ PP PPP V PP V Sbjct: 548 VHSPPPPVASPPPPVHSPPPPVHSPPPPVHSPPPPVASPPPPVHSPPPPPP-VASPPPPV 606 Query: 26 YKPP----TPPP 3 + PP +PPP Sbjct: 607 HSPPPPVASPPP 618 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/70 (44%), Positives = 39/70 (55%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYK 21 V+ PP +PPP V PP V+ PP PP + PP V+ PP +PPP V+ PP V Sbjct: 499 VHSPPPPVHSPPPPVASPPPPVHSPP-PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVAS 557 Query: 20 PP----TPPP 3 PP +PPP Sbjct: 558 PPPPVHSPPP 567 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 V+ PP +PPP V+ PP V+ PP PP + PP V P PP V+ PP V+ PP P Sbjct: 620 VHSPPPPVASPPPPVHSPPPPVHSPP-PPVHSPPPPVASP--PPALVFSPPPPVHSPPPP 676 Query: 8 PP 3 P Sbjct: 677 AP 678 [148][TOP] >UniRef100_UPI0001985C48 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985C48 Length = 533 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/92 (41%), Positives = 41/92 (44%), Gaps = 21/92 (22%) Frame = -3 Query: 215 QHLPHMCMNHHSYVYKPPT-PPPYVYK----SPPYVYKPP------------TPPPYESP 87 +H PH+ H KPP PPYV PPYV KPP PP P Sbjct: 348 KHPPHVKPPHTPMPPKPPAVKPPYVPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPPVVKP 407 Query: 86 PYVYKPPT----PPPYVYESPPYVYKPPTPPP 3 PYV KPP PPP V+ PP PP PPP Sbjct: 408 PYVPKPPVVQPPPPPVVHPPPPPTPCPPPPPP 439 [149][TOP] >UniRef100_Q9S858 HRGP=HYDROXYPROLINE-rich glycoprotein (Fragment) n=1 Tax=Glycine max RepID=Q9S858_SOYBN Length = 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/61 (52%), Positives = 35/61 (57%), Gaps = 7/61 (11%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYESPPYVYK-PPTPPPYVYESP------PYVYKPPTPP 6 P+P P YKSPP PP+P PY YK PP PPPY Y+SP PY YK P PP Sbjct: 5 PSPTPDYYKSPP----PPSPTPY------YKSPPPPPPYYYKSPPPPSPAPYYYKSPPPP 54 Query: 5 P 3 P Sbjct: 55 P 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/46 (54%), Positives = 27/46 (58%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYE 42 Y PP PPPY YKSPP PP+P PY Y PP PPPY Y+ Sbjct: 23 YYKSPPPPPPYYYKSPP----PPSPAPY----YYKSPPPPPPYYYK 60 [150][TOP] >UniRef100_Q9M4I2 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera RepID=Q9M4I2_VITVI Length = 204 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/80 (47%), Positives = 41/80 (51%), Gaps = 21/80 (26%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPY-----VYKPPTP----PPYESPPYVYKPPTP---------PP 54 Y +KPP P VYKSPP YKPPTP PP E PP YKP TP PP Sbjct: 30 YEHKPPLP---VYKSPPLGKPPPEYKPPTPVYRPPPVEKPPPEYKPLTPVYKSPPVEKPP 86 Query: 53 YVYESPPYVYKPP---TPPP 3 Y+ P VY+PP PPP Sbjct: 87 PEYKPPTPVYRPPPVEKPPP 106 Score = 58.9 bits (141), Expect = 2e-07 Identities = 41/90 (45%), Positives = 42/90 (46%), Gaps = 32/90 (35%) Frame = -3 Query: 176 VYKPPT----PPPY-----VYKSPPYV-----YKPPTP----PPYESPPYVYKPPTP--- 60 VY+PP PP Y VYKSPP YKPPTP PP E PP YKPPTP Sbjct: 57 VYRPPPVEKPPPEYKPLTPVYKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKP 116 Query: 59 -----------PPYVYESPPYVYKPPTPPP 3 PP V PP KPPT PP Sbjct: 117 PPPPKHKTPTLPPRVVRPPP-TPKPPTLPP 145 Score = 56.2 bits (134), Expect = 1e-06 Identities = 34/70 (48%), Positives = 35/70 (50%), Gaps = 20/70 (28%) Frame = -3 Query: 158 PPPYVYK------------SPPYVYKPPT----PPPYESPPYVYKPPTP----PPYVYES 39 PPPY +K PP YKPPT PPP E PP YKP TP PP E Sbjct: 27 PPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYRPPPVEKPPPEYKPLTPVYKSPP--VEK 84 Query: 38 PPYVYKPPTP 9 PP YKPPTP Sbjct: 85 PPPEYKPPTP 94 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/52 (55%), Positives = 31/52 (59%), Gaps = 7/52 (13%) Frame = -3 Query: 143 YKSPPYVYKPPTP----PPYESPPYVYKPPTP---PPYVYESPPYVYKPPTP 9 +K PPY +KPP P PP PP YKPPTP PP V E PP YKP TP Sbjct: 25 HKPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYRPPPV-EKPPPEYKPLTP 75 [151][TOP] >UniRef100_C6T6W7 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=C6T6W7_SOYBN Length = 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/57 (52%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVY-KPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 YK P PPP Y PPY Y PP P P PPY Y P PPP +P Y+YK P PP Sbjct: 2 YKSP-PPPTSYPPPPYHYVSPPPPSPSPPPPYHYTSP-PPPSPAPAPKYIYKSPPPP 56 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/68 (45%), Positives = 34/68 (50%), Gaps = 10/68 (14%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVY-KPPTPPPYESPPYVYKPPTP------PPYVYESPP---Y 30 Y PP PP Y PPY Y PP P P PPY Y P P P Y+Y+SPP Y Sbjct: 1 YYKSPP--PPTSYPPPPYHYVSPPPPSPSPPPPYHYTSPPPPSPAPAPKYIYKSPPPPVY 58 Query: 29 VYKPPTPP 6 +Y P PP Sbjct: 59 IYASPPPP 66 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/55 (50%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = -3 Query: 185 HSYVYKPPT----PPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP 33 + YV PP PPPY Y SPP PP+P P +P Y+YK P PP Y+Y SPP Sbjct: 16 YHYVSPPPPSPSPPPPYHYTSPP----PPSPAP--APKYIYKSPPPPVYIYASPP 64 [152][TOP] >UniRef100_B9S3J8 Repetitive proline-rich cell wall protein 2, putative n=1 Tax=Ricinus communis RepID=B9S3J8_RICCO Length = 299 Score = 59.7 bits (143), Expect = 1e-07 Identities = 33/69 (47%), Positives = 39/69 (56%), Gaps = 11/69 (15%) Frame = -3 Query: 179 YVYKPPT--PPPYVYKSP-----PYVYKPPT--PPPYESPPYVYKPPTPPPYVYESPPYV 27 Y+ KPP PPP+V K P P+V KPP PPP+ P + PP PP SPPY+ Sbjct: 99 YIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPPNPPVTPPSSPPYI 158 Query: 26 YKPP--TPP 6 KPP TPP Sbjct: 159 PKPPVVTPP 167 Score = 55.8 bits (133), Expect = 1e-06 Identities = 37/75 (49%), Positives = 41/75 (54%), Gaps = 11/75 (14%) Frame = -3 Query: 194 MNHHSYVYKPPT--PPPYVYKSPPYVYKPPTPP--PYESPPYVYKPP--TPP-----PYV 48 +N +V KPP PPP+V K PP VY PP PP P SPPY+ KPP TPP P Sbjct: 118 VNPPPFVPKPPVVNPPPFVPK-PPIVY-PPNPPVTPPSSPPYIPKPPVVTPPIKPPTPPT 175 Query: 47 YESPPYVYKPPTPPP 3 P V PPT PP Sbjct: 176 LPPKPPVITPPTKPP 190 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 19/75 (25%) Frame = -3 Query: 170 KPPTPPPYV---YKSPPYVYKPP-------TPPPYESPPYVYKPP--TPPPY-----VYE 42 KPP PP+V + PP+V KPP PP PPY+ KPP PPP+ V Sbjct: 60 KPPKQPPHVKPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVN 119 Query: 41 SPPYVYKPP--TPPP 3 PP+V KPP PPP Sbjct: 120 PPPFVPKPPVVNPPP 134 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/68 (47%), Positives = 37/68 (54%), Gaps = 11/68 (16%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPP--TPPPY-------ESPPYVYKPP--TPPPYVYESPPY 30 + KPPT P PPY+ KPP PPP+ PP+V KPP PPP+V PP Sbjct: 83 IVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFV-PKPPI 141 Query: 29 VYKPPTPP 6 VY PP PP Sbjct: 142 VY-PPNPP 148 [153][TOP] >UniRef100_B9NAX9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NAX9_POPTR Length = 312 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/68 (50%), Positives = 35/68 (51%), Gaps = 7/68 (10%) Frame = -3 Query: 188 HHSYVYKPPTPP------PYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPY 30 + Y YK P PP PY Y SPP K P PP Y SPP K P PPPY Y SPP Sbjct: 29 YEPYYYKSPPPPSQSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSP-PPPYHYSSPPP 87 Query: 29 VYKPPTPP 6 K P PP Sbjct: 88 PKKSPPPP 95 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 5/65 (7%) Frame = -3 Query: 185 HSYVYKPPT----PPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYK 21 + Y PP PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 64 YHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKK 122 Query: 20 PPTPP 6 P PP Sbjct: 123 SPPPP 127 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 5/65 (7%) Frame = -3 Query: 185 HSYVYKPPT----PPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYK 21 + Y PP PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 224 YHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKK 282 Query: 20 PPTPP 6 P PP Sbjct: 283 SPPPP 287 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 89 KKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKKSPPPP 143 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 105 KKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKKSPPPP 159 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 121 KKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKKSPPPP 175 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 137 KKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKKSPPPP 191 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/65 (50%), Positives = 34/65 (52%), Gaps = 5/65 (7%) Frame = -3 Query: 185 HSYVYKPPT----PPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYK 21 + Y PP PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K Sbjct: 192 YHYTSPPPPKKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSP-PPPYHYSSPPPPKK 250 Query: 20 PPTPP 6 P PP Sbjct: 251 SPPPP 255 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 249 KKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKKSPPPP 303 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 57 KKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKKSPPPP 111 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 153 KKSPPPPYHYSSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYTSPPPPKKSPPPP 207 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 169 KKSPPPPYHYSSPPPPKKSPPPPYHYTSPPPPKKSP-PPPYHYSSPPPPKKSPPPP 223 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 217 KKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYSSPPPPKKSPPPP 271 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/56 (55%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 K PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 185 KKSPPPPYHYTSPPPPKKSPPPPYHYSSPPPPKKSP-PPPYHYTSPPPPKKSPPPP 239 [154][TOP] >UniRef100_A7QFS2 Chromosome undetermined scaffold_89, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QFS2_VITVI Length = 234 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/92 (41%), Positives = 41/92 (44%), Gaps = 21/92 (22%) Frame = -3 Query: 215 QHLPHMCMNHHSYVYKPPT-PPPYVYK----SPPYVYKPP------------TPPPYESP 87 +H PH+ H KPP PPYV PPYV KPP PP P Sbjct: 49 KHPPHVKPPHTPMPPKPPAVKPPYVPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPPVVKP 108 Query: 86 PYVYKPPT----PPPYVYESPPYVYKPPTPPP 3 PYV KPP PPP V+ PP PP PPP Sbjct: 109 PYVPKPPVVQPPPPPVVHPPPPPTPCPPPPPP 140 [155][TOP] >UniRef100_Q00451 36.4 kDa proline-rich protein n=1 Tax=Solanum lycopersicum RepID=PRF1_SOLLC Length = 346 Score = 59.7 bits (143), Expect = 1e-07 Identities = 35/73 (47%), Positives = 43/73 (58%), Gaps = 3/73 (4%) Frame = -3 Query: 212 HLPHMCMNHHSYVYKPP-TPPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTP-PPYVYE 42 H+P + H + PP TP P K+PP+ KPP+P PP SPP VY P TP PP V+ Sbjct: 109 HVPRPPIVHPPPIVSPPSTPKPP--KTPPFTPKPPSPIPPIVSPPIVYPPITPTPPIVH- 165 Query: 41 SPPYVYKPPTPPP 3 PP KPP+P P Sbjct: 166 -PPVTPKPPSPTP 177 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/58 (56%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = -3 Query: 170 KPPTP-PPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP+P PP V SPP VY P TP PP PP KPP+P P + SPP VY P TP P Sbjct: 139 KPPSPIPPIV--SPPIVYPPITPTPPIVHPPVTPKPPSPTPPIV-SPPIVYPPITPTP 193 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPP-TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTP-PPYVYESPPYVYKPPTPPP 3 + KPP P P + PP V P TP P ++PP+ KPP+P PP V SPP VY P TP P Sbjct: 104 IVKPPHVPRPPIVHPPPIVSPPSTPKPPKTPPFTPKPPSPIPPIV--SPPIVYPPITPTP 161 Score = 55.8 bits (133), Expect = 1e-06 Identities = 35/80 (43%), Positives = 39/80 (48%), Gaps = 18/80 (22%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTP------------PPYESPPYVYKPPT--PPPY 51 H KPP+P P + SPP VY P TP PP SPP+V PP PPPY Sbjct: 165 HPPVTPKPPSPTPPIV-SPPIVYPPITPTPPVVSPPIIPTPPIVSPPFVPNPPVVIPPPY 223 Query: 50 V----YESPPYVYKPPTPPP 3 V +PP V PPTP P Sbjct: 224 VPSPPVVTPPIVPTPPTPCP 243 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/72 (48%), Positives = 38/72 (52%), Gaps = 14/72 (19%) Frame = -3 Query: 176 VYKPPTP-PPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTPPPYVYE----------SPP 33 VY P TP PP V+ PP KPP+P PP SPP VY P TP P V SPP Sbjct: 153 VYPPITPTPPIVH--PPVTPKPPSPTPPIVSPPIVYPPITPTPPVVSPPIIPTPPIVSPP 210 Query: 32 YVYKPPT--PPP 3 +V PP PPP Sbjct: 211 FVPNPPVVIPPP 222 [156][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/54 (50%), Positives = 29/54 (53%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PP PPP V PP + PP PPP PP PP PPP PP V+ PP PP Sbjct: 121 PPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPP 174 Score = 53.1 bits (126), Expect(2) = 6e-06 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP V+ PP PPP PP PP PPP + PP PP PPP Sbjct: 153 PPPPPPPPPPPPPVVFCPP-PPPCPPPPAPCPPPPPPPPMCLPPP----PPPPPP 202 Score = 20.4 bits (41), Expect(2) = 6e-06 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -2 Query: 219 PPTPPPYVYESPLIC 175 PP PPP P +C Sbjct: 122 PPPPPPVCPPPPPMC 136 [157][TOP] >UniRef100_Q41289 Putative proline-rich protein n=1 Tax=Solanum palustre RepID=Q41289_SOLBR Length = 407 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/66 (50%), Positives = 36/66 (54%), Gaps = 10/66 (15%) Frame = -3 Query: 170 KPPTPPPYVYK---------SPPYVYKPPTP-PPYESPPYVYKPPTPPPYVYESPPYVYK 21 KPPT PP+ K SPP VY P TP PP PP KPP+P P + SPP VY Sbjct: 193 KPPTTPPFTPKPPSPTPPIVSPPIVYPPITPIPPIVHPPVTPKPPSPTPPIV-SPPIVYA 251 Query: 20 PPTPPP 3 P TP P Sbjct: 252 PITPTP 257 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 3/73 (4%) Frame = -3 Query: 212 HLPHMCMNHHSYVYKPP-TPPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTP-PPYVYE 42 H+P + H + PP TP P +PP+ KPP+P PP SPP VY P TP PP V+ Sbjct: 173 HVPRPPIVHPPPIVSPPSTPKPPT--TPPFTPKPPSPTPPIVSPPIVYPPITPIPPIVH- 229 Query: 41 SPPYVYKPPTPPP 3 PP KPP+P P Sbjct: 230 -PPVTPKPPSPTP 241 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/59 (47%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = -3 Query: 176 VYKPP-TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 + KPP P P + PP V P TP P +PP+ KPP+P P + SPP VY P TP P Sbjct: 168 ILKPPHVPRPPIVHPPPIVSPPSTPKPPTTPPFTPKPPSPTPPIV-SPPIVYPPITPIP 225 Score = 55.8 bits (133), Expect = 1e-06 Identities = 35/80 (43%), Positives = 39/80 (48%), Gaps = 18/80 (22%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTP------------PPYESPPYVYKPPT--PPPY 51 H KPP+P P + SPP VY P TP PP SPP+V PP PPPY Sbjct: 229 HPPVTPKPPSPTPPIV-SPPIVYAPITPTPPIVSPPITPTPPIVSPPFVPNPPVVIPPPY 287 Query: 50 V----YESPPYVYKPPTPPP 3 V +PP V PPTP P Sbjct: 288 VPSPPVVTPPIVPTPPTPCP 307 Score = 53.5 bits (127), Expect = 7e-06 Identities = 34/72 (47%), Positives = 38/72 (52%), Gaps = 14/72 (19%) Frame = -3 Query: 176 VYKPPTP-PPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTPPPYVYE----------SPP 33 VY P TP PP V+ PP KPP+P PP SPP VY P TP P + SPP Sbjct: 217 VYPPITPIPPIVH--PPVTPKPPSPTPPIVSPPIVYAPITPTPPIVSPPITPTPPIVSPP 274 Query: 32 YVYKPPT--PPP 3 +V PP PPP Sbjct: 275 FVPNPPVVIPPP 286 [158][TOP] >UniRef100_B9RIB5 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis RepID=B9RIB5_RICCO Length = 144 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/57 (50%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPP---YESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 P PPPY Y+SPP P+PPP Y+SPP P PPP PPY YK P PP Sbjct: 48 PSPPPPYYYQSPPP--PSPSPPPPYYYKSPPPPSPSPPPPPSPSPPPPYYYKSPPPP 102 Score = 54.3 bits (129), Expect(2) = 1e-07 Identities = 29/59 (49%), Positives = 31/59 (52%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP P P PPY YK P PPP SPP P PPPY Y+SPP PP+ P Sbjct: 55 YYQSPPPPSP--SPPPPYYYKSP-PPPSPSPPPPPSPSPPPPYYYKSPP----PPSLSP 106 Score = 24.6 bits (52), Expect(2) = 1e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y+SP Sbjct: 48 PSPPPPYYYQSP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/59 (45%), Positives = 29/59 (49%), Gaps = 9/59 (15%) Frame = -3 Query: 152 PYVYKSPPYVYK---PPTPPPYESPPYVYK------PPTPPPYVYESPPYVYKPPTPPP 3 PY PP YK PP P P PPY Y+ P PPPY Y+SPP P PPP Sbjct: 28 PYYSSPPPLPYKYMSPPPPSPSPPPPYYYQSPPPPSPSPPPPYYYKSPPPPSPSPPPPP 86 [159][TOP] >UniRef100_A9SB04 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SB04_PHYPA Length = 328 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 5/62 (8%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYK-PPTPPPYESPPYVYKPPTPPPYVYESPP---YVYK-PPTP 9 YK PPP SPPYV PP P Y+SPP Y +PPP VY+SPP Y K PPTP Sbjct: 221 YKSSPPPPLNKSSPPYVKSSPPLSPVYKSPPPPYVKSSPPPPVYKSPPPPSYEKKSPPTP 280 Query: 8 PP 3 P Sbjct: 281 VP 282 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/69 (47%), Positives = 37/69 (53%), Gaps = 9/69 (13%) Frame = -3 Query: 182 SYVYKPPTP-----PPYVYKSPPY--VYKPPTPPPYES--PPYVYKPPTPPPYVYESPPY 30 +Y PP P PPYV SPP VYK P PP +S PP VYK P PP Y +SPP Sbjct: 220 AYKSSPPPPLNKSSPPYVKSSPPLSPVYKSPPPPYVKSSPPPPVYKSPPPPSYEKKSPPT 279 Query: 29 VYKPPTPPP 3 +PPP Sbjct: 280 PVPKSSPPP 288 Score = 57.4 bits (137), Expect = 5e-07 Identities = 36/81 (44%), Positives = 39/81 (48%), Gaps = 19/81 (23%) Frame = -3 Query: 191 NHHSYVYKPP-------TPPPYVYKS--PPYVYKPPTPPPYESPPY-VYKPPTPPPYVYE 42 N H PP +PPP +YKS PP V K P PP Y+SPP YK PPP Sbjct: 173 NSHGVNKSPPPPPPSTSSPPPPLYKSSPPPPVLKSPLPPVYKSPPPPAYKSSPPPPLNKS 232 Query: 41 SPPY---------VYKPPTPP 6 SPPY VYK P PP Sbjct: 233 SPPYVKSSPPLSPVYKSPPPP 253 Score = 56.2 bits (134), Expect = 1e-06 Identities = 37/73 (50%), Positives = 39/73 (53%), Gaps = 21/73 (28%) Frame = -3 Query: 161 TPPPYVYKSP-PYVYKPPTPPPYE----------SPPY---------VYKPPTPPPYVYE 42 +PPP V KSP P VYK P PP Y+ SPPY VYK P PPPYV Sbjct: 199 SPPPPVLKSPLPPVYKSPPPPAYKSSPPPPLNKSSPPYVKSSPPLSPVYKSP-PPPYVKS 257 Query: 41 S-PPYVYKPPTPP 6 S PP VYK P PP Sbjct: 258 SPPPPVYKSPPPP 270 [160][TOP] >UniRef100_B9SSV0 Cleavage and polyadenylation specificity factor, putative n=1 Tax=Ricinus communis RepID=B9SSV0_RICCO Length = 210 Score = 55.5 bits (132), Expect(2) = 1e-07 Identities = 29/71 (40%), Positives = 34/71 (47%), Gaps = 5/71 (7%) Frame = -3 Query: 206 PHMCMNHHSYVYKPP---TPPPYVYKSPP--YVYKPPTPPPYESPPYVYKPPTPPPYVYE 42 P + +H + PP T P Y Y SPP Y Y P PP PP Y PPP Sbjct: 81 PSPLLPYHYHSPPPPKKSTHPTYYYNSPPPPYYYNSPPPPSSSPPPLYYYDSPPPPKKSL 140 Query: 41 SPPYVYKPPTP 9 SPPY Y+ P+P Sbjct: 141 SPPYHYQSPSP 151 Score = 23.5 bits (49), Expect(2) = 1e-07 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 P PPPY Y SP Sbjct: 61 PSPPPPYYYTSP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 38/96 (39%), Positives = 41/96 (42%), Gaps = 29/96 (30%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPP------PYVYKSPPYVYKPPTPPP-----YESPP-------- 84 PH + + Y YK P PP PY Y SPP K P+P P Y SPP Sbjct: 42 PHKKVYYPPYYYKSPPPPSPSPPPPYYYTSPPPRKKYPSPSPLLPYHYHSPPPPKKSTHP 101 Query: 83 -YVYKPPTPPPYVYESPP---------YVYKPPTPP 6 Y Y P PPPY Y SPP Y Y P PP Sbjct: 102 TYYYNSP-PPPYYYNSPPPPSSSPPPLYYYDSPPPP 136 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/86 (40%), Positives = 39/86 (45%), Gaps = 14/86 (16%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKSPP---------YVYKPPTPPPYE-SPPYVYKP 69 H P H +Y Y P PPPY Y SPP Y Y P PP SPPY Y+ Sbjct: 90 HSPPPPKKSTHPTYYYNSP-PPPYYYNSPPPPSSSPPPLYYYDSPPPPKKSLSPPYHYQS 148 Query: 68 PTP----PPYVYESPPYVYKPPTPPP 3 P+P PP PPY Y P+P P Sbjct: 149 PSPLSPSPP-----PPYYYASPSPTP 169 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/59 (47%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTP-PPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 Y Y P PPP SPPY Y+ P+P P PPY Y P+P P SP YK P PP Sbjct: 128 YYYDSP-PPPKKSLSPPYHYQSPSPLSPSPPPPYYYASPSPTPKKSPSPLSYYKSPPPP 185 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/67 (47%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = -3 Query: 194 MNHHSYVYKPPTPPPYVYKSPPYVYKPPTPP-PYESPPYVY-KPPTPPPYVYESP--PYV 27 + + SY YK P P VY PPY YK P PP P PPY Y PP Y SP PY Sbjct: 30 LKYPSYEYKLPPPHKKVYY-PPYYYKSPPPPSPSPPPPYYYTSPPPRKKYPSPSPLLPYH 88 Query: 26 YKPPTPP 6 Y P PP Sbjct: 89 YHSPPPP 95 [161][TOP] >UniRef100_UPI000186843E hypothetical protein BRAFLDRAFT_101271 n=1 Tax=Branchiostoma floridae RepID=UPI000186843E Length = 3068 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 6/62 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKPP 15 VY+ PTPPP VY++P P VY+ PTPPP VY+ TPPP VY+ P VY+ Sbjct: 356 VYRTPTPPPVVYRAPTPPPVVYRAPTPPPV-----VYRAQTPPPVVYQQAPPQQAVYQQS 410 Query: 14 TP 9 P Sbjct: 411 AP 412 [162][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 58.9 bits (141), Expect = 2e-07 Identities = 31/72 (43%), Positives = 36/72 (50%), Gaps = 11/72 (15%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPP------YVYESPPYVY 24 +SY PP PPP PP Y P+PPP S P Y P+PPP Y Y +P Y Y Sbjct: 520 YSYPSPPPPPPP---PPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYYY 576 Query: 23 -----KPPTPPP 3 +PP PPP Sbjct: 577 PSPSPRPPPPPP 588 [163][TOP] >UniRef100_Q40793 Tyrosine-rich hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Petroselinum crispum RepID=Q40793_PETCR Length = 259 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/52 (57%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -3 Query: 158 PPPYVYKSPPYVYKPPTPPPY-ESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PPPY Y SPP K P PP Y SPP K P PPPY Y SPP K P PP Sbjct: 12 PPPYYYSSPPPPVKSPPPPYYYTSPPPPVKSP-PPPYYYTSPPPPMKSPPPP 62 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/60 (46%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPY-ESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 + Y P TP YK P P TPP Y +SPP K P P PY Y+SPP K P P P Sbjct: 193 FAYAPKTPYKKCYKPVPTPAAPLTPPYYYQSPPPPSKSPAPTPYYYKSPPPPTKSPAPTP 252 Score = 52.4 bits (124), Expect(2) = 3e-06 Identities = 27/59 (45%), Positives = 30/59 (50%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y Y P PPP PPY Y P PPP +SPP Y +PPP + PP Y P P P Sbjct: 15 YYYSSP-PPPVKSPPPPYYYTSP-PPPVKSPPPPYYYTSPPPPMKSPPPPYYPHPHPHP 71 Score = 21.9 bits (45), Expect(2) = 3e-06 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 12 PPPYYYSSP 20 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 8/54 (14%) Frame = -3 Query: 173 YKP-PTP-----PPYVYKSPPYVYKPPTPPPY--ESPPYVYKPPTPPPYVYESP 36 YKP PTP PPY Y+SPP K P P PY +SPP K P P PY Y+SP Sbjct: 205 YKPVPTPAAPLTPPYYYQSPPPPSKSPAPTPYYYKSPPPPTKSPAPTPYYYKSP 258 [164][TOP] >UniRef100_B9NF54 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NF54_POPTR Length = 179 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKP----PTPPPYVYESPPYVYKPPTPP 6 KPP PP V PP + KPP PP PP V P P PPP V +PP V PPTPP Sbjct: 35 KPPVKPPKV--KPPPIVKPPKPPVTPKPPVVKPPKPEKPCPPPPVIPTPPIVKPPPTPP 91 [165][TOP] >UniRef100_A9PF92 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9PF92_POPTR Length = 179 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKP----PTPPPYVYESPPYVYKPPTPP 6 KPP PP V PP + KPP PP PP V P P PPP V +PP V PPTPP Sbjct: 35 KPPVKPPKV--KPPPIVKPPKPPVTPKPPVVKPPKPEKPCPPPPVIPTPPIVKPPPTPP 91 [166][TOP] >UniRef100_C3ZD83 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3ZD83_BRAFL Length = 1009 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 6/62 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPP---YVYKPP 15 VY+ PTPPP VY++P P VY+ PTPPP VY+ TPPP VY+ P VY+ Sbjct: 402 VYRTPTPPPVVYRAPTPPPVVYRAPTPPPV-----VYRAQTPPPVVYQQAPPQQAVYQQS 456 Query: 14 TP 9 P Sbjct: 457 AP 458 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/59 (47%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYES---PPYVYKPPTPPP 3 +PPTP VY+ PTPPP VY+ PTPPP VY + PP VY+ TPPP Sbjct: 397 RPPTP----------VYRTPTPPPV-----VYRAPTPPPVVYRAPTPPPVVYRAQTPPP 440 [167][TOP] >UniRef100_C5XFE4 Putative uncharacterized protein Sb03g042800 n=1 Tax=Sorghum bicolor RepID=C5XFE4_SORBI Length = 401 Score = 56.6 bits (135), Expect(2) = 2e-07 Identities = 31/67 (46%), Positives = 34/67 (50%), Gaps = 7/67 (10%) Frame = -3 Query: 185 HSYVYKPPT------PPPYVYKSPPYVYKPPTPPPYESPP-YVYKPPTPPPYVYESPPYV 27 H + Y PP PPPY+ KSP P TP Y SPP Y Y PP P Y+ PP Sbjct: 280 HQHNYVPPPLVYQYPPPPYINKSPLLPSSPVTPYHYNSPPTYQYSPP-PYNYLSSPPPAQ 338 Query: 26 YKPPTPP 6 Y PP PP Sbjct: 339 YSPPLPP 345 Score = 21.9 bits (45), Expect(2) = 2e-07 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 210 PPPYVYESP 184 PPPY Y SP Sbjct: 268 PPPYYYNSP 276 [168][TOP] >UniRef100_Q94ES5 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES5_PEA Length = 144 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/62 (43%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPP-YVYESPPYVYKPPTP 9 + Y Y P PP + Y P VY P PP PY Y P PPP + Y P VY P P Sbjct: 28 NQYSYSSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPP 87 Query: 8 PP 3 PP Sbjct: 88 PP 89 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/65 (43%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYV----YKPPTPPPYVYESPPYVYK 21 H VY P PPP +K P PP PP + PP+V Y P PP Y P Y YK Sbjct: 77 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAYSPPPPAYYYK 136 Query: 20 PPTPP 6 P PP Sbjct: 137 SPPPP 141 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/70 (40%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPP---YESPPYVYKPPTPPPYVYESPP 33 H + H + PP P P+ PY Y P PPP Y P VY P PPP ++ P Sbjct: 40 HTYPHPHPVYHSPPPPTPH---KKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKK-P 95 Query: 32 YVYKPPTPPP 3 Y Y P PPP Sbjct: 96 YKYPSPPPPP 105 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/74 (39%), Positives = 33/74 (44%), Gaps = 15/74 (20%) Frame = -3 Query: 185 HSYVYKPPTPPP---YVYKSPPYVYKPPTPPP--------YESPP----YVYKPPTPPPY 51 H YK P+PPP + Y P VY P PPP Y SPP + Y P P P Sbjct: 58 HKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPV 117 Query: 50 VYESPPYVYKPPTP 9 + PP Y PP P Sbjct: 118 YHSPPPPAYSPPPP 131 [169][TOP] >UniRef100_Q41986 Extensin (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q41986_ARATH Length = 97 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/67 (50%), Positives = 36/67 (53%), Gaps = 11/67 (16%) Frame = -3 Query: 179 YVYKPPTPPP---------YVYKSPPYVYKPPTPPPYESPPY--VYKPPTPPPYVYESPP 33 YV P PPP Y + PPYVY P PPPY SP VYK P PPPYVY SPP Sbjct: 33 YVXHSPPPPPXXSXSPKPAYNFXPPPYVYSSP-PPPYXSPAPKPVYKFP-PPPYVYNSPP 90 Query: 32 YVYKPPT 12 Y P+ Sbjct: 91 PXYXXPS 97 Score = 56.2 bits (134), Expect = 1e-06 Identities = 36/85 (42%), Positives = 39/85 (45%), Gaps = 18/85 (21%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTP-----PPYVYKSPP--YVYKPPTPPPYES-----------PPY 81 PH+C + PP P P YKSPP YV P PPP S PPY Sbjct: 6 PHVCX------FXPPPPCYSNSPKXEYKSPPTPYVXHSPPPPPXXSXSPKPAYNFXPPPY 59 Query: 80 VYKPPTPPPYVYESPPYVYKPPTPP 6 VY P PPPY +P VYK P PP Sbjct: 60 VYSSP-PPPYXSPAPKPVYKFPPPP 83 [170][TOP] >UniRef100_Q2PET4 Putative uncharacterized protein n=1 Tax=Trifolium pratense RepID=Q2PET4_TRIPR Length = 478 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/70 (48%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPTP------PPYESPPYVYKPPTPPPYVYESP---P 33 VYKPP P VYK P P +YKPP PP+E PP +YKPP P VY+ P P Sbjct: 365 VYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPP-IYKPPFEKPPVYKPPIEEP 423 Query: 32 YVYKPPTPPP 3 YKPP P Sbjct: 424 PFYKPPFENP 433 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/70 (47%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPP------TPPPYESPPYVYKPPTPPPYVYESP---P 33 VYKPP P +YK P P +YKPP PP+E PP VYKPP P Y+ P P Sbjct: 375 VYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPP-VYKPPIEEPPFYKPPFENP 433 Query: 32 YVYKPPTPPP 3 +YKPP P Sbjct: 434 PIYKPPYEKP 443 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/70 (45%), Positives = 40/70 (57%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPPT------PPPYESPPYVYKPPTPPPYVYESP---P 33 +YKPP P +YK P P VYKPP PP+E+PP +YKPP P +Y+ P P Sbjct: 395 IYKPPFEKPPIYKPPFEKPPVYKPPIEEPPFYKPPFENPP-IYKPPYEKPPLYKPPFEKP 453 Query: 32 YVYKPPTPPP 3 +YKPP P Sbjct: 454 PLYKPPFEEP 463 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP---PYVYKPP------TPPPYESPPYVYKPPTPPPYVYESP---P 33 +YKPP P +YK P P +YKPP PP E PP+ YKPP P +Y+ P P Sbjct: 385 MYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKPPIEEPPF-YKPPFENPPIYKPPYEKP 443 Query: 32 YVYKPPTPPP 3 +YKPP P Sbjct: 444 PLYKPPFEKP 453 [171][TOP] >UniRef100_C5YXL4 Putative uncharacterized protein Sb09g019560 n=1 Tax=Sorghum bicolor RepID=C5YXL4_SORBI Length = 340 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/71 (42%), Positives = 33/71 (46%), Gaps = 9/71 (12%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPP-------YVYKPPTPPPYVYESP-- 36 HH Y PP PPP + PP PP PPP+ PP Y Y P PPP+ Y P Sbjct: 18 HHYSSYPPPPPPPPHHHHPP----PPPPPPHHRPPPPPPPSSYYYHPHPPPPHAYHGPWH 73 Query: 35 PYVYKPPTPPP 3 P PP P P Sbjct: 74 PAPAPPPQPQP 84 [172][TOP] >UniRef100_C5WTU8 Putative uncharacterized protein Sb01g043846 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5WTU8_SORBI Length = 132 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/73 (39%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = -3 Query: 215 QHLPHMCMNHHSYVYKPPTP--PPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYE 42 +H H C H Y PP P PP + PP +Y+ P PY P Y PPP Sbjct: 43 EHYQHQC--HQQYAPPPPQPMYPPPYGQPPPPMYQQPYGQPYGQPVYASPYGQPPPPAMY 100 Query: 41 SPPYVYKPPTPPP 3 PPY PP PPP Sbjct: 101 PPPYAQPPPPPPP 113 [173][TOP] >UniRef100_B9TC21 Putative uncharacterized protein (Fragment) n=1 Tax=Ricinus communis RepID=B9TC21_RICCO Length = 79 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/50 (56%), Positives = 30/50 (60%) Frame = -3 Query: 152 PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PY+Y SPP P P Y SPPY YK +PPP E PPY YK P PPP Sbjct: 33 PYIYASPP---PPHHPKDYASPPYYYK--SPPPKHAEHPPYYYKSPPPPP 77 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -3 Query: 179 YVYKPPTPP--PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPP 54 Y+Y P PP P Y SPPY YK P P E PPY YK P PPP Sbjct: 34 YIYASPPPPHHPKDYASPPYYYKSPPPKHAEHPPYYYKSPPPPP 77 [174][TOP] >UniRef100_B9ILJ5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9ILJ5_POPTR Length = 509 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/66 (46%), Positives = 33/66 (50%), Gaps = 9/66 (13%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVY------KPPTPPPYVYESPP---YVY 24 VY PP PPP PP YKPP P PP VY P PPP +Y SPP VY Sbjct: 429 VYSPPPPPPSSSPPPPIHYKPPPSPSPPPPPAVYYHSPPPLSPPPPPVIYGSPPPPTPVY 488 Query: 23 KPPTPP 6 + P PP Sbjct: 489 EGPLPP 494 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/60 (50%), Positives = 31/60 (51%), Gaps = 7/60 (11%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYES--PPYVYKP-----PTPPPYVYESPPYVYKPPTPP 6 P+PPP PP VY PP PPP S PP YKP P PPP VY P PP PP Sbjct: 421 PSPPP-----PPPVYSPPPPPPSSSPPPPIHYKPPPSPSPPPPPAVYYHSPPPLSPPPPP 475 [175][TOP] >UniRef100_A7Y7G6 Putative extensin (Fragment) n=1 Tax=Prunus dulcis RepID=A7Y7G6_PRUDU Length = 97 Score = 58.5 bits (140), Expect = 2e-07 Identities = 33/59 (55%), Positives = 34/59 (57%), Gaps = 5/59 (8%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPP---YVYKPPTPPPYVYESP--PYVYKPPTPP 6 PP PPY YKSPP PTPP + SPP Y YK P PPP Y P PY YK P PP Sbjct: 41 PPVSPPYHYKSPPP--PSPTPPVHYSPPKHPYHYKSP-PPPVHYSPPKHPYHYKSPPPP 96 [176][TOP] >UniRef100_Q9FUR7 ENOD2 (Fragment) n=1 Tax=Styphnolobium japonicum RepID=Q9FUR7_SOPJA Length = 269 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 9/66 (13%) Frame = -3 Query: 173 YKPP--TPPPYVYKSPPYVYKPPT---PPPYESPPYVYKPP--TPPPYVYESPPYVYKPP 15 Y+PP PP VY PP+ KPP PPP+E PP Y+PP PP VY+ PP+V PP Sbjct: 105 YQPPHHVKPPPVYP-PPHHEKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPP 163 Query: 14 T--PPP 3 PPP Sbjct: 164 VYQPPP 169 Score = 57.0 bits (136), Expect = 6e-07 Identities = 33/72 (45%), Positives = 41/72 (56%), Gaps = 15/72 (20%) Frame = -3 Query: 173 YKPP--TPPPYVYKSPPYVYKPPT---PPPYESPPYVYKPP--TPPPYVYESPPY----- 30 Y+PP PP VY+ PP+V PP PP +E PP Y+PP PP VY+ PP+ Sbjct: 141 YQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPP 200 Query: 29 VYKPP---TPPP 3 VY+PP PPP Sbjct: 201 VYQPPHHEIPPP 212 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/65 (47%), Positives = 37/65 (56%), Gaps = 8/65 (12%) Frame = -3 Query: 173 YKPP--TPPPYVYKSPPYVYKPPT--PPPYESPPYVYKPP--TPPPYVYESPPYVYKPPT 12 Y+PP PP VY+ PP+ PP PP +E PP VY PP PP Y+ PP+V PP Sbjct: 178 YQPPHHVKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPA 237 Query: 11 --PPP 3 PPP Sbjct: 238 YQPPP 242 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/72 (45%), Positives = 38/72 (52%), Gaps = 14/72 (19%) Frame = -3 Query: 176 VYKPPT--PPPYVYKSP-----PYVYKPPT----PPPYESPPYVYKPPTPPPYVYESPPY 30 VY+PP PP VY+ P P VY PP PP Y+ PP+V PP P +E PP Sbjct: 189 VYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKPPP 248 Query: 29 VYKPP---TPPP 3 VY PP PPP Sbjct: 249 VYPPPHHEKPPP 260 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/69 (46%), Positives = 37/69 (53%), Gaps = 7/69 (10%) Frame = -3 Query: 188 HHSY---VYKPP--TPPPYVYKSPPYVYKPPT--PPPYESPPYVYKPPTPPPYVYESPPY 30 HH VY PP PP Y+ PP+V PP PPP+E PP VY PPP+ +E PP Sbjct: 206 HHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKPPPVY----PPPH-HEKPPP 260 Query: 29 VYKPPTPPP 3 Y PP P Sbjct: 261 AYPPPHEKP 269 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 15/73 (20%) Frame = -3 Query: 176 VYKPP--TPPPYVYKSPPYVYKPPT--PPPYESPPYVYKPP--TPPPYVYESPPY----- 30 VY PP PP V++ PP+ PP PPP+ PP VY+PP PP VY+ PP+ Sbjct: 116 VYPPPHHEKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPP 175 Query: 29 -VYKPP---TPPP 3 Y+PP PPP Sbjct: 176 PEYQPPHHVKPPP 188 Score = 53.9 bits (128), Expect = 5e-06 Identities = 34/79 (43%), Positives = 42/79 (53%), Gaps = 23/79 (29%) Frame = -3 Query: 170 KPPT---PPPYVYKSPPYVYKPP---------TPPPYESPPYVYKPPT--------PPPY 51 KPP PPP+V PP VY+PP PPP+E PP Y+PP PPP+ Sbjct: 64 KPPPAYQPPPHV--KPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPH 121 Query: 50 VYESPPYVYKPP---TPPP 3 +E PP V++PP PPP Sbjct: 122 -HEKPPPVHQPPPHEKPPP 139 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/66 (46%), Positives = 37/66 (56%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTP---PPYVYKSPPYVYKPPT--PPPYESPPYVYKPPTPPPYVYESPPYVYKPP- 15 VY+PP PP Y+ P +V PP PPP+E PP VY+PP +E PP VY PP Sbjct: 164 VYQPPPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPPVYQPPH-----HEIPPPVYPPPR 218 Query: 14 --TPPP 3 PPP Sbjct: 219 ENKPPP 224 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/71 (43%), Positives = 38/71 (53%), Gaps = 9/71 (12%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPT----PPPYESPPYVYKPPT--PPPYVYESPPYV 27 HH PP P ++ PP Y+PP PP Y+ PP+V PP PPP+V PP V Sbjct: 26 HHEI---PPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHVKPPPAYQPPPHV--KPPPV 80 Query: 26 YKPP---TPPP 3 Y+PP PPP Sbjct: 81 YQPPHHEKPPP 91 [177][TOP] >UniRef100_Q9FUR5 ENOD2f (Fragment) n=1 Tax=Maackia amurensis RepID=Q9FUR5_9FABA Length = 308 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/64 (48%), Positives = 36/64 (56%), Gaps = 8/64 (12%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT-------PPPYESPPYVYKPP-TPPPYVYESPPYVYKPP 15 KPP P ++ PP VY+PP PPP+E PP Y PP PP VY+ PPY PP Sbjct: 158 KPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQ-PPYEKPPP 216 Query: 14 TPPP 3 T PP Sbjct: 217 TYPP 220 Score = 58.2 bits (139), Expect = 3e-07 Identities = 33/61 (54%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = -3 Query: 173 YKPP-TPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPP--TPP 6 Y PP PP VY+ PPY PPT PPP+E PP Y PP P YE PP +Y PP PP Sbjct: 196 YPPPHEKPPPVYQ-PPYEKPPPTYPPPHEKPPIEYPPPHEKP-PYEKPPPLYPPPYEKPP 253 Query: 5 P 3 P Sbjct: 254 P 254 Score = 57.8 bits (138), Expect = 4e-07 Identities = 32/70 (45%), Positives = 38/70 (54%), Gaps = 14/70 (20%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT-------PPPYESPPYVYKPP--TPPPYV---YESPPYV 27 KPP P ++ PP VY+PP PPP+E PP VY+PP PPP +E PP Sbjct: 136 KPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIE 195 Query: 26 YKPP--TPPP 3 Y PP PPP Sbjct: 196 YPPPHEKPPP 205 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/66 (48%), Positives = 37/66 (56%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPP---PYVYESPPYVYKPP 15 VY+PP P + PP+ PP PPYE PP VY PP PP P +E PP VY+PP Sbjct: 151 VYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPP 210 Query: 14 --TPPP 3 PPP Sbjct: 211 YEKPPP 216 Score = 56.6 bits (135), Expect = 8e-07 Identities = 36/81 (44%), Positives = 42/81 (51%), Gaps = 25/81 (30%) Frame = -3 Query: 170 KPPT--PPPYV---------YKSPPYVYKPPT-------PPPYESPPYVYKPP--TPP-- 57 KPP PPPY Y+ PP +Y PP PPP+E PP VY+PP PP Sbjct: 103 KPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIE 162 Query: 56 -PYVYESPPYVYKPP--TPPP 3 P +E PP VY+PP PPP Sbjct: 163 YPPPHEKPPPVYQPPYEKPPP 183 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 5/61 (8%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPP---TPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT--PP 6 KPP P Y+ PP +Y PP PP +E PP+ YKPP P E PP V KPP+ PP Sbjct: 240 KPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPF-YKPPVYEPPPLEKPPPVEKPPSYKPP 298 Query: 5 P 3 P Sbjct: 299 P 299 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 11/67 (16%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT---PPPYESPPYVYKPPT----PPPYV--YESPPYVYKP 18 KPPT P + PP VY+PP PPP+ PP Y+PP PP Y +E PP Y+P Sbjct: 18 KPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQPPHEKPPPEYQP 77 Query: 17 P--TPPP 3 P PPP Sbjct: 78 PHEKPPP 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/64 (46%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYV---YESPPYVYKPP 15 +Y PP P V PP+ PP PPYE PP Y PP PPP YE PP VY PP Sbjct: 129 LYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPP 188 Query: 14 TPPP 3 P Sbjct: 189 HEKP 192 Score = 54.7 bits (130), Expect = 3e-06 Identities = 33/74 (44%), Positives = 37/74 (50%), Gaps = 17/74 (22%) Frame = -3 Query: 173 YKPP--TPPPYV---YKSPPYVYKPPT-------PPPYESPPYVYKPP---TPPPYV--Y 45 Y PP PPP Y+ PP VY PP PPP+E PP VY+PP PP Y + Sbjct: 163 YPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPH 222 Query: 44 ESPPYVYKPPTPPP 3 E PP Y PP P Sbjct: 223 EKPPIEYPPPHEKP 236 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYV---YESPPYVYKPP- 15 Y+PP P PP+ PP PPPYE PP Y+PP PPP +E PP Y PP Sbjct: 86 YQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPH 145 Query: 14 -TPPP 3 PPP Sbjct: 146 EKPPP 150 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/73 (43%), Positives = 38/73 (52%), Gaps = 14/73 (19%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPP-TPPPYESPPYVYKPP-------TPPPYVYESP---- 36 Y PPT PP ++ PP Y PP PPYE PP +Y PP PPP+ ++ P Sbjct: 211 YEKPPPTYPP-PHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEK 269 Query: 35 PYVYKPPT--PPP 3 P YKPP PPP Sbjct: 270 PPFYKPPVYEPPP 282 [178][TOP] >UniRef100_Q94ES4 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum RepID=Q94ES4_PEA Length = 120 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP--TPPPYVYESPP--YVYK 21 H VY P PPP +K P PP PP + PP+V P +PPP VY PP Y YK Sbjct: 53 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPPPPAYYYK 112 Query: 20 PPTPP 6 P PP Sbjct: 113 SPPPP 117 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/60 (45%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 179 YVYKPPTPPP-YVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y Y P PPP + Y P VY P PPP++ P PP PP + Y P VY P PPP Sbjct: 7 YKYPSPPPPPVHTYPHPHPVYHSP-PPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPP 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/74 (40%), Positives = 33/74 (44%), Gaps = 15/74 (20%) Frame = -3 Query: 185 HSYVYK---PPTPPPYVYKSPPYVYKPPTPPP--------YESPP----YVYKPPTPPPY 51 H YK PP PP + Y P VY P PPP Y SPP + Y P P P Sbjct: 34 HKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPV 93 Query: 50 VYESPPYVYKPPTP 9 + PP VY PP P Sbjct: 94 YHSPPPPVYSPPPP 107 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 11/71 (15%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPP-----PYVYKSPP----YVYKP--PTPPPYESPPYVYKPPTPP 57 H + H + PP PP PY Y SPP + Y P PTP + PP VY PP PP Sbjct: 49 HTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPP-PP 107 Query: 56 PYVYESPPYVY 24 Y Y+SPP Y Sbjct: 108 AYYYKSPPPPY 118 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/80 (41%), Positives = 36/80 (45%), Gaps = 19/80 (23%) Frame = -3 Query: 185 HSYVYKPPTPPPY----------VYKSPP------YVYKPPTPPP---YESPPYVYKPPT 63 H YK P+PPP VY SPP Y Y P PPP Y P VY P Sbjct: 3 HKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPP 62 Query: 62 PPPYVYESPPYVYKPPTPPP 3 PPP ++ P Y Y P PPP Sbjct: 63 PPPTPHKKP-YKYPSPPPPP 81 [179][TOP] >UniRef100_Q94ES3 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum RepID=Q94ES3_PEA Length = 137 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP--TPPPYVYESPP--YVYK 21 H VY P PPP +K P PP PP + PP+V P +PPP VY PP Y YK Sbjct: 70 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPPPPAYYYK 129 Query: 20 PPTPP 6 P PP Sbjct: 130 SPPPP 134 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/80 (41%), Positives = 35/80 (43%), Gaps = 19/80 (23%) Frame = -3 Query: 185 HSYVYKPPTPPP----------YVYKSP------PYVYKPPTPPP---YESPPYVYKPPT 63 H YK P+PPP VY SP PY Y P PPP Y P VY P Sbjct: 3 HKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPP 62 Query: 62 PPPYVYESPPYVYKPPTPPP 3 PP + Y P VY P PPP Sbjct: 63 PPVHTYPHPHPVYHSPPPPP 82 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/72 (40%), Positives = 32/72 (44%), Gaps = 12/72 (16%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPP--------YESPP----YVYKPPTPPPYVY 45 H VY P PP + Y P VY P PPP Y SPP + Y P P P + Sbjct: 53 HPHPVYHSPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYH 112 Query: 44 ESPPYVYKPPTP 9 PP VY PP P Sbjct: 113 SPPPPVYSPPPP 124 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 11/71 (15%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPP-----PYVYKSPP----YVYKP--PTPPPYESPPYVYKPPTPP 57 H + H + PP PP PY Y SPP + Y P PTP + PP VY PP PP Sbjct: 66 HTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPVYSPP-PP 124 Query: 56 PYVYESPPYVY 24 Y Y+SPP Y Sbjct: 125 AYYYKSPPPPY 135 [180][TOP] >UniRef100_Q5W1I2 Putative extensin (Fragment) n=1 Tax=Nicotiana glauca RepID=Q5W1I2_NICGL Length = 85 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/59 (52%), Positives = 34/59 (57%) Frame = -3 Query: 185 HSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 H+ VYK P PP VYKSPP PP P Y VYK P PP VY+SPP PP+P Sbjct: 35 HTPVYKSPPPPTPVYKSPP----PPKKPYYPPHTPVYKSPPPPTPVYKSPP----PPSP 85 Score = 55.1 bits (131), Expect = 2e-06 Identities = 35/69 (50%), Positives = 39/69 (56%), Gaps = 8/69 (11%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPY--VYKPPTPPP--YESPPYVYKPPTPP-PYVYESPP--- 33 H + VYK P PPP PP+ VYK P PP Y+SPP KP PP VY+SPP Sbjct: 15 HPAPVYKSPPPPPKKPYYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTPVYKSPPPPT 74 Query: 32 YVYKPPTPP 6 VYK P PP Sbjct: 75 PVYKSPPPP 83 [181][TOP] >UniRef100_Q41400 Root nodule extensin (Fragment) n=1 Tax=Sesbania rostrata RepID=Q41400_SESRO Length = 91 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/83 (40%), Positives = 43/83 (51%), Gaps = 11/83 (13%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPP----TPPPYVYKSPPYV-----YKPPTPPPYESPPYVYKPP 66 H H PH + YK P +PPP V+ PP++ + PP P PY+ P YK Sbjct: 10 HPH-PHPVYHSPPPPYKKPYKYHSPPPPVHTYPPHIPHPVYHSPPPPTPYKKP---YKYH 65 Query: 65 TPPPYVYESPP--YVYKPPTPPP 3 +PPP V+ PP Y YK P PPP Sbjct: 66 SPPPPVHSPPPPHYYYKSPPPPP 88 [182][TOP] >UniRef100_Q3E939 Uncharacterized protein At5g26080.1 n=1 Tax=Arabidopsis thaliana RepID=Q3E939_ARATH Length = 141 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/70 (44%), Positives = 37/70 (52%), Gaps = 8/70 (11%) Frame = -3 Query: 188 HHSYVYKPPTPP----PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYK 21 + S V PP PP P + PP +Y PP PP Y PP +Y PP PP Y PP +Y Sbjct: 47 YRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIY--PPPIYSPPPPPIY----PPPIYS 100 Query: 20 PP----TPPP 3 PP +PPP Sbjct: 101 PPPTPISPPP 110 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/63 (44%), Positives = 33/63 (52%), Gaps = 6/63 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESP------PYVYKPPTPPPYVYESPPYVYKPP 15 +Y PP PP Y+SP + PP PP Y P P +Y PP PP Y PP +Y PP Sbjct: 39 IYSPPPPP---YRSPVTI--PPPPPVYSRPVAFPPPPPIYSPPPPPIY----PPPIYSPP 89 Query: 14 TPP 6 PP Sbjct: 90 PPP 92 [183][TOP] >UniRef100_Q1PE26 Leucine-rich repeat family protein/extensin family protein n=1 Tax=Arabidopsis thaliana RepID=Q1PE26_ARATH Length = 218 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/59 (49%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 V+ PP P P V+ PP V+ PP PPP Y PP V+ PP +SPP VY PP PP Sbjct: 112 VHSPPPPAP-VHSPPPPVHSPPPPPPVYSPPPPVFSPPPS-----QSPPVVYSPPPRPP 164 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/63 (49%), Positives = 37/63 (58%), Gaps = 6/63 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYV----YESPPY--VYKPP 15 V+ PP PPP VY PP V+ +PPP +SPP VY PP PP + +SPP V K Sbjct: 128 VHSPPPPPP-VYSPPPPVF---SPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKE 183 Query: 14 TPP 6 TPP Sbjct: 184 TPP 186 [184][TOP] >UniRef100_B9H154 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9H154_POPTR Length = 266 Score = 58.2 bits (139), Expect = 3e-07 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 9/77 (11%) Frame = -3 Query: 209 LPHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPY--VYKPPTPPPYVYES- 39 LP + HH Y++ P PP +YK P V+KPP P Y+ P +YKP PP +Y+ Sbjct: 165 LPPLKDFHHPYLFPPKPPPVPIYKPKPPVFKPPPVPVYKPKPKPPIYKPLPPPVPIYKPL 224 Query: 38 ------PPYVYKPPTPP 6 PP+ YK P PP Sbjct: 225 PPIPKIPPF-YKKPCPP 240 [185][TOP] >UniRef100_A7RNZ0 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RNZ0_NEMVE Length = 370 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/88 (38%), Positives = 37/88 (42%), Gaps = 20/88 (22%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKS------------------PPYVYKPPTPPPYESPPY 81 PH C H S +P P PY +S PPY Y P PY+ PY Sbjct: 184 PHNCEVHKSIKKEPKGPYPYPTESLYPYQYWQLYPAPGPAPYPPYPYPTAAPYPYQYSPY 243 Query: 80 VYKPPTPPPY--VYESPPYVYKPPTPPP 3 Y P PPPY Y PPY PP PPP Sbjct: 244 PYTPYPPPPYPNPYPQPPY---PPPPPP 268 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/60 (50%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESP-PYVYKPPTPPPY--VYESPPYVYKPPTPPP 3 Y PT PY Y+ PY Y P PPPY +P P PP PPPY Y PPY PP P P Sbjct: 228 YPYPTAAPYPYQYSPYPYTPYPPPPYPNPYPQPPYPPPPPPYPNPYPQPPY---PPPPAP 284 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/71 (45%), Positives = 34/71 (47%), Gaps = 16/71 (22%) Frame = -3 Query: 167 PPTPPPYV--YKSPPYV-------------YKPPTPPPYESP-PYVYKPPTPPPYVYESP 36 PP PPPY Y PPY Y P PPPY +P PY PP PPPY + P Sbjct: 263 PPPPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPY---PPPPPPYPEQVP 319 Query: 35 PYVYKPPTPPP 3 P PP PPP Sbjct: 320 PPPPPPPPPPP 330 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/62 (48%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = -3 Query: 179 YVYKPPTPPPY--VYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESP-PYVYKPPTP 9 Y Y P PPPY Y PPY PP PPPY + PY P PPP P P Y P P Sbjct: 243 YPYTPYPPPPYPNPYPQPPY---PPPPPPYPN-PYPQPPYPPPPAPCSGPGPCPYPGPPP 298 Query: 8 PP 3 PP Sbjct: 299 PP 300 [186][TOP] >UniRef100_P08297 Early nodulin-75 n=1 Tax=Glycine max RepID=NO75_SOYBN Length = 309 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/71 (45%), Positives = 37/71 (52%), Gaps = 14/71 (19%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYVYESP---PYVYKPP- 15 Y+PP P PP+ PP PPPYE PP VY+PP PPP VY P P +Y+PP Sbjct: 229 YQPPHEKPPPEHQPPHEKPPPVYPPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPIYEPPP 288 Query: 14 -------TPPP 3 PPP Sbjct: 289 LEKPPVYNPPP 299 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/61 (44%), Positives = 31/61 (50%), Gaps = 8/61 (13%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT--------PPPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 KPP P Y+ PP VY+PP PPP+E PP PP P VY PPY PP Sbjct: 246 KPPPVYPPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPIYEPPPLEKPPVYNPPPYGRYPP 305 Query: 14 T 12 + Sbjct: 306 S 306 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/64 (48%), Positives = 36/64 (56%), Gaps = 9/64 (14%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP---TPPPYV---YESPPYVYKPP-- 15 PP P Y+ PP+ YKPP PPP PP Y+PP TPP Y+ +E PP Y PP Sbjct: 36 PPIEKPPTYEPPPF-YKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPHE 94 Query: 14 TPPP 3 PPP Sbjct: 95 KPPP 98 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/61 (47%), Positives = 35/61 (57%), Gaps = 4/61 (6%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPP--TPPPYESPPYVYKPPTPPPYVYESPPYVYKPP--TPP 6 Y+PP P ++ PP Y+PP PPP PP+ PP PP YE PP VY+PP PP Sbjct: 213 YQPPQEKP-PHEKPPPEYQPPHEKPPPEHQPPHEKPPPVYPP-PYEKPPPVYEPPYEKPP 270 Query: 5 P 3 P Sbjct: 271 P 271 [187][TOP] >UniRef100_P04929 Histidine-rich glycoprotein n=1 Tax=Plasmodium lophurae RepID=HRPX_PLALO Length = 351 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/60 (38%), Positives = 30/60 (50%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H + +H H H +HHH +H H P +HHH H H PH + +HHH H H H Sbjct: 136 HHHAAHHH--HHEEHHHHHHAAHHH-PWFHHHHLGYHHHHAPHHHHHHHHAPHHHHHHHH 192 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNH-----HHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSH 17 H + H H H + +H HH+ H H PH +HHH H H H + HHH H Sbjct: 143 HHHEEHHHHHHAAHHHPWFHHHHLGYHHHHAPHHHHHHHHAPHHHHHHHHAPHHH--HHH 200 Query: 16 QHLPH 2 H PH Sbjct: 201 HHAPH 205 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/60 (38%), Positives = 27/60 (45%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H+ H H H +HHH H H H HHH H H PH + +HHH H H H Sbjct: 165 HLGYHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHH--HHHAPHHHHHHHHAPHHHHHHHH 222 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/60 (38%), Positives = 27/60 (45%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H + H H H +HHH H H H HHH H H PH + +HHH H H H Sbjct: 175 HHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHH--HHHHHAPHHHHHHHHGHHHHHHHHH 232 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/60 (38%), Positives = 28/60 (46%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H H H H + +HHH H H PH +HHH H H H + +HHH H H H Sbjct: 181 HHAPHHHHHHHHAPHHHH---HHHHAPHHHHHHHHAPHHHHHHHHGHHHHHHHHHGHHHH 237 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/63 (39%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = -1 Query: 181 HMYTSHQHL---LHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQH 11 H + H HL H + +HHH H H PH +HHH H H H + HHH H H Sbjct: 158 HPWFHHHHLGYHHHHAPHHHH---HHHHAPHHHHHHHHAPHHHHHHHHAPHHH--HHHHH 212 Query: 10 LPH 2 PH Sbjct: 213 APH 215 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/60 (38%), Positives = 28/60 (46%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H H H H + +HHH H H PH +HHH H H H + +HHH H H H Sbjct: 191 HHAPHHHHHHHHAPHHHH---HHHHAPHHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHH 247 [188][TOP] >UniRef100_Q9S9A7 ENOD2 protein (Fragment) n=1 Tax=Vicia faba RepID=Q9S9A7_VICFA Length = 127 Score = 57.8 bits (138), Expect = 4e-07 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 16/88 (18%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKP--PTPPPYVYKSPPY-----VYKPP-TPPPYESPPYVYKPP- 66 H+H P N+H KP PPP PP+ Y+PP PP+ESPP VYKPP Sbjct: 18 HEHTPP---NYHKPHEKPLHENPPPQY--QPPHEHPSPEYQPPHVEPPHESPPPVYKPPY 72 Query: 65 --TPPPYVY-----ESPPYVYKPPTPPP 3 +PPP VY SPP+V P PPP Sbjct: 73 ETSPPPPVYHHPIFHSPPHVKPPVYPPP 100 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 13/76 (17%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP-------TPPPYV---YE 42 N SY P PP+ + +PP +KP P +E+PP Y+PP PP+V +E Sbjct: 4 NSSSYYPPPHEKPPHEH-TPPNYHKPHEKPLHENPPPQYQPPHEHPSPEYQPPHVEPPHE 62 Query: 41 SPPYVYKPP---TPPP 3 SPP VYKPP +PPP Sbjct: 63 SPPPVYKPPYETSPPP 78 [189][TOP] >UniRef100_Q9S9A4 Extensin (Fragment) n=1 Tax=Vicia faba RepID=Q9S9A4_VICFA Length = 116 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP--TPPPYVYESPP--YVYK 21 H VY P PPP +K P PP PP + PP+V P +PPP VY PP Y YK Sbjct: 49 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPVHTYPPHVPHPVYHSPPPPVYSPPPPHYYYK 108 Query: 20 PPTPP 6 P PP Sbjct: 109 SPPPP 113 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/70 (42%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPP---YESPPYVYKPPTPPPYVYESPP 33 H + H + + PP PPP +K P Y Y P PPP Y P VY P PPP ++ P Sbjct: 11 HTYPHPHPFYHSPP-PPPTPHKKP-YKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKP- 67 Query: 32 YVYKPPTPPP 3 Y Y P PPP Sbjct: 68 YKYPSPPPPP 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/83 (37%), Positives = 35/83 (42%), Gaps = 13/83 (15%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPP-YVYKSPPYVYKPPTPPP--------YESPP----YV 78 H P + Y Y P PPP + Y P VY P PPP Y SPP + Sbjct: 21 HSPPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPVHT 80 Query: 77 YKPPTPPPYVYESPPYVYKPPTP 9 Y P P P + PP VY PP P Sbjct: 81 YPPHVPHPVYHSPPPPVYSPPPP 103 [190][TOP] >UniRef100_Q40692 Hydroxyproline-rich glycoprotein n=1 Tax=Oryza sativa RepID=Q40692_ORYSA Length = 369 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/71 (49%), Positives = 36/71 (50%), Gaps = 14/71 (19%) Frame = -3 Query: 173 YKP---PTPPPYVYKSPPYVYKP---PTPPPYESPPY--VYKP---PTPPPYVYESPPYV 27 YKP PTP PY P +YKP PTP PY P YKP PTPPPY P Sbjct: 126 YKPQPKPTPAPYTPTPTPPMYKPQPKPTPAPYTPTPTPPTYKPQPKPTPPPYTPTPAPPT 185 Query: 26 YKP---PTPPP 3 YKP P PPP Sbjct: 186 YKPQPKPNPPP 196 Score = 55.1 bits (131), Expect = 2e-06 Identities = 39/86 (45%), Positives = 43/86 (50%), Gaps = 29/86 (33%) Frame = -3 Query: 173 YKP---PTPPPYV-------YK-----SPPYVYKP---PTPPPYESPPYVYKP---PTPP 57 YKP PTPPPY YK +PP YKP PTP PY+ P YKP P PP Sbjct: 166 YKPQPKPTPPPYTPTPAPPTYKPQPKPNPPPTYKPAPKPTPTPYQPAPPTYKPQPKPNPP 225 Query: 56 PYVYE-----SPPYVYKP---PTPPP 3 P Y+ +PP YKP PTP P Sbjct: 226 P-TYKPQPKPNPPPTYKPAPKPTPTP 250 [191][TOP] >UniRef100_Q39353 Cell wall-plasma membrane linker protein n=1 Tax=Brassica napus RepID=Q39353_BRANA Length = 376 Score = 57.8 bits (138), Expect = 4e-07 Identities = 34/63 (53%), Positives = 36/63 (57%), Gaps = 7/63 (11%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESP----PYVYKPPT-- 12 KPPT PP V K PP KPPT PP + PP KPPT PP V P P +KPPT Sbjct: 112 KPPTKPPTV-KPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVC 170 Query: 11 PPP 3 PPP Sbjct: 171 PPP 173 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/62 (51%), Positives = 34/62 (54%), Gaps = 6/62 (9%) Frame = -3 Query: 170 KPPTPP-----PYVYKSPPYVYKPPTPPP-YESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 KPPT P P K PP KPPT PP + PP KPPT PP V + PP KPPT Sbjct: 90 KPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTV-KPPPSTPKPPTK 148 Query: 8 PP 3 PP Sbjct: 149 PP 150 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/63 (52%), Positives = 35/63 (55%), Gaps = 8/63 (12%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPY------VYKPPT--PPPYVYESPPYVYKPP 15 KPPT PP V K PP KPPT PP PP +KPPT PPP +PP V PP Sbjct: 128 KPPTKPPTV-KPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVV-TPP 185 Query: 14 TPP 6 TPP Sbjct: 186 TPP 188 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKP-PTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPPT P+ + PP P P PP + PP KPPT PP V + PP KPPT PP Sbjct: 79 KPPTVRPHPHPKPPTKPHPIPKPPTIKPPPSTPKPPTKPPTV-KPPPSTPKPPTKPP 134 [192][TOP] >UniRef100_B5DQ45 GA23840 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DQ45_DROPS Length = 791 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/63 (47%), Positives = 34/63 (53%), Gaps = 7/63 (11%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESP-----PYVYKPPTPPPYVYESP--PYVYKPPT 12 +PPT PP +PP Y PPTPPP P P +PPT PP Y P V +PPT Sbjct: 692 RPPTRPPTRPPTPPPTYLPPTPPPTRPPTRPPTPPPTRPPTRPPTTYLPPVTTRVTRPPT 751 Query: 11 PPP 3 PPP Sbjct: 752 PPP 754 [193][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PPP PP PP PPP PP PP PPP Sbjct: 135 PPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 189 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PPP SPP PP PPP PP PP PPP Sbjct: 149 PPSPPPPPPPSPPPPPSPPPPPP-PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202 [194][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PP SPP PP+PPP SPP PP+PPP Sbjct: 2534 PPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPP---PSPPPSPPPPSPPP 2585 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP + PP PPP SPP PP+PPP SPP PP PPP Sbjct: 205 PPPPPP-----PPPLPPPPPPPPPPSPP----PPSPPPPPPPSPPPPSPPPPPPP 250 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP PP PP+PPP Sbjct: 2682 PPSPPPSPPPSPP----PPSPPPPSPPPPSPPPPSPPP---SPPPPSPPPPSPPP 2729 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP P PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 2673 PPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPP---PSPPPSPPPPSPPP 2724 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 2700 PPSPPP---PSPPPPSPPPSPPPPSPPPPSPPPPSPPP---PSPP----PPSPPP 2744 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 2705 PPSPPP---PSPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPP----PPSPPP 2749 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP+PPP PP PP+PPP PP PP PPP Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPP--PPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/63 (44%), Positives = 32/63 (50%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 N +S PP P P+ PP PP+PPP PP PP PPP SPP PP+ Sbjct: 2249 NENSPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPP---SPPPPPPTPPPSPP----PPS 2301 Query: 11 PPP 3 PPP Sbjct: 2302 PPP 2304 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/55 (52%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PPTPPP PP PP+PPP SPP PP+PPP Sbjct: 2269 PPSPPP---PSPP----PPTPPPSPPPPPPTPPPSPPP---PSPP----PPSPPP 2309 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -3 Query: 170 KPPTPP--PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP+PP P SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 2666 KPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSP-PPPSPPP---PSPPPPSPPPSPPP 2719 [195][TOP] >UniRef100_Q6QNA3 Proline-rich protein 1 n=1 Tax=Capsicum annuum RepID=Q6QNA3_CAPAN Length = 260 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYESP-PYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PTPPP SPP KPPTPPP + P P KPPT PP SPP KPPT PP Sbjct: 65 PTPPPAKSPSPPPA-KPPTPPPAKPPSPPPSKPPTKPPAKSPSPPPA-KPPTKPP 117 [196][TOP] >UniRef100_Q40150 Tomato cell wall HRGP (hydroxproline-rich glycoprotein) (Fragment) n=1 Tax=Solanum lycopersicum RepID=Q40150_SOLLC Length = 93 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/59 (47%), Positives = 34/59 (57%), Gaps = 6/59 (10%) Frame = -3 Query: 167 PP--TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYKPPTP 9 PP +PPP V PP V+ PP PP PP V+ PP +PPP V+ PP V+ PP P Sbjct: 34 PPVHSPPPPVASPPPPVHSPPPPPVASPPPPVHSPPPPVASPPPPVHSPPPPVHSPPPP 92 [197][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PPP PP PP+PPP SPP PP PPP Sbjct: 327 PPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPP---PSPPPPSPPPPPPP 378 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PPP PP PP+PPP SPP PP PPP Sbjct: 299 PPSPPP---PSPPPPSPPPPPPPRPPPPSP-PPPSPPPPPPPSPPPPPSPPPPPP 349 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/55 (47%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP PP SPP PP PPP PP PP+PPP Sbjct: 341 PPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPP 395 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/55 (49%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP PPP PP +PP PPP SPP PP+PPP Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPP---PSPP----PPSPPP 299 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/55 (47%), Positives = 29/55 (52%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP+PPP PP PP+PPP PP PP+PPP Sbjct: 277 PPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPP----PPSPPP 327 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/55 (49%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP PP PP PPP Sbjct: 227 PPSPPP---PSPP----PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PP PP SPP PP PPP PP PP+PPP Sbjct: 281 PPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP---RPPPPSPPPPSPPP 332 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/55 (47%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP PPP PP PP+PPP PP PP PPP Sbjct: 335 PPSPPPPPSPPPP---PPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 386 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP+PPP SPP PP PPP PP PP+PPP Sbjct: 373 PPPPPPSPPPPPPPRPPPPSPPP-PSPPPPSPPPPPPPSPPPPPPPRPPPPSPPP 426 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/55 (49%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP+PPP PP PP+PPP SPP PP PPP Sbjct: 217 PPSPPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPPPP 266 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/54 (48%), Positives = 28/54 (51%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 P PPP PP +PP PPP PP PP+PPP SPP PP PPP Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPPPP 318 [198][TOP] >UniRef100_P93237 Proline-rich protein PRP2 n=1 Tax=Lupinus luteus RepID=P93237_LUPLU Length = 894 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP P V++ PPY PP PPP++ PP Y PP P VYE PPY PP PP Sbjct: 673 YPPPLEKPPVHE-PPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYE-PPYERSPPVHPP 728 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/62 (46%), Positives = 35/62 (56%), Gaps = 5/62 (8%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYV----YESPPYVYKPPTP 9 Y PP P VY+ PPY PP PPP+E PP V+ PP P + +E PP V+ PP Sbjct: 442 YPPPHEKPPVYE-PPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVH 500 Query: 8 PP 3 PP Sbjct: 501 PP 502 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP P VY+ PPY PP PPP E PP Y PP P V+E PPY PP PP Sbjct: 641 YPPPHEKPPVYE-PPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHE-PPYEKPPPVQPP 696 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/58 (48%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPP--TPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 KPP P ++ PP V++PP PPP++ PP Y PP P VYE PPY PP PP Sbjct: 410 KPPIEYPPPHEKPP-VHEPPYKKPPPHDKPPIEYPPPHEKPPVYE-PPYEKSPPVHPP 465 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/61 (49%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = -3 Query: 182 SYVYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 S Y PP P VY+ PPY PP PPP+E PP Y PP P V+E PPY PP Sbjct: 272 SIEYPPPHEKPPVYE-PPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHE-PPYEKPPPEHS 329 Query: 5 P 3 P Sbjct: 330 P 330 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/59 (49%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT--PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP P + PP+V KPP PPP+E PP Y P P VYE PPY PP PP Sbjct: 511 YPPPHTKPPIEYPPPHV-KPPIQYPPPHEKPPIEYPLPHEKPPVYE-PPYEKPPPVHPP 567 [199][TOP] >UniRef100_C1PGW1 Tracheary element differentiation-related 7A n=1 Tax=Zinnia violacea RepID=C1PGW1_ZINEL Length = 300 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/54 (42%), Positives = 29/54 (53%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 P TPPP+ PP+ PP+PP PP PP PP+ PP+ PP+PP Sbjct: 29 PSTPPPHFISPPPHSVPPPSPPHSVPPPLHPVPPPSPPHPVSPPPHTVPPPSPP 82 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 9/64 (14%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPP---------PYESPPYVYKPPTPPPYVYESPPYVYKPP 15 PP PP+ PP+ PP+P P SPP+ PP PPP+ PP+ PP Sbjct: 93 PPPSPPHPVFPPPHTVPPPSPHFVPPPPNMVPPPSPPHANPPPPPPPHSVPPPPHTVPPP 152 Query: 14 TPPP 3 PPP Sbjct: 153 PPPP 156 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPP-PYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 PP PP+ PP+ PP+PP P PP+ PP+PP V+ PP+ PP+P Sbjct: 61 PPPSPPHPVSPPPHTVPPPSPPHPVSPPPHTVPPPSPPHPVF-PPPHTVPPPSP 113 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYE--SPPYVYKPPTPPPYVYESPPYVYKPPTP 9 + PP P SPP+ PP PPP+ PP+ PP PPP++ P + PP P Sbjct: 115 FVPPPPNMVPPPSPPHANPPPPPPPHSVPPPPHTVPPPPPPPHIIPPPAHALSPPPP 171 [200][TOP] >UniRef100_C1N0J8 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N0J8_9CHLO Length = 2933 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/63 (42%), Positives = 31/63 (49%), Gaps = 9/63 (14%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPP---------YVYKPPTPPPYVYESPPYVYKPP 15 PP+PPP + PP PP PP E PP Y Y PP+PPP PP PP Sbjct: 443 PPSPPPPPFPPPPPTPSPPPFPPPEMPPFTPPGVNNPYTYPPPSPPPNAPSPPPNPSPPP 502 Query: 14 TPP 6 +PP Sbjct: 503 SPP 505 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/69 (42%), Positives = 35/69 (50%), Gaps = 12/69 (17%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESP------------PY 30 Y PP PP+ +P YV PP+PPP PP+ PPTP P + P PY Sbjct: 428 YSPPPLPPF---APGYV-SPPSPPP---PPFPPPPPTPSPPPFPPPEMPPFTPPGVNNPY 480 Query: 29 VYKPPTPPP 3 Y PP+PPP Sbjct: 481 TYPPPSPPP 489 [201][TOP] >UniRef100_B9N4U0 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9N4U0_POPTR Length = 499 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/66 (46%), Positives = 38/66 (57%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYKPP-- 15 V PP PPP V+ PP V PP PP + PP V+ PP +PPP V+ PP V+ PP Sbjct: 401 VQSPPPPPP-VHSPPPPVQSPP-PPVHSPPPPVHSPPPPVQSPPPPVHSPPPPVHSPPPP 458 Query: 14 --TPPP 3 +PPP Sbjct: 459 VHSPPP 464 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYK 21 V PP +PPP V+ PP V PP PP + PP V+ PP +PPP V+ PP V Sbjct: 417 VQSPPPPVHSPPPPVHSPPPPVQSPP-PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQS 475 Query: 20 PP----TPPP 3 PP +PPP Sbjct: 476 PPPPVHSPPP 485 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/72 (44%), Positives = 40/72 (55%), Gaps = 14/72 (19%) Frame = -3 Query: 176 VYKPP----TPPPYVYKSPPYVYKPPTP-----PPYESPPYVYKPP--TPPPYVYESPPY 30 V+ PP +PPP V+ PP V+ PP P PP SPP PP +PPP V+ PP Sbjct: 431 VHSPPPPVQSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP----PPVQSPPPPVHSPPPP 486 Query: 29 VYKPP---TPPP 3 V+ PP +PPP Sbjct: 487 VHSPPPVQSPPP 498 [202][TOP] >UniRef100_C9SIX0 Predicted protein n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SIX0_9PEZI Length = 334 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/63 (46%), Positives = 34/63 (53%), Gaps = 6/63 (9%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPY------ESPPYVYKPPTPPPYVYESPPYVYKPPT 12 + PP PP PP +Y+PPTPPP PP+V +PP PPP V E P PP Sbjct: 35 FVPPPPP------PPVIYRPPTPPPVICRPATPPPPFVVEPPPPPPPVCEPLP----PPP 84 Query: 11 PPP 3 PPP Sbjct: 85 PPP 87 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYE----SPPYVYKPPTPPP 3 PPT V ++ + PP PPP P +Y+PPTPPP + PP+V +PP PPP Sbjct: 20 PPTYDRSVVRTRRTTFVPPPPPP----PVIYRPPTPPPVICRPATPPPPFVVEPPPPPP 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/62 (40%), Positives = 32/62 (51%), Gaps = 4/62 (6%) Frame = -3 Query: 176 VYKPPTPPPYVYKS----PPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 +Y+PPTPPP + + PP+V +PP PPP P PP PPP PP+P Sbjct: 45 IYRPPTPPPVICRPATPPPPFVVEPPPPPPPVCEPLPPPPPPPPPVC---------PPSP 95 Query: 8 PP 3 P Sbjct: 96 EP 97 [203][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 7/61 (11%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP--TPPPYVYESPPYV-----YKPPTP 9 PP PPP PP PP PPP PP++ PP PPP++ +PP++ + PPTP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPFILPPPFILPPPFIPPAPPFIPPAPPFIPPTP 331 Query: 8 P 6 P Sbjct: 332 P 332 [204][TOP] >UniRef100_Q06841 Early nodulin-75 (Fragment) n=1 Tax=Lupinus luteus RepID=NO75_LUPLU Length = 434 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP P V++ PPY PP PPP++ PP Y PP P VYE PPY PP PP Sbjct: 215 YPPPLEKPPVHE-PPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYE-PPYERSPPVHPP 270 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP P VY+ PPY PP PPP E PP Y PP P V+E PPY PP PP Sbjct: 183 YPPPHEKPPVYE-PPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHE-PPYEKPPPAQPP 238 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/59 (49%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT--PPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PP P + PP+V KPP PPP+E PP Y P P VYE PPY PP PP Sbjct: 53 YPPPHTKPPIEYPPPHV-KPPIQYPPPHEKPPIEYPLPHEKPPVYE-PPYEKPPPVHPP 109 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/60 (46%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPP--TPPPYESPPYVYKPPTPPPYVYESPPYVYKPP 15 H KPP P + PP Y PP PP YE PPY PP PP +E PP+VY PP Sbjct: 225 HEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYE-PPYERSPPVHPPS-HEKPPFVYPPP 282 [205][TOP] >UniRef100_Q94ES9 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES9_PEA Length = 183 Score = 56.6 bits (135), Expect(2) = 5e-07 Identities = 26/63 (41%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSP-PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 H VY P PP + Y P P + PP P P++ P PP PP + Y P VY P Sbjct: 66 HPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPP 125 Query: 11 PPP 3 PPP Sbjct: 126 PPP 128 Score = 20.4 bits (41), Expect(2) = 5e-07 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP V+ P Sbjct: 54 PPPPPPPVHTYP 65 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/65 (43%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYV----YKPPTPPPYVYESPPYVYK 21 H VY P PPP +K P PP PP + PP+V Y P PP Y P Y YK Sbjct: 116 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAYSPPPPAYYYK 175 Query: 20 PPTPP 6 P PP Sbjct: 176 SPPPP 180 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/70 (40%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPP---YESPPYVYKPPTPPPYVYESPP 33 H + H + PP P P+ PY Y P PPP Y P VY P PPP ++ P Sbjct: 79 HTYPHPHPVYHSPPPPTPH---KKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKK-P 134 Query: 32 YVYKPPTPPP 3 Y Y P PPP Sbjct: 135 YKYPSPPPPP 144 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/74 (39%), Positives = 33/74 (44%), Gaps = 15/74 (20%) Frame = -3 Query: 185 HSYVYKPPTPPP---YVYKSPPYVYKPPTPPP--------YESPP----YVYKPPTPPPY 51 H YK P+PPP + Y P VY P PPP Y SPP + Y P P P Sbjct: 97 HKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPV 156 Query: 50 VYESPPYVYKPPTP 9 + PP Y PP P Sbjct: 157 YHSPPPPAYSPPPP 170 [206][TOP] >UniRef100_UPI0000E125D3 Os05g0552600 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E125D3 Length = 510 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 6/59 (10%) Frame = -3 Query: 161 TPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPP----TPPPYVYESPPYVYKPPTPPP 3 +PPP PP VY PP PPP S PP VY PP +PPP V PP V PP P P Sbjct: 76 SPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVP 134 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/58 (51%), Positives = 31/58 (53%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 VY PP PPP PP VY P PPP SPP P+PPP V PP V PP P P Sbjct: 88 VYSPPPPPPRSSPPPPPVYSP--PPPVSSPP--PPVPSPPPPVSSPPPPVPSPPPPVP 141 [207][TOP] >UniRef100_Q4A373 Putative lectin protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A373_EHV86 Length = 1994 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PPTPPP SPP PP+ PP +PP PP+PPP Sbjct: 1227 PPPPPPSPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPP-PSPNPPPAPPPPSPPP 1280 [208][TOP] >UniRef100_Q94ES8 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum RepID=Q94ES8_PEA Length = 195 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/76 (40%), Positives = 32/76 (42%), Gaps = 14/76 (18%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPY--------VYESP- 36 H VY P PP + Y P VY P PP PY Y P PPP VY SP Sbjct: 64 HPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPP 123 Query: 35 -----PYVYKPPTPPP 3 PY Y P PPP Sbjct: 124 PPHKKPYKYSSPPPPP 139 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/76 (42%), Positives = 33/76 (43%), Gaps = 17/76 (22%) Frame = -3 Query: 179 YVYKPPTPPPY--------VYKSP------PYVYKPPTPPP---YESPPYVYKPPTPPPY 51 Y Y P PPP VY SP PY Y P PPP Y P VY P PP + Sbjct: 99 YKYPSPPPPPVHTYPHPHPVYHSPPPPHKKPYKYSSPPPPPVHTYPHPHPVYHSPPPPVH 158 Query: 50 VYESPPYVYKPPTPPP 3 Y P VY P PPP Sbjct: 159 TYPHPHPVYHSPPPPP 174 [209][TOP] >UniRef100_Q94ES6 Root nodule extensin n=1 Tax=Pisum sativum RepID=Q94ES6_PEA Length = 181 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/65 (43%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYV----YKPPTPPPYVYESPPYVYK 21 H VY P PPP +K P PP PP + PP+V Y P PP Y P Y YK Sbjct: 114 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAYSPPPPAYYYK 173 Query: 20 PPTPP 6 P PP Sbjct: 174 SPPPP 178 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/63 (41%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSP-PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 H VY P PP + Y P P + PP P P++ P PP PP + Y P VY P Sbjct: 64 HPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPP 123 Query: 11 PPP 3 PPP Sbjct: 124 PPP 126 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/70 (40%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPP---YESPPYVYKPPTPPPYVYESPP 33 H + H + PP P P+ PY Y P PPP Y P VY P PPP ++ P Sbjct: 77 HTYPHPHPVYHSPPPPTPH---KKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKK-P 132 Query: 32 YVYKPPTPPP 3 Y Y P PPP Sbjct: 133 YKYPSPPPPP 142 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/74 (39%), Positives = 33/74 (44%), Gaps = 15/74 (20%) Frame = -3 Query: 185 HSYVYKPPTPPP---YVYKSPPYVYKPPTPPP--------YESPP----YVYKPPTPPPY 51 H YK P+PPP + Y P VY P PPP Y SPP + Y P P P Sbjct: 95 HKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPV 154 Query: 50 VYESPPYVYKPPTP 9 + PP Y PP P Sbjct: 155 YHSPPPPAYSPPPP 168 [210][TOP] >UniRef100_Q94ES2 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum RepID=Q94ES2_PEA Length = 88 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/65 (43%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYV----YKPPTPPPYVYESPPYVYK 21 H VY P PPP +K P PP PP + PP+V Y P PP Y P Y YK Sbjct: 21 HPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPVYHSPPPPAYSPPPPAYYYK 80 Query: 20 PPTPP 6 P PP Sbjct: 81 SPPPP 85 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/74 (39%), Positives = 33/74 (44%), Gaps = 15/74 (20%) Frame = -3 Query: 185 HSYVYKPPTPPP---YVYKSPPYVYKPPTPPP--------YESPP----YVYKPPTPPPY 51 H YK P+PPP + Y P VY P PPP Y SPP + Y P P P Sbjct: 2 HKKPYKYPSPPPPPVHTYPHPHPVYHSPPPPPTPHKKPYKYPSPPPPPAHTYPPHVPTPV 61 Query: 50 VYESPPYVYKPPTP 9 + PP Y PP P Sbjct: 62 YHSPPPPAYSPPPP 75 [211][TOP] >UniRef100_Q76KW4 Hydroxyproline-rich glycoprotein-1 (Fragment) n=1 Tax=Pisum sativum RepID=Q76KW4_PEA Length = 152 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/76 (40%), Positives = 32/76 (42%), Gaps = 14/76 (18%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPY--------VYESP- 36 H VY P PP + Y P VY P PP PY Y P PPP VY SP Sbjct: 67 HPHPVYHSPPPPVHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPVHTYPHPHPVYHSPP 126 Query: 35 -----PYVYKPPTPPP 3 PY Y P PPP Sbjct: 127 PPHKKPYKYSSPPPPP 142 [212][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/55 (52%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + SPP PP PPP SPP PPTPP SPP PP+PPP Sbjct: 788 PPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPP-----SPP---PPPSPPP 834 [213][TOP] >UniRef100_Q00TR5 Homology to unknown gene n=1 Tax=Ostreococcus tauri RepID=Q00TR5_OSTTA Length = 1931 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/55 (52%), Positives = 33/55 (60%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP SPP PP+PPP SPP PP+PPP Sbjct: 1814 PPSPPPSPPPSPP-PSPPPSPPP--SPPPPSPPPSPPPSPPPSPPPPSPPPSPPP 1865 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/55 (52%), Positives = 33/55 (60%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP SPP PP+PPP SPP PP+PPP Sbjct: 1810 PPSPPPSPPPSPP-PSPPPSPPP--SPPPSPPPPSPPPSPPPSPPPSPPPPSPPP 1861 [214][TOP] >UniRef100_C6TIZ0 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TIZ0_SOYBN Length = 207 Score = 57.0 bits (136), Expect = 6e-07 Identities = 33/68 (48%), Positives = 39/68 (57%), Gaps = 12/68 (17%) Frame = -3 Query: 176 VYKPPTP---------PPYVYKSPPYVYKP---PTPPPYESPPYVYKPPTPPPYVYESPP 33 V+KPP P PP+V+ PPYV KP P PP + PP+V KP PP V+ PP Sbjct: 47 VHKPPKPCPPPKSSPKPPHVH--PPYVPKPPHYPKPPVHPHPPHVPKPHPKPP-VHPHPP 103 Query: 32 YVYKPPTP 9 YV KPP P Sbjct: 104 YVPKPPPP 111 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/66 (46%), Positives = 35/66 (53%), Gaps = 10/66 (15%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTP---------PPYESPPYVYKPPT-PPPYVYESPPYVYK 21 KPP PP V P V+KPP P PP+ PPYV KPP P P V+ PP+V K Sbjct: 35 KPPKKPPVV---KPPVHKPPKPCPPPKSSPKPPHVHPPYVPKPPHYPKPPVHPHPPHVPK 91 Query: 20 PPTPPP 3 P PP Sbjct: 92 PHPKPP 97 [215][TOP] >UniRef100_B9N8Z7 Predicted protein (Fragment) n=2 Tax=Populus trichocarpa RepID=B9N8Z7_POPTR Length = 420 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/55 (50%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PP V PP V P +PP PP VY PP PP Y P VY PP PPP Sbjct: 368 PPSPPVPVLSPPPPVVIPKSPPA--PPPPVYSPPPPPVYSPPPLPPVYSPPPPPP 420 [216][TOP] >UniRef100_B9FLI1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FLI1_ORYSJ Length = 518 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 6/59 (10%) Frame = -3 Query: 161 TPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPP----TPPPYVYESPPYVYKPPTPPP 3 +PPP PP VY PP PPP S PP VY PP +PPP V PP V PP P P Sbjct: 107 SPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVP 165 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYKPP-- 15 VY PP PPP PP VY PP PP PP V PP +PPP V PP V PP Sbjct: 119 VYSPPPPPPRSSPPPPPVYSPP-PPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVSSPPPP 177 Query: 14 --TPPP 3 +PPP Sbjct: 178 VSSPPP 183 [217][TOP] >UniRef100_A2Y786 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2Y786_ORYSI Length = 493 Score = 57.0 bits (136), Expect = 6e-07 Identities = 30/59 (50%), Positives = 32/59 (54%), Gaps = 6/59 (10%) Frame = -3 Query: 161 TPPPYVYKSPPYVYKPPTPPPYES--PPYVYKPP----TPPPYVYESPPYVYKPPTPPP 3 +PPP PP VY PP PPP S PP VY PP +PPP V PP V PP P P Sbjct: 82 SPPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPVSSPPPPVPSPPPPVSSPPPPVP 140 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPP----TPPPYVYESPPYVYKPP-- 15 VY PP PPP PP VY PP PP PP V PP +PPP V PP V PP Sbjct: 94 VYSPPPPPPRSSPPPPPVYSPP-PPVSSPPPPVPSPPPPVSSPPPPVPSPPPPVSSPPPP 152 Query: 14 --TPPP 3 +PPP Sbjct: 153 VSSPPP 158 [218][TOP] >UniRef100_P16329 Early nodulin-75 (Fragment) n=1 Tax=Pisum sativum RepID=NO75_PEA Length = 112 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/80 (38%), Positives = 39/80 (48%), Gaps = 9/80 (11%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPT------PPPYESPPYVYKPP--- 66 H+H P H KPP P PP+ + PP PP+E+PP VYKPP Sbjct: 24 HEHPPPEYQPPHE---KPPHEKPSPKYQPPHEHSPPEYQPPHEKPPHENPPPVYKPPYEN 80 Query: 65 TPPPYVYESPPYVYKPPTPP 6 +PPP+VY P + PP P Sbjct: 81 SPPPHVYHRPLFQAPPPVKP 100 [219][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 55.5 bits (132), Expect(2) = 7e-07 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PPTPPP +PP PPTPPP PP + P+PP + PP PP PPP Sbjct: 55 PPTPPPTPPPTPPPT-PPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPP 108 Score = 21.2 bits (43), Expect(2) = 7e-07 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PPTPPP SP Sbjct: 36 PPTPPPTPPTSP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/55 (47%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PPTPPP +PP P P P +PP PP PPP PP PPTPPP Sbjct: 67 PPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPPP 121 [220][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/56 (50%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPT-PPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+ PPP SPP PP+PPP Sbjct: 79 PPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPP 134 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+P P PP PP+PPP SPP PP+PPP Sbjct: 51 PPSPPP----SPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPP 101 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP P PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 74 PPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPSPPP 125 [221][TOP] >UniRef100_Q4A2S6 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S6_EHV86 Length = 430 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/57 (43%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYV--YKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP+ PP Y P PPP+ PP + PP PP PP V P +PPP Sbjct: 188 PPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPPP 244 [222][TOP] >UniRef100_O49151 Early nodulin (Fragment) n=1 Tax=Maackia amurensis RepID=O49151_9FABA Length = 447 Score = 56.6 bits (135), Expect = 8e-07 Identities = 36/83 (43%), Positives = 42/83 (50%), Gaps = 27/83 (32%) Frame = -3 Query: 170 KPPT--PPPYV---------YKSPPYVYKPPT-------PPPYESPPYVYKPPT------ 63 KPP PPPY Y+ PP +Y PP PPP+E PP VY+PP Sbjct: 116 KPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIE 175 Query: 62 -PPPYVYESPPYVYKPP--TPPP 3 PPP+ E PP VY+PP PPP Sbjct: 176 YPPPH--EKPPPVYQPPYEKPPP 196 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/81 (43%), Positives = 42/81 (51%), Gaps = 19/81 (23%) Frame = -3 Query: 188 HHSYVYKPPTP---PPYVYKSPPYVYKPPT-------PPPYESPPYVYKPPT-------P 60 H Y+ P P PPY + PP +Y PP PPP+E PP VY+PP P Sbjct: 246 HEKPPYEKPPPEYQPPY--EKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYP 303 Query: 59 PPYVYESPPYVYKPP--TPPP 3 PP+ E PP VY+PP PPP Sbjct: 304 PPH--EKPPPVYQPPYEKPPP 322 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/80 (43%), Positives = 41/80 (51%), Gaps = 8/80 (10%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPP-TPPPYESPPYVYKPP--TPPPYV 48 H+ LP + Y PPT PP ++ PP Y PP PPYE PP Y+PP PPP Sbjct: 213 HEKLPPVYQP--PYEKPPPTYPP-PHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLY 269 Query: 47 ---YESPPYVYKPP--TPPP 3 +E PP Y PP PPP Sbjct: 270 PPPHEKPPIEYPPPHEKPPP 289 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/61 (49%), Positives = 35/61 (57%), Gaps = 5/61 (8%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPP---TPPPYESPPYVYKPPTPPPYVYESPPYVYKPPT--PP 6 KPP P Y+ PP +Y PP PP +E PP+ YKPP P E PP V KPP+ PP Sbjct: 379 KPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPF-YKPPVYEPPPLEKPPPVEKPPSYKPP 437 Query: 5 P 3 P Sbjct: 438 P 438 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/66 (45%), Positives = 34/66 (51%), Gaps = 10/66 (15%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT-------PPPYESPPYVYKPP---TPPPYVYESPPYVYK 21 KPP P ++ PP VY+PP PPP+E PP Y PP PP Y PPY Sbjct: 171 KPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVY---QPPYEKP 227 Query: 20 PPTPPP 3 PPT PP Sbjct: 228 PPTYPP 233 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/75 (45%), Positives = 38/75 (50%), Gaps = 19/75 (25%) Frame = -3 Query: 170 KPPT--PPPYV---YKSPPYVYKPPT-------PPPYESPPYVYKPP--TPPPYV---YE 42 KPP PPP+ Y+ PP Y+PP PPP+E PP Y PP PPP YE Sbjct: 237 KPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYE 296 Query: 41 SPPYVYKPP--TPPP 3 PP Y PP PPP Sbjct: 297 KPPIEYPPPHEKPPP 311 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/66 (45%), Positives = 34/66 (51%), Gaps = 10/66 (15%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT-------PPPYESPPYVYKPP---TPPPYVYESPPYVYK 21 KPP P ++ PP VY+PP PPP+E PP Y PP PP Y PPY Sbjct: 297 KPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVY---QPPYEKP 353 Query: 20 PPTPPP 3 PPT PP Sbjct: 354 PPTYPP 359 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/67 (46%), Positives = 37/67 (55%), Gaps = 11/67 (16%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT---PPPYESPPYVYKPPT----PPPYV--YESPPYVYKP 18 KPPT P + PP VY+PP PPP+ PP Y+PP PP Y +E PP Y+P Sbjct: 31 KPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQPPHEKPPPEYQP 90 Query: 17 P--TPPP 3 P PPP Sbjct: 91 PHEKPPP 97 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/64 (45%), Positives = 35/64 (54%), Gaps = 12/64 (18%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT-------PPPYESPPYVYKPP--TPPPYV---YESPPYV 27 KPP P ++ PP VY+PP PPP+E PP VY+PP PPP +E PP Sbjct: 149 KPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIE 208 Query: 26 YKPP 15 Y PP Sbjct: 209 YPPP 212 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/64 (45%), Positives = 35/64 (54%), Gaps = 12/64 (18%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPT-------PPPYESPPYVYKPP--TPPPYV---YESPPYV 27 KPP P ++ PP VY+PP PPP+E PP VY+PP PPP +E PP Sbjct: 275 KPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIE 334 Query: 26 YKPP 15 Y PP Sbjct: 335 YPPP 338 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/64 (45%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYV---YESPPYVYKPP 15 +Y PP P + PP+ PP PPYE PP Y PP PPP YE PP VY PP Sbjct: 142 LYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPP 201 Query: 14 TPPP 3 P Sbjct: 202 HEKP 205 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/64 (45%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYV---YESPPYVYKPP 15 +Y PP P + PP+ PP PPYE PP Y PP PPP YE PP VY PP Sbjct: 268 LYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPP 327 Query: 14 TPPP 3 P Sbjct: 328 HEKP 331 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/71 (43%), Positives = 35/71 (49%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP-------TPPPY---VYESPPY 30 VY PP P + PP+ PP PPYE PP Y PP PPP+ YE PP Sbjct: 323 VYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPP 382 Query: 29 VYKPP--TPPP 3 +Y PP PPP Sbjct: 383 LYPPPYEKPPP 393 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/86 (40%), Positives = 43/86 (50%), Gaps = 14/86 (16%) Frame = -3 Query: 218 HQHLPHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPP-TPPPYESPPYVYKPP-------T 63 H+ LP + Y PPT PP ++ PP Y PP PPYE PP +Y PP Sbjct: 339 HEKLPPVYQP--PYEKPPPTYPP-PHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLY 395 Query: 62 PPPYVYESP----PYVYKPPT--PPP 3 PPP+ ++ P P YKPP PPP Sbjct: 396 PPPHHHKPPHHEKPPFYKPPVYEPPP 421 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP--TPPPYV---YESPPYVYKPP- 15 Y+PP P PP+ PP PPPYE PP Y+PP PPP +E PP Y PP Sbjct: 99 YQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPH 158 Query: 14 -TPPP 3 PPP Sbjct: 159 EKPPP 163 Score = 53.5 bits (127), Expect = 7e-06 Identities = 31/71 (43%), Positives = 35/71 (49%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYVYKPPT-PPPYESPPYVYKPP-------TPPPY---VYESPPY 30 VY PP P + PP+ PP PPYE PP Y PP PPP+ YE PP Sbjct: 197 VYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPP 256 Query: 29 VYKPP--TPPP 3 Y+PP PPP Sbjct: 257 EYQPPYEKPPP 267 [223][TOP] >UniRef100_B9GHP4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GHP4_POPTR Length = 223 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/76 (43%), Positives = 38/76 (50%), Gaps = 18/76 (23%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPY------------------VYKPPTPPPYESPPYVYKPPTPPPY 51 +YKPPTP P V PP VYKPP+P P +PP KPPT P Sbjct: 42 LYKPPTPAPPVKTPPPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVKPPTTP-- 99 Query: 50 VYESPPYVYKPPTPPP 3 +PP VYKPP+P P Sbjct: 100 ---APP-VYKPPSPAP 111 [224][TOP] >UniRef100_A8WZD0 Putative uncharacterized protein n=1 Tax=Caenorhabditis briggsae RepID=A8WZD0_CAEBR Length = 219 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/63 (39%), Positives = 30/63 (47%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYV 27 P + HS PP PPP PP ++PP PP Y PP Y PP P P + PP + Sbjct: 125 PKQKSSEHSKNQPPPPPPPQRRPPPPPHHRPPPPPGYRPPPPSYYPPPPLPVIVGPPPVI 184 Query: 26 YKP 18 P Sbjct: 185 MSP 187 [225][TOP] >UniRef100_Q8MP30 Uncharacterized histidine-rich protein DDB0167791 n=1 Tax=Dictyostelium discoideum RepID=Y7791_DICDI Length = 233 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/60 (40%), Positives = 28/60 (46%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H + H H H +HHH H H PH HHH H H PH + +HHH H H H Sbjct: 71 HHHHHHHHHHHHHHHHHHHHHHHHHHPHHPHHHPH--HHHHPHHHHHHHHHHHHHHHHHH 128 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/55 (41%), Positives = 27/55 (49%) Frame = -1 Query: 166 HQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H H LH +HHH H H H +HHH H H PH + +HHH H H H Sbjct: 66 HPHHLHHHHHHHHHHHHHHH--HHHHHHHHHHHPHHPHHHPHHHHHPHHHHHHHH 118 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/60 (36%), Positives = 27/60 (45%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H + H H H +H H H H PH +HHH H H H + +HHH H H H Sbjct: 84 HHHHHHHHHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 143 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/60 (38%), Positives = 28/60 (46%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H + H H H +HHH H H H +HHH H H H + +HHH H H PH Sbjct: 101 HHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHPH 156 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/60 (36%), Positives = 27/60 (45%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H + H H H +HHH H H H +HHH H H H + +HHH H H H Sbjct: 91 HHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 150 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/60 (36%), Positives = 27/60 (45%) Frame = -1 Query: 181 HMYTSHQHLLHMSTNHHHMSTSHQHLPHMNHHHTSTSHQHLPHMYTNHHHTSTSHQHLPH 2 H + H H H +HHH H H PH + HH H H H + +HHH H H H Sbjct: 74 HHHHHHHHHHHHHHHHHHHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHH 133 [226][TOP] >UniRef100_UPI0000DB7674 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB7674 Length = 441 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTP 9 Y PP+PP PP Y PP+PP PP Y PP+PP PP Y PP+P Sbjct: 37 YVPPSPPTSRPPPPPTPYVPPSPPTSRPPPTPYLPPSPPTSRPRPPPTPYVPPSP 91 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 27/62 (43%), Positives = 33/62 (53%), Gaps = 6/62 (9%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTP--PPYESPPYVYKPPTPPPYVYESPPYVY----KPPT 12 Y PP+PP PP Y PP+P PP PP PPT P Y+ SPP + +PP+ Sbjct: 165 YLPPSPPINRPSPPPSSYLPPSPSRPPSPQPPPTRPPPTGPTYLPPSPPVTHPPITRPPS 224 Query: 11 PP 6 PP Sbjct: 225 PP 226 Score = 21.6 bits (44), Expect(2) = 2e-06 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP P PYV SP Sbjct: 128 PPPPTPYVPPSP 139 [227][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/57 (50%), Positives = 31/57 (54%) Frame = -3 Query: 173 YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 Y PPT PP SPP PP+PPP PP PP+PPP SPP PP PPP Sbjct: 110 YIPPTTPP---PSPPPSQPPPSPPPPSPPPPSPPPPSPPP---PSPPPPPSPPPPPP 160 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 117 PPSPPP---SQPPPSPPPPSPPPPSPPPPSPPPPSPPP--PPSPPPPPPPPSPPP 166 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 481 PPSPPP---PSPP----PPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPSPPP 525 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 226 PPSPPP---PSPP----PPSPPPPSPPPPSPPPPSPPP---PSPPPPPPPPSPPP 270 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 251 PPSPPP---PSPPPPPPPPSPPPPSPPPPSPPPPSPPP---PSPP----PPSPPP 295 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/55 (47%), Positives = 27/55 (49%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PP PP SPP PP PP PP PP+PPP Sbjct: 369 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPP 423 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 428 PPSPPPPSPPSPP----PPSPPPPSPPPPSPPPPSPPP---PSPP----PPSPPP 471 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP SPP PP PPP Sbjct: 221 PPSPPP---PSPP----PPSPPPPSPPPPSPPPPSPPP---PSPPPPSPPPPPPP 265 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PPP PP PP+PPP SPP PP+PPP Sbjct: 246 PPSPPP---PSPPPPSPPPPPPPPSPPPPSPPPPSPPP---PSPP----PPSPPP 290 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 313 PPPPPPSPPPSPP----PPSPPPPSPPPPSPPPPSPPP---PSPP----PPSPPP 356 [228][TOP] >UniRef100_A9B3Y6 Serine/threonine protein kinase n=1 Tax=Herpetosiphon aurantiacus ATCC 23779 RepID=A9B3Y6_HERA2 Length = 989 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 25/88 (28%) Frame = -3 Query: 191 NHHSYVYKPPTPPPYVYKS-------PPYVYKPPTP---------PPYESPPYVYKPPTP 60 N + +Y PPTP P V + P +Y PPTP PP P +Y PPTP Sbjct: 345 NEGTMIYTPPTPNPVVNQQAAPPPNEPTQIYTPPTPNSVVNQQAAPPPNEPTQIYTPPTP 404 Query: 59 PPYVYESPP---------YVYKPPTPPP 3 P V ++ P +Y PPTP P Sbjct: 405 NPVVQQAAPAAKPPVDATQIYTPPTPNP 432 [229][TOP] >UniRef100_C5EUN4 Predicted protein n=1 Tax=Clostridiales bacterium 1_7_47FAA RepID=C5EUN4_9FIRM Length = 608 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/63 (52%), Positives = 33/63 (52%), Gaps = 5/63 (7%) Frame = -3 Query: 179 YVYKPPTPP--PYVYKSP--PYVYKPPTPPPYESPPYVYKPPTPP-PYVYESPPYVYKPP 15 Y KPP PP PY K P PY PPTPP PP KPP PP P PPY KPP Sbjct: 473 YPPKPPYPPYPPYPPKPPYPPYPPYPPTPPYPPEPPCPPKPPCPPEPPCPPKPPYPPKPP 532 Query: 14 TPP 6 PP Sbjct: 533 CPP 535 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/54 (53%), Positives = 30/54 (55%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 PPTPP PPY KPP PP +PPY PPTPP PPY KPP PP Sbjct: 438 PPTPP-----YPPYPPKPPYPPYPPTPPYPPYPPTPP-----YPPYPPKPPYPP 481 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/56 (51%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = -3 Query: 167 PPTPP-PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPP-PYVYESPPYVYKPPTPP 6 PPTPP P +PPY PP PP PPY KPP PP P +PPY +PP PP Sbjct: 456 PPTPPYPPYPPTPPYPPYPPKPPYPPYPPYPPKPPYPPYPPYPPTPPYPPEPPCPP 511 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/59 (50%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -3 Query: 179 YVYKPPTPP-PYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPP 6 Y KPP PP P PPY PP PP PPY PP PP Y PPY PPTPP Sbjct: 446 YPPKPPYPPYPPTPPYPPYPPTPPYPPYPPKPPYPPYPPYPPKPPY--PPYPPYPPTPP 502 [230][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP + SPP PP PPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/55 (47%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP + PP PPP PP PP PPP PP PP PPP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/55 (47%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP PP PPP PP PP PPP PP PP PPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/55 (47%), Positives = 27/55 (49%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/55 (47%), Positives = 27/55 (49%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP+PPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/55 (47%), Positives = 27/55 (49%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP+PPP PP PP PPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 [231][TOP] >UniRef100_Q41403 Early nodulin (enod2-3a) protein (Fragment) n=1 Tax=Sesbania rostrata RepID=Q41403_SESRO Length = 64 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/60 (46%), Positives = 31/60 (51%), Gaps = 7/60 (11%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTP-------PPYESPPYVYKPPTPPPYVYESPPYVYKPPT 12 KPP P Y+ PP VY PP PPYE PP YKPP P Y PPY + PP+ Sbjct: 2 KPPPVYPPPYEKPPPVYPPPYEKPPPVYSPPYEKPPPEYKPPHEKPPGYNPPPYGHYPPS 61 [232][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PP PPP PP PP+PPP PP PP PPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/55 (50%), Positives = 29/55 (52%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PPP SPP PP PPP PP PP PPP Sbjct: 223 PPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPP-----PPPPPPPPPPPP 272 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP PPP SPP PP PPP PP PP PPP PP PP PPP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/55 (47%), Positives = 27/55 (49%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP PP PP PPP PP PP PPP PP PP PPP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 [233][TOP] >UniRef100_B9RUF0 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis RepID=B9RUF0_RICCO Length = 234 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/60 (53%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = -3 Query: 176 VYKPPTPPPYVYKSP--PYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 V KPPTP P VYK P P + P P P PP V PP P Y SPP V KPPTP P Sbjct: 81 VVKPPTPSPPVYKPPTTPVIKPPNAPSPVVKPPTVPAPPVVKPPTY-SPP-VAKPPTPAP 138 [234][TOP] >UniRef100_Q296I6 GA17823 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=Q296I6_DROPS Length = 579 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/71 (46%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = -3 Query: 209 LPHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPT---PPPYESPPYVYKPPTPPPYVYES 39 LP + + Y PPT PP Y P Y PPT PP Y PP Y PPT PP Y + Sbjct: 256 LPPVLPTYPPTTYAPPTNPPPTYAPPTY---PPTTYAPPTY--PPPTYAPPTYPPPTY-A 309 Query: 38 PPYVYKPPTPP 6 PP Y PPT P Sbjct: 310 PPPTYPPPTYP 320 [235][TOP] >UniRef100_A0T1J6 Rendezvin (Fragment) n=1 Tax=Lytechinus variegatus RepID=A0T1J6_LYTVA Length = 1839 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 3/71 (4%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYE---SP 36 P+ N Y+PP PP Y++P PP PP +PP Y+PP PP Y+ +P Sbjct: 1734 PYQPPNAPPAPYQPPNAPPAPYQTPNAPPAPPYQPP-NAPPAPYQPPNEPPAPYQPPNAP 1792 Query: 35 PYVYKPPTPPP 3 P Y+PP PP Sbjct: 1793 PAPYQPPNAPP 1803 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 8/63 (12%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPY-----ESPPYVYKPPTPPPYVYE---SPPYVYKPPT 12 PP PP +PP Y+PP PP +PP Y+PP PP Y+ +PP Y+PP Sbjct: 1761 PPAPPYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPYQPPNAPPAPYQPPNAPPAPYQPPN 1820 Query: 11 PPP 3 PP Sbjct: 1821 APP 1823 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/74 (37%), Positives = 38/74 (51%), Gaps = 6/74 (8%) Frame = -3 Query: 206 PHMCMNHHSYVYKPPTPPPYVYK---SPPYVYKPPTPPPYESPPYVYKPPTPPPYVYE-- 42 P+ N Y+PP PP Y+ +PP Y+PP +PP Y+PP PP Y+ Sbjct: 1765 PYQPPNAPPAPYQPPNEPPAPYQPPNAPPAPYQPP-----NAPPAPYQPPNAPPAPYQPP 1819 Query: 41 -SPPYVYKPPTPPP 3 +PP Y+PP PP Sbjct: 1820 NAPPAPYQPPNAPP 1833 [236][TOP] >UniRef100_A0CRV7 Chromosome undetermined scaffold_25, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CRV7_PARTE Length = 177 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/56 (50%), Positives = 29/56 (51%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 +PP PPPY Y PP Y PP PP Y PPY PPP Y PP P PPP Sbjct: 2 QPPPPPPYGY--PPAQYPPPPPPAYGQPPYPQPGYQPPPTGYPYPP---TPGYPPP 52 [237][TOP] >UniRef100_UPI0001982F72 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982F72 Length = 559 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYK---PPTPPPYVYKSPPYVYKPPTPPPYESPPY-----VYKPPTPPP-----YVYESP 36 VYK PP+ PPY SPP VY P+P P P+ +Y P PPP + SP Sbjct: 208 VYKQQIPPSVPPYTAPSPPQVYDQPSPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFPSP 267 Query: 35 PYVYKPPTPPP 3 VYK P PPP Sbjct: 268 VPVYKKPLPPP 278 [238][TOP] >UniRef100_Q5N8V9 Os01g0899700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5N8V9_ORYSJ Length = 412 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/63 (44%), Positives = 35/63 (55%), Gaps = 8/63 (12%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPP------TPPPYES-PPYVYKPPTPPPYVYES-PPYVY 24 + Y P P PY Y SPP+ YK P +PPP+ PP ++ P+PP Y S PPY Y Sbjct: 184 FPYNSPPPSPYQYPSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQY 243 Query: 23 KPP 15 PP Sbjct: 244 TPP 246 [239][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP+PPP PP PP+PPP SPP PP+PPP Sbjct: 206 PPSPPPPPPPSPP----PPSPPPPSPPPPSPPPPSPPPPPPPSPP----PPSPPP 252 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/67 (43%), Positives = 32/67 (47%) Frame = -3 Query: 203 HMCMNHHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVY 24 H C PP PPP PP PP+PPP PP PP+PPP SPP Sbjct: 164 HQCCPVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPP--PPPPSPPPPPPPSPP--- 218 Query: 23 KPPTPPP 3 PP+PPP Sbjct: 219 -PPSPPP 224 [240][TOP] >UniRef100_A5BQP2 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BQP2_VITVI Length = 1190 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/71 (43%), Positives = 36/71 (50%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYK---PPTPPPYVYKSPPYVYKPPTPPPYESPPY-----VYKPPTPPP-----YVYESP 36 VYK PP+ PPY SPP VY P+P P P+ +Y P PPP + SP Sbjct: 862 VYKQQIPPSVPPYTAPSPPQVYDQPSPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFPSP 921 Query: 35 PYVYKPPTPPP 3 VYK P PPP Sbjct: 922 VPVYKKPLPPP 932 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 29/66 (43%), Positives = 33/66 (50%), Gaps = 8/66 (12%) Frame = -3 Query: 176 VYKPPTPPPY-----VYKSPPYVYKPPTPPP---YESPPYVYKPPTPPPYVYESPPYVYK 21 +Y P PPP + SP VYK P PPP Y+ PP PP P + PP V K Sbjct: 902 IYHKPLPPPVRVYGQPFPSPVPVYKKPLPPPVPIYKKPPLPSLPPPVPVHKKSLPPPVPK 961 Query: 20 PPTPPP 3 PP PPP Sbjct: 962 PPLPPP 967 Score = 20.8 bits (42), Expect(2) = 1e-06 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP+ PPY SP Sbjct: 868 PPSVPPYTAPSP 879 [241][TOP] >UniRef100_A2WXZ6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2WXZ6_ORYSI Length = 412 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/63 (44%), Positives = 35/63 (55%), Gaps = 8/63 (12%) Frame = -3 Query: 179 YVYKPPTPPPYVYKSPPYVYKPP------TPPPYES-PPYVYKPPTPPPYVYES-PPYVY 24 + Y P P PY Y SPP+ YK P +PPP+ PP ++ P+PP Y S PPY Y Sbjct: 184 FPYNSPPPSPYQYPSPPFNYKSPPLPNQFSPPPFNKFPPPSHQYPSPPQSSYHSPPPYQY 243 Query: 23 KPP 15 PP Sbjct: 244 TPP 246 [242][TOP] >UniRef100_B5DR41 GA28343 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DR41_DROPS Length = 578 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/74 (41%), Positives = 32/74 (43%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP----YVYKPPTPPPYESPPYVYKPPTPPPYVYESPP-------- 33 VY P PP Y P VY PP PPP VY PP PP YV +PP Sbjct: 158 VYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPA 217 Query: 32 ----YVYKPPTPPP 3 VY PP PPP Sbjct: 218 PVKKVVYTPPPPPP 231 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/74 (41%), Positives = 32/74 (43%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP----YVYKPPTPPPYESPPYVYKPPTPPPYVYESPP-------- 33 VY P PP Y P VY PP PPP VY PP PP YV +PP Sbjct: 305 VYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPA 364 Query: 32 ----YVYKPPTPPP 3 VY PP PPP Sbjct: 365 PVKKVVYTPPPPPP 378 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/71 (46%), Positives = 34/71 (47%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYV-YKPPTP-------PPYESPP-----YVYKPPTPPPYVYESP 36 VY PP PP YV +PP V Y PP P PP PP VY PP PPP Sbjct: 194 VYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPA-PVK 252 Query: 35 PYVYKPPTPPP 3 VY PP PPP Sbjct: 253 KVVYTPPPPPP 263 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/71 (46%), Positives = 34/71 (47%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYV-YKPPTP-------PPYESPP-----YVYKPPTPPPYVYESP 36 VY PP PP YV +PP V Y PP P PP PP VY PP PPP Sbjct: 341 VYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPA-PVK 399 Query: 35 PYVYKPPTPPP 3 VY PP PPP Sbjct: 400 KVVYTPPPPPP 410 [243][TOP] >UniRef100_B4H1U4 GL17948 n=1 Tax=Drosophila persimilis RepID=B4H1U4_DROPE Length = 415 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/74 (41%), Positives = 32/74 (43%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP----YVYKPPTPPPYESPPYVYKPPTPPPYVYESPP-------- 33 VY P PP Y P VY PP PPP VY PP PP YV +PP Sbjct: 158 VYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPA 217 Query: 32 ----YVYKPPTPPP 3 VY PP PPP Sbjct: 218 PVKKVVYTPPPPPP 231 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/74 (41%), Positives = 32/74 (43%), Gaps = 16/74 (21%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPP----YVYKPPTPPPYESPPYVYKPPTPPPYVYESPP-------- 33 VY P PP Y P VY PP PPP VY PP PP YV +PP Sbjct: 305 VYVKPAPPKVEYLPPAPVKKVVYTPPPPPPAPVKKVVYTPPPPPVYVKPAPPKVEYLPPA 364 Query: 32 ----YVYKPPTPPP 3 VY PP PPP Sbjct: 365 PVKKVVYTPPPPPP 378 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/71 (46%), Positives = 34/71 (47%), Gaps = 13/71 (18%) Frame = -3 Query: 176 VYKPPTPPPYVYKSPPYV-YKPPTP-------PPYESPP-----YVYKPPTPPPYVYESP 36 VY PP PP YV +PP V Y PP P PP PP VY PP PPP Sbjct: 194 VYTPPPPPVYVKPAPPKVEYLPPAPVKKVVYTPPPPPPPAPVKKVVYTPPPPPPPA-PVK 252 Query: 35 PYVYKPPTPPP 3 VY PP PPP Sbjct: 253 KVVYTPPPPPP 263 [244][TOP] >UniRef100_A0D0W9 Chromosome undetermined scaffold_33, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D0W9_PARTE Length = 369 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPPYESP-PYVYKPPTPPPYVYESPPYVYKPPT 12 H Y Y+P PPPY +SPP Y+ P PP Y+ P P Y+ P PP + PPY + P Sbjct: 24 HDDYYYQPQ-PPPYYQQSPPPYYEQPYPPYYQQPQPSFYEQPYPPYHDQPYPPY-HDQPY 81 Query: 11 PP 6 PP Sbjct: 82 PP 83 [245][TOP] >UniRef100_C5M7V9 Predicted protein n=1 Tax=Candida tropicalis MYA-3404 RepID=C5M7V9_CANTT Length = 1034 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/75 (38%), Positives = 36/75 (48%), Gaps = 7/75 (9%) Frame = -3 Query: 206 PHMCMN--HHSYVYKPPTPPP-----YVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYV 48 PH N HHS P PPP + + PP PP PP Y Y PP PPP++ Sbjct: 235 PHSGSNNSHHSPHLPHPPPPPTTSSHHSMEEPPRGPPPPLPPHLLHHYYGYPPPPPPPHM 294 Query: 47 YESPPYVYKPPTPPP 3 + P + + PP PPP Sbjct: 295 HHPPGFGFPPPPPPP 309 [246][TOP] >UniRef100_Q7PNI8 AGAP000892-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=Q7PNI8_ANOGA Length = 157 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 31/69 (44%), Positives = 34/69 (49%), Gaps = 11/69 (15%) Frame = -3 Query: 176 VYKPPTP------PPYVYKSPPYVYKPPTPPPYESPPYVYKPPT-----PPPYVYESPPY 30 VY PP P PP Y PP V+ P PPP P VY PP PPP V+ +PP Sbjct: 77 VYGPPPPQSYGPPPPQSYGPPPPVHHAPPPPPPPPPRPVYGPPPQQSYGPPPPVHHAPP- 135 Query: 29 VYKPPTPPP 3 PP PPP Sbjct: 136 ---PPPPPP 141 Score = 20.8 bits (42), Expect(2) = 2e-06 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP Y P Sbjct: 62 PPPPPPPAYGPP 73 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/71 (45%), Positives = 34/71 (47%), Gaps = 9/71 (12%) Frame = -3 Query: 188 HHSYVYKPPTPPPYVYKSPPYVYKPPTPPP-YESPP--YVYKPP------TPPPYVYESP 36 HH PP PP VY PP + PP PPP PP VY PP PPP Y P Sbjct: 42 HHG----PPPPPRPVYGPPPVHHAPPPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYGPP 97 Query: 35 PYVYKPPTPPP 3 P V+ P PPP Sbjct: 98 PPVHHAPPPPP 108 [247][TOP] >UniRef100_UPI0001985257 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985257 Length = 448 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 3/66 (4%) Frame = -3 Query: 194 MNHHSYV-YKPPTPPPYVYKSPPYVYKPPTPPPYESPPYV--YKPPTPPPYVYESPPYVY 24 +N++++ + PP PPP+ PP + P PPP+ PP +PP PPP++ PP Sbjct: 6 INYYNFPPFSPPPPPPHRRPPPPPPHINPPPPPHTRPPPPPHTRPPPPPPHINPPPPPHT 65 Query: 23 KPPTPP 6 +PP PP Sbjct: 66 RPPPPP 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPP---PYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 +PP PPP++ PP +PP PP P PP++ P PPP+ PP +PP PPP Sbjct: 24 RPPPPPPHINPPPPPHTRPPPPPHTRPPPPPPHI--NPPPPPHTRPPPPPHRRPPPPPP 80 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 10/63 (15%) Frame = -3 Query: 164 PTPPPYVYKSPPYVYKPPTPPPYESPPYV----------YKPPTPPPYVYESPPYVYKPP 15 P PPP+ PP +PP PPP+ +PP +PP PPP++ PP +PP Sbjct: 34 PPPPPHTRPPPPPHTRPPPPPPHINPPPPPHTRPPPPPHRRPPPPPPHINPPPPPHTRPP 93 Query: 14 TPP 6 PP Sbjct: 94 PPP 96 Score = 20.8 bits (42), Expect(2) = 5e-06 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -2 Query: 219 PPTPPPYVYESP 184 PP PPP++ P Sbjct: 25 PPPPPPHINPPP 36 [248][TOP] >UniRef100_UPI000186476A hypothetical protein BRAFLDRAFT_84276 n=1 Tax=Branchiostoma floridae RepID=UPI000186476A Length = 1721 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/58 (53%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -3 Query: 170 KPPTPPPYVYKSPPYVYKPPTPPPYE--SPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 + PTPPP PP + PTPPP E PP K PTPPP SPP V K PTPPP Sbjct: 1353 REPTPPPREPTPPP---REPTPPPREPTPPPEPEKEPTPPP----SPPPVEKAPTPPP 1403 [249][TOP] >UniRef100_Q94ES7 Root nodule extensin (Fragment) n=1 Tax=Pisum sativum RepID=Q94ES7_PEA Length = 145 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/69 (42%), Positives = 30/69 (43%), Gaps = 14/69 (20%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPY--------VYESP------PY 30 PP PP + Y P VY P PP PY Y P PPP VY SP PY Sbjct: 54 PPPPPAHTYPHPHPVYHSPPPPTPHKKPYKYPSPPPPPAHTYPHPHPVYHSPPPPHKKPY 113 Query: 29 VYKPPTPPP 3 Y P PPP Sbjct: 114 KYSSPPPPP 122 [250][TOP] >UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y7_VOLCA Length = 687 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP SPP PP PPP PP +PPTPPP SPP PP PPP Sbjct: 624 PPSPPP---PSPP----PPNPPPPSPPPPSPRPPTPPP---PSPPPPRPPPRPPP 668 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/55 (49%), Positives = 30/55 (54%) Frame = -3 Query: 167 PPTPPPYVYKSPPYVYKPPTPPPYESPPYVYKPPTPPPYVYESPPYVYKPPTPPP 3 PP+PPP + PP PPTPPP PP +PP PPP PP PP PPP Sbjct: 484 PPSPPPP--RPPPPSPVPPTPPPSPRPPPSPRPPNPPP----RPPSPRPPPRPPP 532