[UP]
[1][TOP] >UniRef100_A8W7G2 Putative capsid protein n=1 Tax=Primula malacoides virus China/Mar2007 RepID=A8W7G2_9VIRU Length = 673 Score = 112 bits (281), Expect = 1e-23 Identities = 55/112 (49%), Positives = 72/112 (64%) Frame = +2 Query: 89 NINAYDLLFSASPANLRETTVVLQSIYKLFEGKIACKHTLSQFICESTSPSITKHGYSTF 268 ++NAYDLLFSAS ANLRE VVLQ + + +GK+ TL F+ + + KHGYST+ Sbjct: 284 HVNAYDLLFSASAANLRELKVVLQVVSTVLDGKVTTSGTLGDFLTKPSGALAIKHGYSTY 343 Query: 269 PLPTWSHTESDAKAIRFSSVTALIHVSEEDRAQDFCFLQRPTAAIPHLNEAS 424 LPTWS+ + K+ +S++T L SE DRAQD CFLQRP AA E + Sbjct: 344 ALPTWSYNTNATKSAVYSAITTLTLTSERDRAQDICFLQRPAAAFNATTEVT 395 [2][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/53 (50%), Positives = 32/53 (60%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVLQ 160 P PPPPP PPPPP P PPPAPPP PPP P I++ LF +T ++ Sbjct: 1425 PPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGLFPTVATTFNQTNAAIR 1477 Score = 63.9 bits (154), Expect = 5e-09 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPPTPPPAP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1437 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 [3][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPPAP PPPAPPP PPPAP Sbjct: 622 PAPPPPPPPPPPPAPPPPPAPPPPPPPAP 650 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPPAP PPPAPPP PPP P Sbjct: 648 PAPPPPPAPPPPPAPAPPPAPPPPPPPPP 676 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPPAP PPP P P PPPAP Sbjct: 628 PPPPPPPAPPPPPAPPPPPPPAPPPPPAP 656 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPPAP Sbjct: 634 PAPPPPPAPPPPPPPAPPPPPAPPPPPAP 662 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPP--PAPPPTPPPAP 88 P PPPPP PPPPPAP PP PAPPP PPP P Sbjct: 642 PPPPPPPAPPPPPAPPPPPAPAPPPAPPPPP 672 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPPAP PPP PPP PPP P Sbjct: 654 PAPPPPPAPAPPPAPPPPPPPPPAPPPPP 682 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPPAP PPPAPPP P PAP Sbjct: 636 PPPPPAPPPPPPPAPPPPPAPPPPPAPAP 664 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPP-PAPPPTPPPAP 88 P PPPPP P PPPAP PP PAPPP PPP P Sbjct: 599 PGPPPPPAPAPPPAPAPPAPAPPPAPPPPP 628 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPPAP PPPAPPP P P P Sbjct: 664 PPPAPPPPPPPPPAPPPPPAPPPPPAPPP 692 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTP 76 P PPPPP PPPPPAP PPPAPPP P Sbjct: 670 PPPPPPPAPPPPPAPPPPPAPPPPP 694 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPP---PPAPMPPPAPPPTPPPAP 88 P PPP P PPP PPAP PPPAPPP PPP P Sbjct: 601 PPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPP 632 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP P P PPPAP Sbjct: 662 PAPPPAPPPPPPPPPAPPPPPAPPPPPAP 690 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPP--PPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PPP P PPP PPP PPP P Sbjct: 624 PPPPPPPPPPPAPPPPPAPPPPPPPAPPPPP 654 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P P P PPP PPP P Sbjct: 660 PAPAPPPAPPPPPPPPPAPPPPPAPPPPP 688 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P P P PPP PPP P Sbjct: 666 PAPPPPPPPPPAPPPPPAPPPPPAPPPPP 694 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPP P P PPP P P PPPAP Sbjct: 656 PPPPPAPAPPPAPPPPPPPPPAPPPPPAP 684 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP P PPP P PPP P P PPPA Sbjct: 668 PPPPPPPPPAPPPPPAPPPPPAPPPPPA 695 [4][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 63.9 bits (154), Expect = 5e-09 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 P PPPPP PPP P P PPP PPPTPPP PN +A Sbjct: 107 PPPPPPPTPPPTPPPTPPPTPPPTPPPTPNPDA 139 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPPTPPP P Sbjct: 99 PPPPPPPPPPPPPPPTPPPTPPPTPPPTP 127 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPPTPPP P Sbjct: 97 PPPPPPPPPPPPPPPPPTPPPTPPPTP 123 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPPTPPP P Sbjct: 103 PPPPPPPPPPPTPPPTPPPTPPPTPPPTP 131 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PP PP PPPPP P PPP PPPTPPP P Sbjct: 93 PPQPPPPPPPPPPPPPPPPPPTPPPTP 119 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 P PPP PPP P P PPP PPPTPPP P I A Sbjct: 56 PTPPPTPPPTPPPTPPPTPPPTPPPPPIIPA 86 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Frame = +2 Query: 8 PPP--PPLPPPPPAPMPPPAPPPTPPPAP 88 PPP PP PPP P P PPP PPPTPPP P Sbjct: 50 PPPTFPPTPPPTPPPTPPPTPPPTPPPTP 78 [5][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 63.5 bits (153), Expect = 7e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPPLPPPPP P+PPPAPPP PPP P Sbjct: 373 PPPPPLPPPPPRPVPPPAPPPPPPPPP 399 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 PPPP+PPP P P PPP PPP PPP P + A Sbjct: 473 PPPPVPPPTPPPPPPPPPPPPPPPPPPVKA 502 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPPAP PPP PPP PP P Sbjct: 377 PLPPPPPRPVPPPAPPPPPPPPPPPPRPP 405 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAPNI 94 P PPP P+PPP PP P PPP PPP PPP P I Sbjct: 379 PPPPPRPVPPPAPPPPPPPPPPPPRPPPPPAI 410 [6][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 63.5 bits (153), Expect = 7e-09 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPPP PPPPP P PPP PPP PPP PN Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPN 138 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PNPPPPP PPPPP+P PPP+PPP+PPP+P Sbjct: 137 PNPPPPP-PPPPPSPSPPPSPPPSPPPSP 164 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP PPP PPP+P Sbjct: 97 PPPPPPPPPPPPPSPPPPPPPPPPPPPSP 125 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP PPP PPP P Sbjct: 111 PPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 PPPPP PPPPP P PPP PPP PPP P+ Sbjct: 97 PPPPPPPPPPPPPSPPPPPPPPPPPPPS 124 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP+PPPPP P PPP PPP+PPP P Sbjct: 88 PPPPPPPVPPPPPPP-PPPPPPPSPPPPP 115 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPPP PPPPP P PPP PPP PPP+P+ Sbjct: 123 PSPPPPPPPPPPPPPNPPP-PPPPPPPSPS 151 Score = 57.8 bits (138), Expect = 4e-07 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+P PPP PPP P P PPP+PPP+PPP+P Sbjct: 148 PSPSPPPSPPPSPPPSPPPSPPPSPPPSP 176 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P P PPP PPP P P PPP+PPP PPP+PN Sbjct: 184 PPPRPPPSPPPSPPPSPPPSPPPRPPPSPN 213 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP+PPP P Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP+PPP PPP P Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPP-PAPPPTPPPAP 88 P PPPPP PPPPP P PP P+PPP+PPP+P Sbjct: 131 PPPPPPPNPPPPPPPPPPSPSPPPSPPPSP 160 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPPP P PPP+PPP PPP P Sbjct: 91 PPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPP 131 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 117 PPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 152 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 180 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 156 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 184 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 172 PPPSPPPSPPPSPPPRPPPSPPPSPPPSP 200 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP PPP P Sbjct: 94 PVPPPPPPPPPPPPPPSPPPPPPPPPPPP 122 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPPPPPP 147 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 176 PPPSPPPSPPPRPPPSPPPSPPPSPPPSP 204 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP P Sbjct: 160 PPPSPPPSPPPSPPPSPPPSPPPSPPPRP 188 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP PPP+P Sbjct: 164 PPPSPPPSPPPSPPPSPPPSPPPRPPPSP 192 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP PPP+PPP+P Sbjct: 168 PPPSPPPSPPPSPPPSPPPRPPPSPPPSP 196 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP P Sbjct: 180 PPPSPPPRPPPSPPPSPPPSPPPSPPPRP 208 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPP---PTPPPAP 88 P PPPPP PPPPP P PPP PP P+PPP+P Sbjct: 125 PPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSP 156 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPA--PMPPPAPPPTPPPAP 88 P PPPPP P PPP+ P PPP+PPP+PPP+P Sbjct: 142 PPPPPPPSPSPPPSPPPSPPPSPPPSPPPSP 172 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+P PPP PPPP P PPP PPP PPP+P Sbjct: 83 PSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPP-PPPAPMPPPAPPPTPPPAP 88 P PPPPP PP P P P PPP+PPP+PPP+P Sbjct: 139 PPPPPPPPPPSPSPPPSPPPSPPPSPPPSP 168 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP P PPPPP P+PPP PPP PPP P Sbjct: 80 PLPPSPSPPPPPPPPVPPPPPPPPPPPPP 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PP+P PPP PPP PP P Sbjct: 71 PPPPPPPQPPLPPSPSPPPPPPPPVPPPP 99 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PP PPP P Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPP 132 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PP PP PPPPP P PP PPP PPP P+ Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPPPPS 149 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PP PPP P Sbjct: 90 PPPPPVPPPPPPPPPPPPPPSPPPPPPPP 118 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P P P PPP PPP P Sbjct: 93 PPVPPPPPPPPPPPPPPSPPPPPPPPPPP 121 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PP PPP P Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPPPP 146 [7][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 63.5 bits (153), Expect = 7e-09 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDL 109 P PPPPP PPPPP P PPP PPP PPP P N +D+ Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCNLWDV 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [8][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PPP PPP PPP P+I L F Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKISLPF 66 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [9][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 63.5 bits (153), Expect = 7e-09 Identities = 32/70 (45%), Positives = 39/70 (55%), Gaps = 12/70 (17%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLL----------FSASP--ANLRET 145 P PPPPPLPPPPP P PPP PPP PPPA ++ L +S P ++L + Sbjct: 470 PPPPPPPLPPPPPPPPPPPPPPPPPPPALDVGETSSLQPPPPLPPPPYSCDPSGSDLPQD 529 Query: 146 TVVLQSIYKL 175 T VLQ + L Sbjct: 530 TKVLQYYFNL 539 [10][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 63.2 bits (152), Expect = 9e-09 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYD 106 P PPPPP PPPPP P PPP PPP PPP P++ A D Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAAD 690 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 680 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 681 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/40 (57%), Positives = 26/40 (65%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSA 121 P PPPPP PPPPP P PPP PPP PP +A+D +A Sbjct: 659 PPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAFDRTVAA 698 [11][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 63.2 bits (152), Expect = 9e-09 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PPP PPP PPP P + Y + F Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPGYLVFF 123 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 [12][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 62.8 bits (151), Expect = 1e-08 Identities = 38/115 (33%), Positives = 55/115 (47%), Gaps = 9/115 (7%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPAN--------LRETTVV- 154 P PPPPP PPPPP P PPP PPP PPP P + ++ + + AN + +T Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPVETSPKIVLAGTTANDSFILKAAMFDTDATG 529 Query: 155 LQSIYKLFEGKIACKHTLSQFICESTSPSITKHGYSTFPLPTWSHTESDAKAIRF 319 +Q+ K F G + F+ S+T G+S TW H +++ + F Sbjct: 530 VQASIKSFGGASGWSSNNNDFV------SLT--GWSKGSSFTWDHDDANDAHVGF 576 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPPP PPPPP P PPP PPP PPP P Sbjct: 467 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 [13][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLR 139 PPPPP PPPPP P PPP PPP PPP P DL +P +LR Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDLAGGNAPQHLR 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 [14][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 62.4 bits (150), Expect = 2e-08 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP PPP+PPP P Sbjct: 33 PSPPPPPPPPPPPSPPPPPPPPPSPPPLP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLL 112 P+PPPPP PPP P P+PP PPP+PPP+P ++ LL Sbjct: 45 PSPPPPPPPPPSPPPLPPWGPPPSPPPSPPLHVQGLL 81 [15][TOP] >UniRef100_A3WBS5 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBS5_9SPHN Length = 378 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPP-PAPNINAYDLLF 115 P PPPPP PPPPP P+PPPAPPP PP PA N Y + F Sbjct: 234 PPPPPPPPPPPPPPPLPPPAPPPPPPAPACNTGPYIVFF 272 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPP P Sbjct: 232 PPPPPPPPPPPPPPPPPLPPPAPPPPP 258 [16][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP PN Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PPP P N Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PPP P N Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP NI Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPP 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 2/30 (6%) Frame = +2 Query: 5 NPPPP--PLPPPPPAPMPPPAPPPTPPPAP 88 +PPPP P PPPPP P+PPP PPP PPP P Sbjct: 15 DPPPPHCPPPPPPPPPLPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+ PPPP PPPP P PPP PPP PPP P Sbjct: 19 PHCPPPPPPPPPLPPPPPPPPPPPPPPPP 47 [17][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/49 (55%), Positives = 28/49 (57%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETT 148 P PPPPP PPPPP P PPP PPP PPP P + PA LR T Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPAPLRRDT 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 [18][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPPPPP P PPP PPP PPP P Sbjct: 81 PLPPPPPLPPPPPLPPPPPPPPPLPPPPP 109 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPPLPPPPP P PPP PPP PPP P Sbjct: 77 PPPPPLPPPPPLPPPPPLPPPPPPPPP 103 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPPPPP P PPP PPP PPP P Sbjct: 97 PPPPPPPLPPPPPLP-PPPPPPPLPPPLP 124 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPPPPP P P P PPP PPP P Sbjct: 87 PLPPPPPLPPPPPPPPPLPPPPPLPPPPP 115 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/28 (78%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPA-PMPPPAPPPTPPP 82 P PPPPPLPPPPP P+PPP PPP PPP Sbjct: 103 PLPPPPPLPPPPPPPPLPPPLPPPLPPP 130 [19][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP PN Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PPP P N Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PPP P N Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP NI Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+ PPPP PPPPP P PPP PPP PPP P Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPP PPPPP P PPP PPP PPP P Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPP 42 [20][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP+PPP PPP P Sbjct: 219 PSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP+PPP PP P Sbjct: 237 PSPPPPPPPPPPPSPPPPPSPPPPSPPLP 265 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP+P PPP+PPP PPP P Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPPPPP 235 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP PPP P P P Sbjct: 225 PSPPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP+P Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPP P P PPP PPP+PPP P+ Sbjct: 227 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPS 256 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP P P P Sbjct: 231 PPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+P PPP PPPPP+P PPP PPP P P P Sbjct: 213 PSPSPPPSPPPPPSPPPPPPPPPPPSPPP 241 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPP P PPP P P PPP PPP+PPP P Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP P P PPP+P Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPPSP 257 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP P P P PPP PPP P+ Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 250 [21][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP PN Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 67 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PPP P N Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 67 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PPP P N Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 68 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP NI Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+ PPPP PPPPP P PPP PPP PPP P Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPP PPPPP P PPP PPP PPP P Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPP 42 [22][TOP] >UniRef100_Q5CS67 Signal peptide containing large protein with proline stretches n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CS67_CRYPV Length = 1884 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP+PPP+P Sbjct: 1545 PPPPPPPPPPPPPPPPPPPSPPPSPPPSP 1573 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPP P PPP+ PP+PPP+P Sbjct: 1420 PPPPPHSPPPPPPPPPPSSPPSPPPSP 1446 [23][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPPAP + Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPAPYV 70 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [24][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PPP PPP P Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPP 186 Score = 61.2 bits (147), Expect = 3e-08 Identities = 37/83 (44%), Positives = 45/83 (54%), Gaps = 4/83 (4%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP---NINA-YDLLFSASPANLRETTVVLQSIY 169 P+PPPPP PPPPP P PPP PPP PPP P + NA + A + TV +I Sbjct: 172 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNARLKIALKAIRIFQAKITVDPFNIA 231 Query: 170 KLFEGKIACKHTLSQFICESTSP 238 K ++G CK F+C ST P Sbjct: 232 KGWKGNNPCK--FKGFVC-STVP 251 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 166 PPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPPP P PPP P PPP PPP+PPP P+ Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPS 165 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP+P PPP+PPP PPP+P Sbjct: 132 PPPPPSPPPPPPPSPPPPPSPPPPPPPSP 160 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPPP PPPPP P PPP P P PPP P+ Sbjct: 144 PSPPPPPSPPPPPPPSPPPPPSPPPPPPPS 173 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP+P PPP+PPP PPP+P Sbjct: 146 PPPPPSPPPPPPPSPPPPPSPPPPPPPSP 174 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPP P PPP PPP+PPP P Sbjct: 150 PSPPPPPPPSPPPPPSPPPPPPPSPPPPP 178 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP P P PPP+P Sbjct: 138 PPPPPPPSPPPPPSPPPPPPPSPPPPPSP 166 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP P P PPP P Sbjct: 152 PPPPPPPSPPPPPSPPPPPPPSPPPPPPP 180 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPP P PPP PPP PPP P Sbjct: 164 PSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP+P PPP PPP PPP P Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPPPP 188 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPP 195 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPPP P PPP PPP PPP P Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 PPPPP PPPPP P PPP P P PPP P+ Sbjct: 132 PPPPPSPPPPPPPSPPPPPSPPPPPPPS 159 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 2/30 (6%) Frame = +2 Query: 8 PPPPPLP--PPPPAPMPPPAPPPTPPPAPN 91 PPPPP P PPPP P PPP PPP+PPP P+ Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPPPS 151 [25][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP-PPAPPPTPPPAP 88 P PPPPP PPPPPAP P PPAPPP PPPAP Sbjct: 106 PAPPPPPAPPPPPAPPPAPPAPPPPPPPAP 135 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PPPPPAP PPPAPPP PP P Sbjct: 103 PPPPAPPPPPAPPPPPAPPPAPPAPP 128 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPPAP Sbjct: 112 PAPPPPPAPPPAP-PAPPPPPPPAPPPAP 139 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPPAP PP PPP PPP P Sbjct: 125 PAPPPPPPPAPPPAPPAPPPPPPPPPPPP 153 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/28 (78%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPP 82 P PPPPP PPP PPAP PPP PPP PPP Sbjct: 127 PPPPPPPAPPPAPPAPPPPPPPPPPPPP 154 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPP-PPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP PP PPPPP P PPPAPP PPP P Sbjct: 118 PAPPPAPPAPPPPPPPAPPPAPPAPPPPPP 147 [26][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PPP PPP PPP N Y + F Sbjct: 227 PPPPPPPPPPPPPPPPPPPPPPPPPPPPCNTGPYIVFF 264 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PPP P N Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCN 256 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPP P Sbjct: 224 PPPPPPPPPPPPPPPPPPPPPPPPPPP 250 [27][TOP] >UniRef100_Q8H776 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana RepID=Q8H776_ARATH Length = 163 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGAGGG+G GGG G GGGGG+G Sbjct: 80 FGAGGGVGGGAGGGLGGGGGAGGGGGGGIG 109 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGL 4 FGAGGGVGGGAGGGIG GGG G GGGGG+ Sbjct: 118 FGAGGGVGGGAGGGIGGGGGAGGGGGGGV 146 [28][TOP] >UniRef100_Q6Z498 Os07g0511100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z498_ORYSJ Length = 359 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGAGGG+G GGG G GGGGGLG Sbjct: 155 FGAGGGVGGGAGGGVGGGGGFGGGGGGGLG 184 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G GVGGGAGGG+G GGG G GGGGGLG Sbjct: 295 FGGGAGVGGGAGGGVGGGGGFGGGGGGGLG 324 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG GGG+GGGA GG+G GGG G GGGGGLG Sbjct: 81 FGGGGGLGGGASGGVGGGGGFGGGGGGGLG 110 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G G GGGAGGG+G GGG G GGGGGLG Sbjct: 117 FGGGAGAGGGAGGGLGGGGGFGGGGGGGLG 146 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G GVGGGAGGG+G GGG G GGG GLG Sbjct: 191 FGGGAGVGGGAGGGVGGGGGFGGGGGSGLG 220 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G GVG GAGGG+G GGG G GGGGGLG Sbjct: 259 FGGGAGVGSGAGGGVGGGGGFGGGGGGGLG 288 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGG 7 FGAG GVGGGAGGG+G GGG G GGGGG Sbjct: 331 FGAGAGVGGGAGGGVGGGGGFGGGGGGG 358 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G G G GGGAGGGIG GGG G GGGGGLG Sbjct: 224 GGGFGAGGGAGGGIGGGGGFGGGGGGGLG 252 [29][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP+PPP PPP P Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPPPP 251 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP PPP PPP P Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP+P Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/34 (67%), Positives = 24/34 (70%), Gaps = 4/34 (11%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPP----TPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP+PN Sbjct: 235 PPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPN 268 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PP PP P PPP PPP PPP P+ Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPS 261 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 253 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP PPP P Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 254 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP PPP PPP PPP P Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPP P Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPP P PPPPP P PPP PPP PP P+ N Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPN 268 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PP P P P Sbjct: 241 PSPPPPPPPPPPPPPPPPPPSPPPPSPNP 269 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP+P P P Sbjct: 243 PPPPPPPPPPPPPPPPPPSPPPPSPNPPP 271 [30][TOP] >UniRef100_C1FHQ4 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FHQ4_9CHLO Length = 1159 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Frame = +2 Query: 2 PNPPPPPLPPP----PPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVL 157 P PPPPPLPPP PP+P PPPAPPP PPP P D L NL E V L Sbjct: 332 PGPPPPPLPPPSPRAPPSPNPPPAPPPPPPPPPAPRVADPLI----FNLAEVEVAL 383 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 25/32 (78%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTP--PPAPN 91 P+PPPPP PPPP P PPP PPP+P PP+PN Sbjct: 321 PSPPPPP-SPPPPGPPPPPLPPPSPRAPPSPN 351 [31][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRE 142 PPPPP PPPPP P PPP PPP PPP P++ L S A LRE Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPSVT----LSSQKMAGLRE 538 [32][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP+PPP PPP P Sbjct: 258 PSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP PPP PPP P Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPP P PPP PPP PPP+P+ Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPS 298 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PP PP P PPP PPP PPP P+ Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPS 296 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP PPP P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP PPP PPP PPP P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPP P Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPP---PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPPP P PPP PPP+PPP P Sbjct: 251 PSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP P PPP P PPP PPP PPP+P Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSP 278 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+P PPP PPPPP P PPP P P PPP P Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPP--PPPAPMPPPAPPPTPPPAP 88 P+PPP P PP PPP+P PPP PPP PPP P Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPPPPPPPP 272 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP P P+P Sbjct: 271 PPPPPPSPPPPPPPPPPPPPPPPPPSPSP 299 [33][TOP] >UniRef100_Q9Q5L3 EBNA-2 n=1 Tax=Macacine herpesvirus 4 RepID=Q9Q5L3_9GAMA Length = 605 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPPPPP P+PPP PPP PP P Sbjct: 67 PPPPPPPLPPPPPPPLPPPPPPPVQPPPP 95 [34][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLL 112 P PPPPP PPPPP P PPP PPP PPP P A + + Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAFEAREFI 344 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYD 106 PPPPP PPPPP P PPP PPP PPP P A++ Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAFE 339 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPPP PPPPP P PPP PPP PPP P Sbjct: 305 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 [35][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPP P Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPP 456 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPP P Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP+PPP Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP+PPP Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP+PPP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPP 400 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP+PPP Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP+PPP Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPP 514 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP+PPP P Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP+PPP P Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP+PPP P Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP+PPP P Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP+PPP P Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPP PPP+PPP PPP+P Sbjct: 235 PSPPPPPPPSPPPPSPPPPSPPPPPPPSP 263 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPP PPP+PPP PPP+P Sbjct: 253 PSPPPPPPPSPPPPSPPPPSPPPPPPPSP 281 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P P PPP PPP+PPP P Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP+P Sbjct: 261 PSPPPPSPPPPSPPPPPPPSPPPPPPPSP 289 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPP--APPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPP P Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPP PPP+PPP PPP+P Sbjct: 287 PSPPPPPPPSPPPPSPPPPSPPPPPPPSP 315 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP+P Sbjct: 318 PSPPPPSPPPPSPPPPPPPSPPPPPPPSP 346 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP+P Sbjct: 362 PSPPPPSPPPPSPPPPPPPSPPPPPPPSP 390 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP+P Sbjct: 416 PSPPPPSPPPPSPPPPPPPSPPPPPPPSP 444 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP+P Sbjct: 476 PSPPPPSPPPPSPPPPPPPSPPPPPPPSP 504 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP PPP+P Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP PPP+P Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 354 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP PPP+P Sbjct: 370 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP PPP+P Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 452 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP PPP+P Sbjct: 484 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPPP+P PP PPP+PPP P Sbjct: 230 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 259 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPPP+P PP PPP+PPP P Sbjct: 248 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 277 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLP-PPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPPP+P PP PPP+PPP P Sbjct: 305 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPP 334 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP+P PPP P P PPP P+ Sbjct: 430 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 459 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP+P PPP P P PPP P+ Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 467 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPP P PPPPP+P PPP P P PPP P+ Sbjct: 266 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 296 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P+PPPP PPP PP P PPP PPP+PPP P Sbjct: 313 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPP P PPPPP+P PPP P P PPP P+ Sbjct: 323 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 353 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 338 PPPPPPPSPPPPPPPSPPPPSPPPPSPPP 366 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P+PPPP PPP PP P PPP PPP+PPP P Sbjct: 357 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPP P PPPPP+P PPP P P PPP P+ Sbjct: 367 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 397 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 382 PPPPPPPSPPPPPPPSPPPPSPPPPSPPP 410 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P+PPPP PPP PP P PPP PPP+PPP P Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPP P PPPPP+P PPP P P PPP P+ Sbjct: 421 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 451 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPP 480 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P+PPPP PPP PP P PPP PPP+PPP P Sbjct: 471 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPP P PPPPP+P PPP P P PPP P+ Sbjct: 481 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 511 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 496 PPPPPPPSPPPPPPPSPPPPSPPPPSPPP 524 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPP 82 P PPPPP PPPP P P PPP PPP+PPP Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPPPSPPP 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPP 82 P PPPPP PPPP P P PPP PPP+PPP Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPP 317 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAPNINAY 103 P+PPPP P PPPPP+P PP PPP+PPP + Y Sbjct: 530 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPCQVCVY 564 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/32 (65%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP---PPAPPPTPPPAP 88 P PPPPP PPPP P P PP+PPP PPP+P Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 338 [36][TOP] >UniRef100_Q0WQG4 Putative uncharacterized protein At1g05135 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q0WQG4_ARATH Length = 153 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGG+GGGAGGG+G GGG G GGGGGLG Sbjct: 78 FGAGGGLGGGAGGGLGGGGGAGGGGGGGLG 107 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGG GGG G GGGGG GGGGG+G Sbjct: 40 FGAGGGVGGGVGGGAGGGGGGGGGGGGGVG 69 [37][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPAN 133 P PPPPP PPPPP P PPP PPP PPP P ++L +PAN Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEIL--PAPAN 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 [38][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/42 (54%), Positives = 27/42 (64%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P PPP PPP PPP P + ++ + P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [39][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 P PPPPP PPPPP P PPP PPP PPP P + A Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRA 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P AP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPLRAP 42 [40][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PPP PPP P Sbjct: 378 PSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP PPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPP 388 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP PPP PPP P Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPP P Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPPPP 384 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 386 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPP 387 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 362 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 390 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP PPP P Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 391 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP PPP PPP PPP P Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 367 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPP P Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPP 396 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PP P PPP PPP PPP P Sbjct: 369 PPPPPPPPPPSPPPPPPPPPPPPPPPPPP 397 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPP 401 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPPP P PPP PPP PPP P Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 376 PPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP PPPPP P PPP PPP P PA Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPCPA 412 [41][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP P++ Sbjct: 259 PPPPPPPPPPPPPLPPPPPPPPPLPPPPPSL 289 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 262 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P+PPP PPP P P P Sbjct: 257 PPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 [42][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P PAPPPTPPP P Sbjct: 1932 PPPPPPPPPPPPPPPPPTPAPPPTPPPPP 1960 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1936 PPPPPPPPPPPPPTPAPPPTPPPPPPPPP 1964 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 1942 PPPPPPPTPAPPPTPPPPPPPPPPPPPPP 1970 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PP AP Sbjct: 1948 PTPAPPPTPPPPPPPPPPPPPPPPPPSAP 1976 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP PAP P P PPP PPP P Sbjct: 1938 PPPPPPPPPPPTPAPPPTPPPPPPPPPPP 1966 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPP---PAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P P PPP PPP PPP P Sbjct: 1937 PPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPP 1968 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPP P P PPP PPP PPP P Sbjct: 1944 PPPPPTPAPPPTPPPPPPPPPPPPPPPPP 1972 [43][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLL 112 P PPPPP PPPPP P PPP PPP PPP P A + + Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAYEAREFI 296 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYD 106 +PPPPP PPPPP P PPP PPP PPP P AY+ Sbjct: 258 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAYE 291 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PPP PPP PPPA + + F Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPAYEAREFIVYF 299 [44][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPP P Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP+PPP PPP+P Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSP 513 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPP P PPP PPP PPP P Sbjct: 503 PSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP P P PPP P Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP+PPP PPP P Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP+P PPP PPP PPP P Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PP PP PPPPP P PPP PPP PPP P+ Sbjct: 508 PPPPSPPPPPPPPPPPPPPPPPPPPPPGPS 537 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 506 PPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PPP P P+P Sbjct: 511 PSPPPPP-PPPPPPPPPPPPPPPPPGPSP 538 [45][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PPP PPP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP P + Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYV 409 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PP PP PPPPP P PPP PPP PPP P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPP----PTPPPAP 88 P PPPPP PPPPP P PPP PP P+PPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 [46][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP PPP P Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPP 237 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP PPP P Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP PPP P P P Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP PPP P P P Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP+PPP PPP Sbjct: 233 PPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP PPP P P P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPP 231 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP+P Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP+P Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPP-PTPPPAP 88 P+PPPPP PPPPP+P PPP PP P+PPP P Sbjct: 239 PSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP+PPP P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPP 233 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP+PPP P Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP+PPP P Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/41 (56%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP-APNINAYDLLFSA 121 P+PPPPP P PP P PPP+PPP PPP P +L F+A Sbjct: 262 PSPPPPPPSPSPPPPPPPPSPPPAPPPFVPGFFDCELCFAA 302 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPP PPPPP P PP PPP PPP+P+ Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPPSPS 263 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP P P P PPP PPP P+ Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 240 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP P P P PPP PPP P+ Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 252 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPP P PPP PP PPP P+ Sbjct: 232 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPS 261 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP P P PPP P Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/42 (54%), Positives = 24/42 (57%), Gaps = 13/42 (30%) Frame = +2 Query: 2 PNPPPPPLPPPPPAP-------------MPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPPAP Sbjct: 245 PPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAP 286 [47][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI---NAYDLLFSAS-PANLRE 142 P PPPPP PPPPP P PPP PPP PPP P + LF+ P +LRE Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLSALFARPVPRDLRE 120 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [48][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P PPP PPP PPP P ++ A P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQADP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 [49][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PPP PPP PPP P + F Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPRFTTRGVSF 158 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 146 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPP---PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPPP P PPP PPP PPP P Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPP 140 [50][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 305 PPPPPPPPPPPPPCPPPPPPPPPCPPPCP 333 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPCPPPCPPPPP 292 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 260 PCPPPPPPPPPPPPPPPPPPPPPCPPPCP 288 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 313 PPPPPCPPPPPPPPPCPPPCPPPCPPPCP 341 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 254 PPPCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 268 PPPPPPPPPPPPPPPCPPPCPPP-PPPCP 295 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 291 PPPCPPPPPPPPPCPPPPPPPPPPPPPCP 319 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 297 PPPPPPPCPPPPPPPPPPPPPCPPPPPPP 325 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 309 PPPPPPPPPCPPPPPPPPPCPPPCPPPCP 337 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPPPPP 317 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 299 PPPPPCPPPPPPPPPPPPPCPPPPPPPPP 327 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPP P Sbjct: 317 PCPPPPPPPPPCPPPCPPPCPPPCPPPPP 345 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 256 PCPPPCPPPPPPPPPPPPPPPPPPPPPCP 284 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 295 PPPPPPPPPCPPPPPPPPPPPPPCPPPPP 323 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 303 PCPPPPPPPPPPPPPCPPPPPPPPPCPPP 331 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP-PPAPPPTPPPAP 88 P PPPPP PPPPP P P PP PPP PPP P Sbjct: 270 PPPPPPPPPPPPPCPPPCPPPPPPCPPPPP 299 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPP P P PPP PPP PPP P Sbjct: 248 PPPPPCPPPCPPPCPPPPPPPPPPPPP 274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%), Gaps = 6/35 (17%) Frame = +2 Query: 2 PNPPPPPLPPPPP------APMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 269 PPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPP 303 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPP P Sbjct: 321 PPPPPPPCPPPCPPPCPPPCPPP-PPPCP 348 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 22/36 (61%), Gaps = 7/36 (19%) Frame = +2 Query: 2 PNPPPPPL-------PPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 274 PPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPP 309 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 22/38 (57%), Gaps = 9/38 (23%) Frame = +2 Query: 2 PNPPPPPLPPP---------PPAPMPPPAPPPTPPPAP 88 P PPPPP PPP PP P PPP PPP PPP P Sbjct: 276 PPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPP 313 [51][TOP] >UniRef100_UPI0001923DA0 PREDICTED: similar to predicted protein n=1 Tax=Hydra magnipapillata RepID=UPI0001923DA0 Length = 1853 Score = 60.5 bits (145), Expect = 6e-08 Identities = 39/106 (36%), Positives = 51/106 (48%), Gaps = 2/106 (1%) Frame = +2 Query: 8 PPPP--PLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVLQSIYKLFE 181 PPPP PLPPPPP P PPP PPP PPP+P + L S+ + E++V L+ + Sbjct: 1392 PPPPHLPLPPPPPPPPPPPPPPPPPPPSPPLQIPFPLSSSGAMPIIESSVYLEQLTTPPP 1451 Query: 182 GKIACKHTLSQFICESTSPSITKHGYSTFPLPTWSHTESDAKAIRF 319 I + LS + S SI + G P S T + RF Sbjct: 1452 LDIQTAYGLSPSV--SDDSSINEDGGDWTPYSVCSTTCGRGEKKRF 1495 [52][TOP] >UniRef100_UPI0000DC1294 UPI0000DC1294 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DC1294 Length = 90 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPP-PTPPPAP 88 P PPPPP PPPPPAP PPPAPP P PPPAP Sbjct: 54 PAPPPPPDPPPPPAPPPPPAPPAPPPPPAP 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 3/30 (10%) Frame = +2 Query: 2 PNPPPPPLPPP---PPAPMPPPAPPPTPPP 82 P+PPPPP PPP PPAP PPPAPP PPP Sbjct: 60 PDPPPPPAPPPPPAPPAPPPPPAPPAPPPP 89 [53][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPA 130 P PPPPP PPPPP P PPP PPP PPPA +A +PA Sbjct: 62 PTPPPPPPPPPPPPPPPPPPPPPPPPPAAKPSAPPAPAPVTPA 104 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/57 (42%), Positives = 30/57 (52%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVLQSIYK 172 P PPPPP PPPPP P PPP PPP P P+ + +P +E +Q + K Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPAAKPSAPPAPAPVTPAPEVAKEIPEPVQEVVK 120 [54][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 260 PPPPPPPSPPPPPPPSPPPPPPPRPPPPP 288 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP+PPP Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSPPP 294 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP+PPP P Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPPPPP 280 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPPP+P PPP+PPP PPP P Sbjct: 323 PSPPPPSPPPPPPPSPPPPPSPPPPPPPRP 352 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAPN 91 P PPPPP PPPP P P PPP PPP+PPP P+ Sbjct: 312 PPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPS 343 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP+P Sbjct: 248 PSPPPPSPPPPSPPPPPPPSPPPPPPPSP 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPP PPP+PPP PPP+P Sbjct: 310 PSPPPPPPPRPPPPSPPPPSPPPPPPPSP 338 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P+PPPPP P PPP P PPP PPP PPP Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPPPRPPP 354 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PP P P P Sbjct: 336 PSPPPPPSPPPPPPPRPPPPSPPPPSPPP 364 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP P Sbjct: 360 PSPPPPSPPPPSPPPPPPPSPPPPPPPRP 388 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP P Sbjct: 391 PSPPPPSPPPPSPPPPPPPSPPPPPPPRP 419 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPP PPPPP P PPP PPP PPP Sbjct: 364 PPSPPPPSPPPPPPPSPPPPPPPRPPP 390 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPP PPPPP P PPP PPP PPP Sbjct: 395 PPSPPPPSPPPPPPPSPPPPPPPRPPP 421 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLP-PPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPPP+P PP PPP+PPP P Sbjct: 378 PSPPPPPPPRPPPPSPPPPSPPPPSPPPPP 407 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P+PPPP PPP PP P PPP PPP+PPP P Sbjct: 243 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 272 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP PPP P Sbjct: 256 PPPSPPPPPPPSPPPPPPPSPPPPPPPRP 284 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP+P PPP P P PPP P+ Sbjct: 262 PPPPPSPPPPPPPSPPPPPPPRPPPPPPPS 291 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 276 PPPPPPPRPPPPPPPSPPPPSPPPPSPPP 304 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP P P PPP P Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPSPPPPPPP 350 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP PP PPP+P Sbjct: 330 PPPPPPPSPPPPPSP-PPPPPPRPPPPSP 357 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P+PPPP PPP PP P PPP PPP+PPP P Sbjct: 355 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 384 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 372 PPPPPPPSPPPPPPPRPPPPSPPPPSPPP 400 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/36 (61%), Positives = 23/36 (63%), Gaps = 7/36 (19%) Frame = +2 Query: 2 PNPPPPPLPPPP-------PAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P P PPP PPP+PPP P Sbjct: 380 PPPPPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPP 415 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 403 PPPPPPPSPPPPPPPRPPPPSPPPPSPPP 431 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPP-PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPPP P PP PPP+PPP P Sbjct: 305 PSPPPPSPPPPPPPRPPPPSPPPPSPPPPP 334 [55][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 60.5 bits (145), Expect = 6e-08 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPP P P PPP+PPP+PPP+P Sbjct: 854 PSPPPPPNPPPAPTPPPPPSPPPSPPPSP 882 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPP--PTPPPAPN 91 P+PPPPP PPPP+P PPP+PP P+PPP PN Sbjct: 830 PSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPN 861 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P P PPP PPPPP+P PPP+PPP+P P P+ N Sbjct: 874 PPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSN 905 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/38 (60%), Positives = 27/38 (71%), Gaps = 8/38 (21%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPP--------PAPPPTPPPAPN 91 PNPP PP PPPPP+P PP P+PPP+PPPAP+ Sbjct: 818 PNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPS 855 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PP PP PPPPP+P PPP PPP+PPP PN Sbjct: 791 PPPPLPPSPPPPPSP-PPPPPPPSPPPPPN 819 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 PNPPP P PPPPP+ PPP+PPP+PPP P+ Sbjct: 860 PNPPPAPTPPPPPS--PPPSPPPSPPPPPS 887 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP P P PPP+P Sbjct: 866 PTPPPPPSPPPSPPPSPPPPPSPPPPPSP 894 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTP--PPAPN 91 P+PPPPP PP PP+P PPP+PPP P PP P+ Sbjct: 812 PSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPS 843 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP+PPP P P P Sbjct: 806 PPPPPPPSPPPPPNPPTPPSPPPPPSPPP 834 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP P PPP P PPPAP P PPP+P Sbjct: 846 PPPSPPPAPSPPPPPNPPPAPTPPPPPSP 874 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/32 (65%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAP--PPTPPPAPN 91 P PP PP PPPPP+P PPP P PP+PPP P+ Sbjct: 800 PPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPS 831 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/32 (65%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPP--PTPPPAPN 91 P+P PPP PPP P+P PPP PP PTPPP P+ Sbjct: 842 PSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPS 873 [56][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP PPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PPP PPP PPP P Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P+PPPPP PPPPP P PPP PPP PPP Sbjct: 275 PSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPP P PPPPP P PPP PPP PPP P+ Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPS 276 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PPP P P P Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPP-PPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPP PP PPPPP P PPP+PPP PPP P Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPP 261 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP+P PPP PPP PPP P Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP+P Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPP P Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P P PPP PPPPP P PPP PPP PPP P + Sbjct: 273 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPV 303 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPPAP 88 P+PPPPP PPPP P P PPP PPP PPP P Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP PPP P Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP PPP PPP PPP P Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPP P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PP P PPP PPP PPP P Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPPP P PPP PPP PPP P Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPP---PPAPMPPPAPPPTPPPAP 88 P PPPPP PPP PP P PPP+PPP+PPP P Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPP 257 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PP P+ Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPVYPD 306 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPP---PPLPPPPPAPMPPPAPPPTPPPAP 88 PN PP PP PPPPP P PPP+PPP PPP P Sbjct: 215 PNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPP 246 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P PPP PPP PPP P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268 [57][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP P I Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPI 75 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 NPPPPP PPPPP P PPP PPP PPP P Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P PPP PPP PPP I + + P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPIKLIASIPFTWEEKP 89 [58][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP P + Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQL 84 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 [59][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP NI Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPLPPPPRNI 105 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDL 109 P PPPPP PPPPP P PPP PPP P P P N L Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPL 108 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PP PP PPPPP P PPP PPP PPP P Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPP 50 [60][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLL----------FSASP--ANLRET 145 P PPPPP PPPPP P PPP PPP PPPA ++ L +S P ++L + Sbjct: 841 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLPQD 900 Query: 146 TVVLQSIYKL 175 T VLQ + L Sbjct: 901 TKVLQYYFNL 910 [61][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLL----------FSASP--ANLRET 145 P PPPPP PPPPP P PPP PPP PPPA ++ L +S P ++L + Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLPQD 978 Query: 146 TVVLQSIYKL 175 T VLQ + L Sbjct: 979 TKVLQYYFNL 988 [62][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 12/70 (17%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLL----------FSASP--ANLRET 145 P PPPPP PPPPP P PPP PPP PPPA ++ L +S P ++L + Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLPQD 978 Query: 146 TVVLQSIYKL 175 T VLQ + L Sbjct: 979 TKVLQYYFNL 988 [63][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP P I Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPFI 301 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 [64][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP PPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPP+P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSP 90 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 74 PPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 72 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAY 103 P PPPPP PPPPP P PP PPP PPP +A+ Sbjct: 73 PPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAW 106 [65][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPRPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPRPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPRPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPRPPPPPPPPPPPPPPPPPPPPPPPLP 51 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 17 PLPPPPPPPRPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +2 Query: 14 PPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPLPPPPP P PPP PPP PPP P Sbjct: 15 PPPLPPPPPPPRPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPP P PPPPP P PPP PPP PPP P Sbjct: 15 PPPLPPPPPPPRPPPPPPPPPPPPPPP 41 [66][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPPPPP P PP PPP+PPP P Sbjct: 207 PPPPPPPLPPPPPPPPPPSPPPPSPPPPP 235 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPPPP PPP+PPP PPP+P Sbjct: 224 PSPPPPSPPPPPPPSPPPPSPPPPPPPSP 252 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/28 (75%), Positives = 24/28 (85%), Gaps = 1/28 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPP 82 P+PPPPP PPP PP P PPP+PPP+PPP Sbjct: 2668 PSPPPPPSPPPSPPPPSPPPSPPPSPPP 2695 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PP PP P PPP PPP+PPP Sbjct: 215 PPPPPPPPPPSPPPPSPPPPPPPSPPP 241 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PP PP P PPP PPP+PPP P Sbjct: 229 PSPPPPP-PPSPPPPSPPPPPPPSPPPPP 256 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAPNI 94 P+PPPPP PPPP P P+PPP PP PPP P I Sbjct: 1184 PSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLI 1216 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/28 (75%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPP 82 P PPPPP PPPP P P PPP+PPP PPP Sbjct: 231 PPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP PPPTPPP+P Sbjct: 2270 PSPPPPSPPPPTPPPSPPP-PPPTPPPSP 2297 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPA-PPPTPPPAPNINAYD 106 P+PPPP PP PP P PPP+ PPP+PPP P + +D Sbjct: 2558 PSPPPPSPPPSPPPPSPPPSPPPPSPPPYPPCHEFD 2593 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP+PPP PP P Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPP 234 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P+PPPPP PPPP P PP PPP+PPP Sbjct: 1173 PSPPPPPSPPPPSPPPPPSPPPPSPPP 1199 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/32 (65%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPP---PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPP+P PP PPPTPPP+P Sbjct: 2255 PSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSP 2286 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/31 (70%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPA-PPPTPPPAP 88 P+PPPP PPP PPAP PPP+ PPP+PPP+P Sbjct: 2750 PSPPPPSPPPPLPPAPSPPPSPPPPSPPPSP 2780 [67][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP--NINAYDLLFSASPANL 136 P PPPPP PPPPP P PPP PPP PPP N Y + F+ +N+ Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPPTTPCNTGPYIVFFNWDESNI 268 [68][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP P+ Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPEPPPQPD 370 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP----APNINAYD 106 P PPPPP PPPPP P PPP PPP P P AP N+ + Sbjct: 345 PPPPPPPPPPPPPPPPPPPEPPPQPDPPVTTAPGSNSVE 383 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP P P P P P + Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPEPPPQPDPPV 373 [69][TOP] >UniRef100_B4RDQ2 OmpA family protein n=1 Tax=Phenylobacterium zucineum HLK1 RepID=B4RDQ2_PHEZH Length = 410 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 PPPPP PPPPP P PPP PPP PPPAP A Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPAPAYEA 301 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PPP PPP P PA + + F Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPAPAYEAKQFIVYF 308 [70][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP PPP PPP P Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPRPCP 68 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPRPCPPPPPPPPP 76 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP PPP P Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPP 82 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 64 PRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPRPCP 106 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPP 72 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 50 PPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPRPCPPPPP 110 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPRPCPPP 108 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP PPPPP P PPP P P PPPA Sbjct: 84 PPPPPPPPPPPPPPPPPPPRPCPPPPPA 111 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPP---PAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P P PPP PPP PPP P Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPP---PLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP P PPPPP P PPP PPP PPP P Sbjct: 59 PPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 [71][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPPTPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPP 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPAN 133 P PPPPP PPPPP P PPP P P PPP P D +A N Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPKSAAKDIN 88 [72][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPPTPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPP 71 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPAN 133 P PPPPP PPPPP P PPP P P PPP P D +A N Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPKSAAKDIN 88 [73][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP-NINAYDLLF 115 P PPPPP PPPPP P PPP PPP P PAP N Y + F Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPAPEPAPCNTGPYIVFF 272 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPPAP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPAP 258 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPP 82 PPPPP PPPPP P PPP PPP PPP Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPP 255 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PPPPP P PPP PPP PPP P Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPPP 256 [74][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 250 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP+PPPPP P PPP PPP PPP+P Sbjct: 239 PRPPPPPMPPPPPPP-PPPPPPPPPPPSP 266 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP+PPP PPP P Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PPP P Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP PPP P Sbjct: 249 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP PPP PPP PPP P Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPAN 133 P PPPPP PPP P P PPP PPP PP P + + SP + Sbjct: 254 PPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSPCD 297 [75][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPPTPPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPTPPPPP 445 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PP P+ Sbjct: 421 PPPPPPPPPPPPPPPPPPPTPPPPPPRPPS 450 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPTPPPPPPRP 448 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/39 (53%), Positives = 25/39 (64%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFS 118 P PPPPP PPPPP P PPP PP+PPP + ++ S Sbjct: 427 PPPPPPPPPPPPPTPPPPPPRPPSPPPVEKVTVNPIVRS 465 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PPP PP+P Sbjct: 423 PPPPPPPPPPPPPPPPPTPPPPPPRPPSP 451 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PP PPP PP P + Sbjct: 424 PPPPPPPPPPPPPPPPTPPPPPPRPPSPPPV 454 [76][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 60.1 bits (144), Expect = 8e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P+PPP PP PPP+P Sbjct: 1211 PSPPPPPPPPPPPPPLPPPPSPPPPPPSP 1239 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/30 (73%), Positives = 26/30 (86%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P+PP PP PPP PP+P PPP+PPP+PPPAP Sbjct: 1358 PSPPSPPSPPPSPPSPPPPPSPPPSPPPAP 1387 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPPPP P PPP+PPP PP P Sbjct: 1219 PPPPPPPLPPPPSPPPPPPSPPPPSPPPP 1247 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PP P PPP PP PPP+P Sbjct: 1216 PPPPPPPPPPLPPPPSPPPPPPSPPPPSP 1244 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPPP P PP PPP+PPP P Sbjct: 1208 PPPPSPPPPPPPPPPPPPLPPPPSPPPPP 1236 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP PP P Sbjct: 1213 PPPPPPPPPPPPPLP-PPPSPPPPPPSPP 1240 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/31 (70%), Positives = 24/31 (77%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPP-PPPLPP-PPPAPMPPPAPPPTPPPAP 88 P+PP PPP PP PPP P PPP+PPP PPP P Sbjct: 1361 PSPPSPPPSPPSPPPPPSPPPSPPPAPPPMP 1391 [77][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PPP P + Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 75 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P PPP PPP PPP I + + P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPVKLIASIPFTWEEKP 89 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 NP PPP PPPPP P PPP PPP PPP P Sbjct: 42 NPAPPPPPPPPPPPPPPPPPPPPPPPPP 69 [78][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP P+ Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPS 530 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPPP PPPPP P PPP PPP PPP P Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 [79][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYD 106 P PPPPP PPPPP P PPP PPP PPP P D Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 [80][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP P+ Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 [81][TOP] >UniRef100_P09789 Glycine-rich cell wall structural protein 1 n=1 Tax=Petunia x hybrida RepID=GRP1_PETHY Length = 384 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 4/34 (11%) Frame = -3 Query: 90 FGAGGGVGGGAGGG----IGAGGGGGSGGGGGLG 1 FGAGGGVGGGAGGG +G GGGGGSGGGGG+G Sbjct: 193 FGAGGGVGGGAGGGLGGGVGGGGGGGSGGGGGIG 226 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGA GG+G GGG G GGGGG+G Sbjct: 277 FGAGGGVGGGAAGGVGGGGGFGGGGGGGVG 306 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGAGGG+ GGGGG+GGGGG+G Sbjct: 315 FGAGGGVGGGAGGGL--GGGGGAGGGGGIG 342 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGG GGG G GGGGG+GGGGGLG Sbjct: 74 GAGGGAGGGLGGGGGLGGGGGAGGGGGLG 102 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGG GGG GGGGG GGGGG G Sbjct: 235 FGAGGGVGGGVGGGAAGGGGGGGGGGGGGG 264 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGAG G G GGGGG GGGGG G Sbjct: 153 FGAGGGVGGGAGAGGGVGGGGGFGGGGGGG 182 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGGVGGGA GG G GGGGG GGGGGLG Sbjct: 240 GVGGGVGGGAAGGGGGGGGGGGGGGGGLG 268 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = -3 Query: 87 GAGGGVGGG--AGGGIGAGGGGGSGGGGGLG 1 GAGGG GGG GGG+G GGGGG+GGGGG+G Sbjct: 114 GAGGGAGGGLGGGGGLGGGGGGGAGGGGGVG 144 [82][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/80 (42%), Positives = 38/80 (47%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVLQSIYKLFE 181 P PPPPP PPPPP P PPP PPP PPP P LL P ++ V QS Sbjct: 423 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP------LLPPPPPPSISSFLVPPQSC--PIP 474 Query: 182 GKIACKHTLSQFICESTSPS 241 C + S+ C S PS Sbjct: 475 CSPQCAPSCSENCCSSLIPS 494 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPPP P PPP PPP PP ++ Sbjct: 146 PPPPPPPPPPPPPPPPPPPPPPPKPPKTQHV 176 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PP PP PPPPP P PPP PPP PPP P Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPPPPP 448 [83][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 882 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 883 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP AP Sbjct: 937 PPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPP 879 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 941 PPPPPPPPPPPPPPPPPPPPPPGAPPPPP 969 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 940 PPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP PPPPP P PPP PP PPPA Sbjct: 944 PPPPPPPPPPPPPPPPPPPGAPPPPPPA 971 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP APPP PP P Sbjct: 945 PPPPPPPPPPPPPPPPPPGAPPPPPPALP 973 [84][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [85][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1503 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1477 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 1505 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP 1501 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PP PP PPPPP P PPP PPP PPP P Sbjct: 1472 PPLPPPPPPPPPPPPPPPPPPPPPPPP 1498 [86][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPFQP 264 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPFQPP 265 [87][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANL 136 P PPPPP PPPPP P PPP PPP PPPA + ++ + F + L Sbjct: 219 PPPPPPPPPPPPPPPPPPPPPPPPPPPACDDVSFPVYFEWDSSTL 263 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYD 106 PPPPP PPPPP P PPP PPP PPP P A D Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPACD 248 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 PPPPP PPPPP P PPP PPP PPP P D+ F Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPACDDVSF 252 [88][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPPAP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPAP 242 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 213 PVPPPPPPPPPPPPPPPPPPPPPPPPP 239 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFS 118 P PPPPP PPPPP P PPP PPP P P Y + F+ Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPAPVCQQGPYIVFFN 254 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP PPPPP P PPP PPP PPP P Sbjct: 213 PVPPPPPPPPPPPPPPPPPPPPPPPPP 239 [89][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP+PPP P P P Sbjct: 523 PSPPPPPSPPPPPSPPPPPSPPPPPSPPP 551 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP+PPP P P P Sbjct: 529 PSPPPPPSPPPPPSPPPPPSPPPPPSPPP 557 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP+PPP P P P Sbjct: 535 PSPPPPPSPPPPPSPPPPPSPPPPPSPPP 563 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP+PPP P P P Sbjct: 541 PSPPPPPSPPPPPSPPPPPSPPPPPSPPP 569 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP+PPP P P P Sbjct: 547 PSPPPPPSPPPPPSPPPPPSPPPPPSPPP 575 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PPP+PPP P P P Sbjct: 553 PSPPPPPSPPPPPSPPPPPSPPPPPSPPP 581 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/31 (70%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAP--PPTPPPAP 88 P+PPPPP PPPPP+P PPP+P PP+PPP P Sbjct: 565 PSPPPPPSPPPPPSPPPPPSPRHPPSPPPRP 595 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTP----PPAP 88 P+PPPPP PPPPP+P PPP+PPP P PP+P Sbjct: 559 PSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSP 591 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTP-PPAP 88 P+PPPPP PPPPP+P PP+PPP P PP P Sbjct: 571 PSPPPPPSPPPPPSPRHPPSPPPRPRPPRP 600 [90][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPLPPPPP P PPP PPP PPP P Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPP PP P PPP PPP PPP P Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P+PP PPP PPP P Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPP P PPP PPP PPP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PPP PP P Sbjct: 677 PSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPPPP P PPP PPP PPP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP+P Sbjct: 681 PPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP+P Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP+PPP P Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP+PPP PPP P Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP PPP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PP+P PPP PPP PPP P Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PP PP PPPPP P PPP PPP PPP P+ Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PP P+ Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPPPPS 708 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PP P+ Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPPP P PPP PPP PPP P Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PP PP P+PPP PPP PPP P Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPP 253 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPPLPP PP P PPP PP PPP P Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLP 241 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPPPP+P PPP PPP PPP P Sbjct: 222 PSPPPPSPPPPPPSP-PPPLPPPPPPPPP 249 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PP PPP+PPP Sbjct: 685 PPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPP P PPP PPP PPP P Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 P PPPPP PPPPP P PPP PP P P P + A Sbjct: 683 PPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPA 715 [91][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPP PLPPPPP+P P P PPP+PPP+P Sbjct: 2132 PSPPPAPLPPPPPSPPPSPPPPPSPPPSP 2160 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLP-PPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPPP P+PPPAP P+PPP P Sbjct: 2053 PPPPPPPAPLPPPPPPLPPPAPSPSPPPPP 2082 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 PPPPP PPP P P PPP+PPP+PPP P+ Sbjct: 2128 PPPPPSPPPAPLPPPPPSPPPSPPPPPS 2155 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPPAP P PPP+P Sbjct: 2119 PSPPPPPSPPPPP-PSPPPAPLPPPPPSP 2146 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPP 82 PPPPPLPPP P+P PPP PPP PPP Sbjct: 2064 PPPPPLPPPAPSPSPPPPPPPWPPP 2088 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP-PPAPPPTPPPAP 88 P P PPP PPPPP+P P PPAPPP PPP P Sbjct: 2142 PPPSPPPSPPPPPSPPPSPPAPPPHPPPEP 2171 [92][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 90 PPPPPPPPPPPPPPPPPPPPPPPPPPTCP 118 [93][TOP] >UniRef100_A4S9A6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S9A6_OSTLU Length = 4076 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPA-PPPTPPPAP 88 P+PPPPP PPPPP+P PPP+ PPP+PPP+P Sbjct: 86 PSPPPPPSPPPPPSPPPPPSPPPPSPPPSP 115 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P+PPPPP PPPPP+P PPP+PPP+PPP Sbjct: 92 PSPPPPPSPPPPPSP-PPPSPPPSPPP 117 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPP PPPPP+P PP PPP+PPP Sbjct: 2086 PPSPPPPSPPPPPSPPPPSPPPPSPPP 2112 [94][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PP N++ Sbjct: 83 PPPPPPPPPPPPPPPPPPPLPPPPPPSQENLH 114 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPPP P PPP PPP PPP P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PP PPP P+ Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPS 109 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PP PP PPPPP P PPP PPP PPP P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPP 82 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAY 103 P PPPPP PPPPP P PPP P P PPP N + Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLH 114 [95][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 51 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPQQP 83 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP P P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPQQPLP 85 [96][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPPP PPPPP P PPP PPP PPP P Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 [97][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/47 (53%), Positives = 28/47 (59%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRE 142 P PPPPP PPPPP P PPP PPP PPP + FS + + RE Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRFVLERFSKTCTSSRE 74 [98][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [99][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 [100][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAY 103 P PPPPP PPPPP P PPP PPP PPP + Y Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRY 53 [101][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP PP PP+P PPPAPP PPPA Sbjct: 156 PPPPPPPPPPSPPSPQPPPAPPAAPPPA 183 [102][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 985 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1013 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 986 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1014 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPPP PPPPP P PPP PPP PPP P Sbjct: 984 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 1011 [103][TOP] >UniRef100_A3LVW7 Predicted protein n=1 Tax=Pichia stipitis RepID=A3LVW7_PICST Length = 795 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 PPPPP PPPPP P PPP PPP P PAP+++A Sbjct: 301 PPPPPGPPPPPGPPPPPGPPPPPGPAPSLSA 331 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPP---APMPPPAPPPTPPPAPNINAYDLLFSASPA 130 P PP PP PPPPP P PPP PPP PPAP+++A+ S SP+ Sbjct: 415 PPPPAPPAPPPPPINSGPPPPPPPPPNAPPAPSLSAFS---SGSPS 457 [104][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPPP PPPPP P PPP PPP PP I+ Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPRRARIH 64 [105][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP PPPPP P PPP PPP PPPA Sbjct: 335 PPPPPPPRPPPPPPPPPPPPPPPPPPPA 362 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/40 (55%), Positives = 24/40 (60%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 PPPPP P PPP P PPP PPP PPP P + + SP Sbjct: 335 PPPPPPPRPPPPPPPPPPPPPPPPPPPALKNVENPMIPSP 374 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPP PPPPP P PPP PPP PP N+ Sbjct: 336 PPPPPPRPPPPPPPPPPPPPPPPPPPALKNV 366 [106][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/31 (70%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P+P+PPP+PPP+PPP+P Sbjct: 1563 PPSPPPPLPPPPVPPSPLPPPSPPPSPPPSP 1593 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/31 (70%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P+PPP+PPP+PPP+P Sbjct: 707 PPSPPPPLPPPPLPPPPLPPPSPPPSPPPSP 737 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P+PPPP PPP PP P PPPAPPP+PPP+P Sbjct: 739 PSPPPPTPPPPAPPPPAPPPAPPPSPPPSP 768 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPP P P PPP+PPP+PPP+P Sbjct: 744 PTPPPPAPPPPAPPPAPPPSPPPSPPPSP 772 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPP P P PPP+PPP+PPP+P Sbjct: 748 PPAPPPPAPPPAPPPSPPPSPPPSPPPSP 776 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 752 PPPAPPPAPPPSPPPSPPPSPPPSPPPSP 780 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P P PPPLPPPP P P PPP+PPP+PPP+P Sbjct: 1624 PPPSPPPLPPPPLPPPPSPPPSPPPSPPPSP 1654 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 712 PPLPPPPLPPPPLPPPSPPPSPPPSPPPSP 741 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 842 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 871 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 952 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 981 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 1020 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1049 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 1111 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1140 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 1219 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1248 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPP-PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 1629 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 1658 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 837 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 867 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 947 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 977 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 1015 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 1045 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 1106 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 1136 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPLPPPP P P PPP+PPP+PPP+P Sbjct: 1214 PPLPPPPLPPPPLPPPPSPPPSPPPSPPPSP 1244 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPP PPP P P PPP+PPP+PPP+P+ Sbjct: 1634 PPLPPPPSPPPSPPPSPPPSPPPSPPPSPS 1663 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPP P P PPP+PPP+PPP+P Sbjct: 1224 PPLPPPPSPPPSPPPSPPPSPPPSPPPSP 1252 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/33 (66%), Positives = 25/33 (75%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPP----PLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PLPPP P P PPP+PPP+PPP+P Sbjct: 1569 PLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSP 1601 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPLPPP P P PPP+PPP+PPP Sbjct: 717 PPLPPPPLPPPSPPPSPPPSPPPSPPP 743 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPAP PPPAPPP+PPP+P Sbjct: 867 PPPSPPPPTPPPPAP-PPPAPPPSPPPSP 894 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPAP PPPAPPP+PPP+P Sbjct: 1045 PPPSPPPPTPPPPAP-PPPAPPPSPPPSP 1072 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPAP PPPAPPP+PPP+P Sbjct: 1136 PPPSPPPPTPPPPAP-PPPAPPPSPPPSP 1163 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPA 130 P+PPPP PPP P P PPP+PPP PP P+++ S SP+ Sbjct: 1734 PSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPS 1776 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPAP PPPAPPP PPP+P Sbjct: 737 PPPSPPPPTPPPPAP-PPPAPPPAPPPSP 764 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPP-PPPAPMPPPAPPPTPPPAP 88 P PP PPLPP PPP P PP PPPTPPP+P Sbjct: 2104 PPPPSPPLPPSPPPLPPPPVPPPPTPPPSP 2133 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P+P PPP PPP P P PPP+PPP+PPP Sbjct: 1577 PSPLPPPSPPPSPPPSPPPSPPPSPPP 1603 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPA-PPPTPPPAP 88 P+P PPP PPPP+P PPP+ PPP+PPP+P Sbjct: 676 PSPSPPPPSPPPPSPSPPPSPPPPSPPPSP 705 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P P PPP PPP P P PPP+PPP+PPP Sbjct: 756 PPPAPPPSPPPSPPPSPPPSPPPSPPP 782 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLP-PPPPAPMPPPAPPPTPPPAP 88 P+PPP P P PPPP P PP PPPTPPP+P Sbjct: 770 PSPPPSPPPSPPPPTPPPPAPPPPTPPPSP 799 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPAP PPP PPP+PPP+P Sbjct: 776 PPPSPPPPTPPPPAP-PPPTPPPSPPPSP 803 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPP-APPPTPPPAP 88 P PPPPLPPPP P P+PPP +PPP+PPP+P Sbjct: 832 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP 863 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPM-PPPAPPPTPPPAP 88 P P PPPLPPPP P P+ PPP+PPP+PPP+P Sbjct: 942 PPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSP 973 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPP-APPPTPPPAP 88 P PPPPLPPPP P P+PPP +PPP+PPP+P Sbjct: 1010 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP 1041 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPP-APPPTPPPAP 88 P PPPPLPPPP P P+PPP +PPP+PPP+P Sbjct: 1101 PPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSP 1132 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPM-PPPAPPPTPPPAP 88 P P PPPLPPPP P P+ PPP+PPP+PPP+P Sbjct: 1209 PPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSP 1240 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P P PPP PPP P P PPP+PPP+PPP Sbjct: 1228 PPPSPPPSPPPSPPPSPPPSPPPSPPP 1254 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLP-PPPPAPMPPPAPPPTPPPAP 88 P+PPP P P PPPP P PP PPPTPPP+P Sbjct: 1242 PSPPPSPPPSPPPPTPPPPAPPPPTPPPSP 1271 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPA-PPPTPPPAP 88 P+P PPP PPPP+P PPP+ PPP+PPP+P Sbjct: 1532 PSPSPPPPSPPPPSPSPPPSPPPPSPPPSP 1561 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPP-PPPLPPPPPAPMPPP--APPPTPPPAP 88 P+PP PPPLPPP P+P+PPP PPP+PPP P Sbjct: 2168 PSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHP 2199 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 24/31 (77%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPP--PPAPMPPPAPPPTPPPAP 88 P PPPPLPPP PP+P PP PPP+PPP+P Sbjct: 1720 PPNPPPPLPPPPSPPSPPPPSPPPPSPPPSP 1750 [107][TOP] >UniRef100_Q3MC83 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC 29413 RepID=Q3MC83_ANAVT Length = 387 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 325 PPPPPPPDPPPPPPPDPPPPPPPDPPPPP 353 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 333 PPPPPPPDPPPPPPPDPPPPPPPDPPPPP 361 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 341 PPPPPPPDPPPPPPPDPPPPPPPDPPPPP 369 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 349 PPPPPPPDPPPPPPPDPPPPPPPDPPPPP 377 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PPP PPP P Sbjct: 357 PPPPPPPDPPPPPPPDPPPPPPPDPPPPP 385 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPP P Sbjct: 319 PPPPPDPPPPPPPDPPPPPPPDPPPPP 345 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP P PPP P P PPP P+ Sbjct: 319 PPPPPDPPPPPPPDPPPPPPPDPPPPPPPD 348 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP P PPP P P PPP P+ Sbjct: 327 PPPPPDPPPPPPPDPPPPPPPDPPPPPPPD 356 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP P PPP P P PPP P+ Sbjct: 335 PPPPPDPPPPPPPDPPPPPPPDPPPPPPPD 364 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP P PPP P P PPP P+ Sbjct: 343 PPPPPDPPPPPPPDPPPPPPPDPPPPPPPD 372 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPP P PPPPP P PPP P P PPP P+ Sbjct: 351 PPPPPDPPPPPPPDPPPPPPPDPPPPPPPD 380 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP P P PPP P Sbjct: 359 PPPPPDPPPPPPPDPPPPPPPDPPPPPPP 387 [108][TOP] >UniRef100_B4U926 Putative uncharacterized protein n=1 Tax=Hydrogenobaculum sp. Y04AAS1 RepID=B4U926_HYDS0 Length = 231 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP TPPP P Sbjct: 65 PAPPPPPPPPPPPPPPPPPPPPETPPPPP 93 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PP PPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPETPPPPPPP 95 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPETPPPPPP 94 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P PPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPETPPPPPPP 95 [109][TOP] >UniRef100_B9SFQ6 Glycine-rich cell wall structural protein 1, putative n=1 Tax=Ricinus communis RepID=B9SFQ6_RICCO Length = 313 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGG GGG G GGGGG GGGGG G Sbjct: 129 FGAGGGVGGGVGGGAGGGGGGGGGGGGGGG 158 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGG GGG G GGGGG GGGGG G Sbjct: 214 FGAGGGVGGGIGGGAGGGGGGGGGGGGGGG 243 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGG GGG G GGGGG GGGGG G Sbjct: 172 FGAGGGVGGGLGGGPGGGGGGGGGGGGGGG 201 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGG 7 G GGGVGGGAGGG G GGGGG GGGGG Sbjct: 134 GVGGGVGGGAGGGGGGGGGGGGGGGGG 160 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGG+GGG GGG G GGGGG GGGGG+G Sbjct: 177 GVGGGLGGGPGGGGGGGGGGGGGGGGGIG 205 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGG+GGGAGGG G GGGGG GGGGG+G Sbjct: 219 GVGGGIGGGAGGG-GGGGGGGGGGGGGVG 246 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/31 (74%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = -3 Query: 87 GAGGGVGGG--AGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGG AGGG+G GGG G GGGGG+G Sbjct: 90 GAGGGLGGGGGAGGGLGGGGGAGGGGGGGIG 120 [110][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPPLPPPPP P P P PPP PPP P + Sbjct: 1217 PPPPPPPLPPPPPPPPPLPPPPPPPPPPPPV 1247 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPPLPPPPP P P P PPP PPP P Sbjct: 1209 PPPPPLPPPPPPPPPLPPPPPPPPPLP 1235 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPP PPP P Sbjct: 1211 PPPLPPPPPPPPPLPPPPPPPPPLPPPPP 1239 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPP P PPP PPP PPP P Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPPP 1243 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PPPPP P PPP PPP PPP P Sbjct: 1203 PPPPLTPPPPPLPPPPPPPPPLPPPPP 1229 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P+PPP PPP P P P Sbjct: 1209 PPPPPLPPPPPPPPPLPPPPPPPPPLPPP 1237 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = +2 Query: 2 PNPPPPPL---PPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P+PPP PPP PPP Sbjct: 1216 PPPPPPPPLPPPPPPPPPLPPPPPPPPPPP 1245 [111][TOP] >UniRef100_B4NYJ9 GE18286 n=1 Tax=Drosophila yakuba RepID=B4NYJ9_DROYA Length = 622 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPA---PPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PPP PPP PPP P + Y + Sbjct: 504 PPPPPPPPPPPPPPPPPPPTEPPPPPPPPPEPRVKKYSYFY 544 [112][TOP] >UniRef100_B3N3R7 GG25000 n=1 Tax=Drosophila erecta RepID=B3N3R7_DROER Length = 613 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/40 (57%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPP--PAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PP P PPP PPP P + Y + Sbjct: 496 PPPPPPPPPPPPPPPPPPTEPPPPPPPPPEPRVKKYSYFY 535 [113][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP PPPPP P PPP PPP PPPA Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPA 379 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPP 378 [114][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLR----------ETT 148 PPPPP PPPPP P PPP PPP PPP P I L ASP ETT Sbjct: 2406 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVASPVTTATPLFDAVTTLETT 2465 Query: 149 VVLQS 163 VL+S Sbjct: 2466 AVLRS 2470 [115][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLR----------ETT 148 PPPPP PPPPP P PPP PPP PPP P I L ASP ETT Sbjct: 2406 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVASPVTTATPLFDAVTTLETT 2465 Query: 149 VVLQS 163 VL+S Sbjct: 2466 AVLRS 2470 [116][TOP] >UniRef100_A2YLR2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YLR2_ORYSI Length = 342 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG GGG+GGGAGGG+G GGG G GGGGGLG Sbjct: 81 FGEGGGLGGGAGGGVGGGGGFGGGGGGGLG 110 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G GVGGGAGGG+G GGG G GGGGGLG Sbjct: 278 FGGGAGVGGGAGGGVGGGGGFGGGGGGGLG 307 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G G GGGAGGG+G GGG G GGGGGLG Sbjct: 117 FGGGAGAGGGAGGGLGGGGGFGGGGGGGLG 146 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGG 10 FGAGGGVGGGAGGG+G GGG G GGGG Sbjct: 155 FGAGGGVGGGAGGGVGGGGGFGGGGGG 181 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGG 7 FGAG GVGGGAGGG+G GGG G GGGGG Sbjct: 314 FGAGAGVGGGAGGGVGGGGGFGGGGGGG 341 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAG GVG GAGGG+G GGG G GGGG LG Sbjct: 242 FGAGAGVGSGAGGGVGGGGGFGGGGGGALG 271 [117][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLR----------ETT 148 PPPPP PPPPP P PPP PPP PPP P I L ASP ETT Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVASPVTTATPLFDAVTTLETT 2396 Query: 149 VVLQS 163 VL+S Sbjct: 2397 AVLRS 2401 [118][TOP] >UniRef100_Q5KAA5 Cytokinesis protein sepa (Fh1/2 protein), putative n=1 Tax=Filobasidiella neoformans RepID=Q5KAA5_CRYNE Length = 1776 Score = 58.5 bits (140), Expect = 2e-07 Identities = 42/130 (32%), Positives = 58/130 (44%), Gaps = 10/130 (7%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPP----------APPPTPPPAPNINAYDLLFSASPANLRETTV 151 P+PPPPP PPPPP P PPP PPP PPP P L + P+ + + Sbjct: 1086 PHPPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPPLTTLHHPSGPSGAHDLSG 1145 Query: 152 VLQSIYKLFEGKIACKHTLSQFICESTSPSITKHGYSTFPLPTWSHTESDAKAIRFSSVT 331 VL I +G ++ K TL I P P P+ HT + A SV+ Sbjct: 1146 VLAGI----KGGVSLKKTLGPSIPPPPPP-------PALPPPS-IHTPARAP---LGSVS 1190 Query: 332 ALIHVSEEDR 361 +L++ + + R Sbjct: 1191 SLLYGANDSR 1200 [119][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLR----------ETT 148 PPPPP PPPPP P PPP PPP PPP P I L ASP ETT Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVASPVTTATPLFDAVTTLETT 2396 Query: 149 VVLQS 163 VL+S Sbjct: 2397 AVLRS 2401 [120][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 58.5 bits (140), Expect = 2e-07 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLR----------ETT 148 PPPPP PPPPP P PPP PPP PPP P I L ASP ETT Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVASPVTTATPLFDAVTTLETT 2396 Query: 149 VVLQS 163 VL+S Sbjct: 2397 AVLRS 2401 [121][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 PPPPP PPPPP P PPP PPP PPP P + Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPPPV 166 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P+PPP PP PPPAP Sbjct: 195 PPPPPPPPPPPCPLPPPPPPCPPPPAP 221 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPPPP 165 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = +2 Query: 8 PPPPPL--PPPPPAPMPPPAPPPTPPPAP 88 PPPPP+ PPPPP P PPP PPP PPP P Sbjct: 130 PPPPPMCAPPPPPPPPPPPPPPPPPPPPP 158 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPP---PPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PPP PPPPP P PPP PPP PPP P Sbjct: 131 PPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPP 162 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPP----PTPPPAP 88 P PPPPP PPPPP P PPP PP P PPP P Sbjct: 144 PPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCP 176 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPPP---APMPPPAPPPTPPPAP 88 P PPPPP+ PPPP AP PPP PPP PPP P Sbjct: 121 PPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPP 152 [122][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 2801 PPPPPPPTPPPPPPPPPPPPPPPPPPP 2827 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P PPPP PPPPP P PPP PPP PPP +IN Sbjct: 2802 PPPPPPTPPPPPPPPPPPPPPPPPPPPQHSIN 2833 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PP PP P PPP PPP PPP P Sbjct: 2800 PPPPPPPPTPPPPPPPPPPPPPPPPPP 2826 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP P PPP P PPP PPP PPP P Sbjct: 2801 PPPPPPPTPPPPPPPPPPPPPPPPPPP 2827 [123][TOP] >UniRef100_UPI0000E20C65 PREDICTED: similar to Family with sequence similarity 44, member B n=1 Tax=Pan troglodytes RepID=UPI0000E20C65 Length = 282 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/58 (46%), Positives = 34/58 (58%), Gaps = 16/58 (27%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPP-----------APPPTPPPAPNINAYDLL-----FSASP 127 P+PPPPP PPPPP+P PPP PPP+PPP+P ++ LL +S SP Sbjct: 33 PSPPPPPPPPPPPSPPPPPPPPSPPPLPPWGPPPSPPPSPPLHVLGLLSWRRSYSRSP 90 [124][TOP] >UniRef100_Q2RTE8 Putative uncharacterized protein n=1 Tax=Rhodospirillum rubrum ATCC 11170 RepID=Q2RTE8_RHORT Length = 208 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 91 PEPPPPPPPPPPPPPPPPPPPPPEPPP 117 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P P PPP PPPPP P PPP PPP P P P ++ Sbjct: 89 PEPEPPPPPPPPPPPPPPPPPPPPPEPPPFVS 120 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P P P PPPPP P PPP PPP PPP P Sbjct: 87 PEPEPEPPPPPPPPPPPPPPPPPPPPPEP 115 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P P P PPPPP P PPP PPP PPP P Sbjct: 85 PIPEPEPEPPPPPPPPPPPPPPPPPPPPP 113 [125][TOP] >UniRef100_B0T8U3 Peptidase M56 BlaR1 n=1 Tax=Caulobacter sp. K31 RepID=B0T8U3_CAUSK Length = 596 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 7/48 (14%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPP-------PAPNINAYDLLFSASPA 130 PPPPP PPPPPAP PPP PP PP P P Y SASPA Sbjct: 381 PPPPPAPPPPPAPPPPPPAPPAPPAPPAPPAPPPEGLGYSYFRSASPA 428 [126][TOP] >UniRef100_B0SVF7 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0SVF7_CAUSK Length = 409 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLL 112 P PPPPP PPPPP P PPAPPP PPPA A + + Sbjct: 268 PPPPPPPPPPPPPPPPEPPAPPPPPPPAAAYEAREFV 304 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYD 106 PPPPP PPPPP P PPP PP PPP P AY+ Sbjct: 267 PPPPPPPPPPPPPPPPPEPPAPPPPPPPAAAYE 299 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPPP PPPPP P PPP PP PPP P Sbjct: 265 SPPPPPPPPPPPPPPPPPPEPPAPPPPP 292 [127][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP+P PP PPP+PPP P Sbjct: 90 PPPPPPPPPPPPPSPPPPSPPPPSPPPPP 118 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P P PPP PPP PPP+P Sbjct: 96 PPPPPPPSPPPPSPPPPSPPPPPPPPPPPSP 126 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP+PPP PP P Sbjct: 106 PPSPPPPSPPPPPPPPPPPSPPPPSPPPP 134 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP+P PPP+PPP PPP P Sbjct: 95 PPPPPPPPSPPPPSP-PPPSPPPPPPPPP 122 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PP P PPP PP PPP P Sbjct: 93 PPPPPPPPPPSPPPPSPPPPSPPPPPPPP 121 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P+PPPP PPP P P PPP PPP+PPP Sbjct: 102 PSPPPPSPPPPSPPPPPPPPPPPSPPP 128 [128][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANL 136 P PPPPP PPPPP P PPP PPP PP P + + F ++L Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPAKPAARQFVVYFDFDRSDL 289 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 242 PAAPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/54 (46%), Positives = 27/54 (50%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVLQS 163 P PPPPP PPPPP P PPP PPP PA F S +VV Q+ Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPAKPAARQFVVYFDFDRSDLTAEARSVVTQA 300 [129][TOP] >UniRef100_Q8L5Q3 Putative glicine-rich protein (Fragment) n=1 Tax=Cicer arietinum RepID=Q8L5Q3_CICAR Length = 138 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGGAGGG G GGGGG GGGGG+G Sbjct: 49 GAGGGTGGGAGGGFGGGGGGGFGGGGGVG 77 [130][TOP] >UniRef100_B9RYC5 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RYC5_RICCO Length = 510 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPPPP P PPP PPP PPP P Sbjct: 94 PSPPPPKHPPPPPPPSPPPPPPPPPPPPP 122 [131][TOP] >UniRef100_B9MZR3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZR3_POPTR Length = 256 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGAGGG+G G GGG+GGG G+G Sbjct: 202 FGAGGGVGGGAGGGLGGGSGGGAGGGFGVG 231 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGG 7 FGAGGGVGGG GGG G GGGGG GGGGG Sbjct: 129 FGAGGGVGGGHGGGAGGGGGGGGGGGGG 156 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G+GGG+GGGAGGG+G GGG G GGGGG+G Sbjct: 58 GSGGGLGGGAGGGVGGGGGFGGGGGGGVG 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGG GGG G GGGGG G GGG G Sbjct: 95 FGAGGGVGGGLGGGAGGGGGGGGGIGGGSG 124 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 5/35 (14%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGG-----GGGSGGGGGLG 1 FGAGGGVGGG GGG+G GG GGGSG GGG G Sbjct: 169 FGAGGGVGGGLGGGVGGGGGGGGIGGGSGHGGGFG 203 [132][TOP] >UniRef100_B9MZR2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZR2_POPTR Length = 150 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGAGGG+G G GGG+GGG G+G Sbjct: 96 FGAGGGVGGGAGGGLGGGSGGGAGGGFGVG 125 [133][TOP] >UniRef100_B9MZQ9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZQ9_POPTR Length = 252 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGAGGG+G G GGG+GGG G+G Sbjct: 167 FGAGGGVGGGAGGGLGGGSGGGAGGGFGVG 196 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGG 7 FGAGGGVGGG GGG G GGGGG GGGGG Sbjct: 93 FGAGGGVGGGLGGGAGGGGGGGGGGGGG 120 [134][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLP-PPPPAPMPPPAPPPTPPPAP 88 P PPPPPLP PPPP P PPP PPP PPP P Sbjct: 309 PPPPPPPLPSPPPPPPTPPPPPPPPPPPPP 338 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PPP PPPTPPP P Sbjct: 303 PPPSPPPPPPPPPLPSPPP-PPPTPPPPP 330 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPP P PPP PPP PP P Sbjct: 317 PSPPPPPPTPPPPPPPPPPPPPPNPPFIP 345 [135][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/49 (48%), Positives = 29/49 (59%), Gaps = 3/49 (6%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLRET 145 PPPPP PPPPP P PPP PPP PPP P ++ + + +P L T Sbjct: 2347 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPAVHPKKKVIATAPVTLTPT 2395 [136][TOP] >UniRef100_A1TG37 Putative uncharacterized protein n=1 Tax=Mycobacterium vanbaalenii PYR-1 RepID=A1TG37_MYCVP Length = 396 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP PPPPPA PPP P PTPPPA Sbjct: 230 PPPPPPPPPPPPPAQQPPPPPQPTPPPA 257 [137][TOP] >UniRef100_Q00S27 Chromosome 19 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri RepID=Q00S27_OSTTA Length = 1757 Score = 57.8 bits (138), Expect = 4e-07 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PP PP PPP P P PPP+PPP+PPP+P Sbjct: 300 PSPPAPPSPPPSPPPSPPPSPPPSPPPSP 328 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 308 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 336 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPP-PPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PPP PPP P P PPP+PPP+PPP+P Sbjct: 303 PAPPSPPPSPPPSPPPSPPPSPPPSPPPSP 332 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P P PPP PPP P P PPP+PPP+PPP Sbjct: 312 PPPSPPPSPPPSPPPSPPPSPPPSPPP 338 [138][TOP] >UniRef100_A3BK83 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BK83_ORYSJ Length = 268 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G GVGGGAGGG+G GGG G GGGGGLG Sbjct: 204 FGGGAGVGGGAGGGVGGGGGFGGGGGGGLG 233 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G GVG GAGGG+G GGG G GGGGGLG Sbjct: 168 FGGGAGVGSGAGGGVGGGGGFGGGGGGGLG 197 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGG 7 FGAG GVGGGAGGG+G GGG G GGGGG Sbjct: 240 FGAGAGVGGGAGGGVGGGGGFGGGGGGG 267 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/31 (74%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGG-GGSGGGGGLG 1 FG GGG+GGGA GG+G GGG GG GGGGG G Sbjct: 81 FGGGGGLGGGASGGVGGGGGFGGGGGGGGAG 111 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G G G GGGAGGGIG GGG G GGGGGLG Sbjct: 133 GGGFGAGGGAGGGIGGGGGFGGGGGGGLG 161 [139][TOP] >UniRef100_Q86BM9 CG33003, isoform A n=1 Tax=Drosophila melanogaster RepID=Q86BM9_DROME Length = 579 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P P PPP PPP P + Y + Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPPPEPRVKKYSYFY 501 [140][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 P PPPPP PPPPP P PPP PPP PPP + A Sbjct: 100 PPPPPPPPPPPPPPPPPPPPPPPPPPPPGSAEA 132 [141][TOP] >UniRef100_B7Z017 CG33003, isoform B n=1 Tax=Drosophila melanogaster RepID=B7Z017_DROME Length = 604 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P P PPP PPP P + Y + Sbjct: 489 PPPPPPPPPPPPPPPPTEPPPPPPPPPEPRVKKYSYFY 526 [142][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP-PPAPPPTPPPAP 88 P PPPPP PPPPPAP P PP PPPT PP P Sbjct: 234 PKPPPPPPPPPPPAPKPSPPTPPPTTPPPP 263 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 6/35 (17%) Frame = +2 Query: 2 PNPPPPPLP------PPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPPP P PPP PPP PPPAP Sbjct: 214 PPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPPAP 248 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAP---PPTPPP 82 P PPP P PPPPP P PPPAP PPTPPP Sbjct: 228 PPPPPKPKPPPPPPPPPPPAPKPSPPTPPP 257 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P P P P PPPAP P PPP P Sbjct: 202 PPPPPPPAPAPTPPPPPPPAPKPKPPPPP 230 [143][TOP] >UniRef100_B3MU38 GF21178 n=1 Tax=Drosophila ananassae RepID=B3MU38_DROAN Length = 608 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P P PPP PPP P + Y + Sbjct: 492 PPPPPPPPPPPPPPPPTEPPPPPPPPPEPRVKKYSYFY 529 [144][TOP] >UniRef100_A7SGL4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SGL4_NEMVE Length = 620 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P+P P PPP PPP+P Sbjct: 427 PCPPPPPPPPPPPCPVPCPPPPPPPPPSP 455 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPP P P PPP PPP P P P Sbjct: 429 PPPPPPPPPPPCPVPCPPPPPPPPPSPPP 457 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P P PPP PPPPP P P P PPP PPP P+ Sbjct: 425 PVPCPPPPPPPPPPPCPVPCPPPPPPPPPS 454 [145][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP PPP P Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAPNINA 100 PPPP PPPPP P PPP PPP PPP P ++A Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPPMSA 1062 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%), Gaps = 5/34 (14%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPM-----PPPAPPPTPPPAP 88 P PPPPP PPPPP PM PPP PPP PPP P Sbjct: 1045 PPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPP 1078 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 22/35 (62%), Gaps = 6/35 (17%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTP------PPAP 88 P PPPPP PPPPP P PPP PPP P PP P Sbjct: 1035 PPPPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPP 1069 [146][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/65 (47%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLR----------ETT 148 PPPPP PPPPP P PPP PPP PPP P I L A+P ETT Sbjct: 2344 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVAAPVTTATPLFDAVTTLETT 2403 Query: 149 VVLQS 163 VL+S Sbjct: 2404 AVLRS 2408 [147][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/65 (47%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLR----------ETT 148 PPPPP PPPPP P PPP PPP PPP P I L A+P ETT Sbjct: 1282 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVAAPVTTATPLFDAVTTLETT 1341 Query: 149 VVLQS 163 VL+S Sbjct: 1342 AVLRS 1346 [148][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 57.4 bits (137), Expect = 5e-07 Identities = 31/65 (47%), Positives = 33/65 (50%), Gaps = 13/65 (20%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPA---PNINAYDLLFSASPANLR----------ETT 148 PPPPP PPPPP P PPP PPP PPP P I L A+P ETT Sbjct: 2344 PPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVAAPVTTATPLFDAVTTLETT 2403 Query: 149 VVLQS 163 VL+S Sbjct: 2404 AVLRS 2408 [149][TOP] >UniRef100_Q4THH6 Chromosome undetermined SCAF2934, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4THH6_TETNG Length = 300 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 NPPP P PPPPP P PPP PPP PPP P Sbjct: 260 NPPPAPPPPPPPPPPPPPTPPPPPPPPP 287 [150][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 232 PAPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPPPP 259 [151][TOP] >UniRef100_Q9M3Y2 Glycine-rich protein n=1 Tax=Triticum aestivum RepID=Q9M3Y2_WHEAT Length = 390 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 2/32 (6%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGG--GSGGGGGLG 1 FG G G GGGAGGG+GAGGGG GSGGGGGLG Sbjct: 185 FGGGAGAGGGAGGGLGAGGGGGFGSGGGGGLG 216 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGG GGGAGGG GAGGG G G GGG G Sbjct: 81 FGAGGGAGGGAGGGFGAGGGAGGGLGGGHG 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 2/32 (6%) Frame = -3 Query: 90 FGAGGGVG--GGAGGGIGAGGGGGSGGGGGLG 1 FGAGGG G GGAGGG GAGGGGG GGGGG G Sbjct: 225 FGAGGGAGAGGGAGGGFGAGGGGGFGGGGGGG 256 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG G GVGGGAGGG+G GGG G G GGGLG Sbjct: 293 FGGGAGVGGGAGGGLGGGGGLGGGSGGGLG 322 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 2/32 (6%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSG--GGGGLG 1 FG G G GGGAGGG+G GGGGG G GGGGLG Sbjct: 113 FGGGAGAGGGAGGGLGGGGGGGFGGSGGGGLG 144 [152][TOP] >UniRef100_Q6Z142 Os07g0440100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z142_ORYSJ Length = 422 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG GGG GGG GGG+G GGGGG GGGGG G Sbjct: 79 FGGGGGFGGGGGGGLGGGGGGGLGGGGGFG 108 [153][TOP] >UniRef100_Q2R0D0 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2R0D0_ORYSJ Length = 957 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPPL P PPAP PPP PPP PPAP Sbjct: 501 PSPPPPPLAPSPPAPPPPPPPPPPCPPAP 529 [154][TOP] >UniRef100_C1N0J8 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N0J8_9CHLO Length = 2933 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/34 (64%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP--APNIN 97 P+PPPPP PPPPP P PPP PPP PP P +N Sbjct: 444 PSPPPPPFPPPPPTPSPPPFPPPEMPPFTPPGVN 477 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 4/48 (8%) Frame = +2 Query: 2 PNPPP-PPLPPPPPAPMPPP---APPPTPPPAPNINAYDLLFSASPAN 133 P+PPP PP PPPPP+P PPP +PPP+PPP P + F + AN Sbjct: 109 PSPPPSPPSPPPPPSPPPPPPNPSPPPSPPPPPLPPQWAETFPSRDAN 156 [155][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP+P+ Sbjct: 259 PPPPPPPSPPPPPPP-PPPPPPPPPPPSPS 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPP----PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPPP P PPP PPP PPP P Sbjct: 247 PSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP 279 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P+PPPPP P PPP P PPP PPP PPP Sbjct: 257 PSPPPPPPPSPPPPPPPPPPPPPPPPP 283 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP P P+P Sbjct: 260 PPPPPPSPPPPPPPPPPPPPPPPPPSPSP 288 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPPP P PPP PPP+P P P Sbjct: 262 PPPPSPPPPPPPPPPPPPPPPPPSPSPPP 290 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 7/36 (19%) Frame = +2 Query: 2 PNPPPPPLP----PPPPAPM---PPPAPPPTPPPAP 88 P+PPPPP P PPPP+P+ PPP PPP+PPP P Sbjct: 236 PSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPP 271 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PP PPPP P PPP PPP PPP P Sbjct: 254 PLPPSPPPPPPPSPPPPPPPPPPPPPPPP 282 [156][TOP] >UniRef100_A4S6G3 Predicted protein (Fragment) n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S6G3_OSTLU Length = 2146 Score = 57.4 bits (137), Expect = 5e-07 Identities = 43/134 (32%), Positives = 56/134 (41%), Gaps = 4/134 (2%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVLQSIYKLFE 181 P+PPPP PPP P P+PPP PPP+PPP ++ L N + V+L S+Y + Sbjct: 940 PSPPPPSPPPPSPPPLPPPPPPPSPPPP--VDECPTLRLVGGPNAVQNEVLLNSLY-VDP 996 Query: 182 GKIACKH---TLSQFICESTSPSITKH-GYSTFPLPTWSHTESDAKAIRFSSVTALIHVS 349 G +A +S I TS T G D A R V AL+ S Sbjct: 997 GAVATDELDGDISDAIEADTSEVDTSRVGTYRVYYRVRDSGGCDVSAERLVRVIALVPTS 1056 Query: 350 EEDRAQDFCFLQRP 391 E + C P Sbjct: 1057 EYSQLTSLCVSNIP 1070 [157][TOP] >UniRef100_A4S1Y9 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S1Y9_OSTLU Length = 1065 Score = 57.4 bits (137), Expect = 5e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 477 PTPSPPPSPPPSPPPSPPPSPPPSPPPSP 505 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 481 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 509 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 485 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 513 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 489 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 517 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 493 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 521 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 524 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 552 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 528 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 556 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 532 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 560 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 536 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 564 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 540 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 568 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 544 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 572 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPP-PPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPP PP PPP P P PPP+PPP+PPP+P Sbjct: 515 PSPPPSPPSPPPSPPPSPPPSPPPSPPPSP 544 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPP-PPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PP PPP PPP P P PPP+PPP+PPP+P Sbjct: 519 PSPPSPPPSPPPSPPPSPPPSPPPSPPPSP 548 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P P PPP PPP P P PPP+PPP+PPP P+ Sbjct: 548 PPPSPPPSPPPSPPPSPPPSPPPSPPPPPH 577 Score = 54.3 bits (129), Expect = 4e-06 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P P P PPP P P PPP+PPP+PPP+P Sbjct: 473 PTPTPTPSPPPSPPPSPPPSPPPSPPPSP 501 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAP-MPPPAPPPTPPPAP 88 P+PPP P P PPP+P PPP+PPP+PPP+P Sbjct: 507 PSPPPSPPPSPPPSPPSPPPSPPPSPPPSP 536 [158][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 57.4 bits (137), Expect = 5e-07 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP PPPPP+P PPP+PPP PPP+P Sbjct: 1772 PSPPPSPPPPPSPPPPPSPPPPPPPSP 1798 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPP P PPP+PP PPP P Sbjct: 1571 PSPPPPPPSPPPPPPSPPPSPPSPPPPPP 1599 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPPPP P PP PPP+PPP P Sbjct: 1556 PPPSPPPSPPPPPPPPSPPPPPPSPPPPP 1584 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPP-PPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPP PP PPPPP+P PPP PP PPP+P Sbjct: 1558 PSPPPSPPPPPPPPSPPPPPPSPPPPPPSP 1587 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDL 109 P+PPPPP PPPPP+P PP PPP+PPP + D+ Sbjct: 1776 PSPPPPPSPPPPPSP--PPPPPPSPPPLHQFTSADV 1809 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP+PPP+P Sbjct: 1564 PPPPPPPPSPPPPPPSPPP-PPPSPPPSP 1591 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPA--PMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP+PPP+PP P Sbjct: 1565 PPPPPPPSPPPPPPSPPPPPPSPPPSPPSPP 1595 [159][TOP] >UniRef100_A3BJ87 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BJ87_ORYSJ Length = 121 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG GGG GGG GGG+G GGGGG GGGGG G Sbjct: 45 FGGGGGFGGGGGGGLGGGGGGGLGGGGGFG 74 [160][TOP] >UniRef100_B6ACL7 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6ACL7_9CRYT Length = 506 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+P PPPLPPP P P+PPP PPP PPP P Sbjct: 316 PSPLPPPLPPPLPPPLPPPLPPPLPPPLP 344 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLP P P P+PPP PPP PPP P Sbjct: 308 PLPPPPPLPSPLPPPLPPPLPPPLPPPLP 336 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPPLPPP P P+PPP PPP PPP P Sbjct: 320 PPPLPPPLPPPLPPPLPPPLPPPLPPPLP 348 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPPLPPP P P+PPP PPP PPP P Sbjct: 324 PPPLPPPLPPPLPPPLPPPLPPPLPPPLP 352 [161][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPP 144 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPP---PLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP P PPPPP P PPP PPP PPP P Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPP 140 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPP 82 PPPPP PPPPP P PPP PPP PPP Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP PPPPP P PPP PPP PPP P Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPP 144 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPP 79 P PPPPP PPPPP P PPP PPP PP Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPP 145 [162][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P P PAP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPEPEPQPAP 81 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPPP PPPPP P PPP PPP P P P Sbjct: 52 SPPPPPPPPPPPPPPPPPPPPPEPEPQP 79 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PP P PPP PPP PPP P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P P P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 [163][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPP 170 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPT---PPPAP 88 P PPPPP PPPPP P PPP PPPT PPP P Sbjct: 148 PPPPPPPPPPPPPPPPPPPPPPPTTLEPPPPP 179 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP PPPPP P PPP PPP PPP P Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPP 170 [164][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PPP PPP PPP P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P P PAP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPEPEPQPAP 81 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 +PPPPP PPPPP P PPP PPP P P P Sbjct: 52 SPPPPPPPPPPPPPPPPPPPPPEPEPQP 79 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PP P PPP PPP PPP P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P P P P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 [165][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPP----TPPPAP 88 P PPPPP PPPPP P PPP PPP PPPAP Sbjct: 357 PPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP P P PPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP PPPPP P PPP PPP PPP P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPP 377 [166][TOP] >UniRef100_UPI0001926BAB PREDICTED: similar to mini-collagen n=1 Tax=Hydra magnipapillata RepID=UPI0001926BAB Length = 149 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PPPPP P PPP PPP PPPAP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPAP 76 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP P P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAPLP 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAPLP 78 [167][TOP] >UniRef100_UPI00019259C5 PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI00019259C5 Length = 496 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 8 PPPPPLPP-PPPAPMPPPAPPPTPPPAPNI 94 PPP PLPP PPPAP+PPP PPP PPP P I Sbjct: 431 PPPAPLPPVPPPAPLPPPPPPPVPPPPPVI 460 [168][TOP] >UniRef100_UPI000186A01D hypothetical protein BRAFLDRAFT_106142 n=1 Tax=Branchiostoma floridae RepID=UPI000186A01D Length = 550 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 5 NPP-PPPLPPPPPAPMPPPAPPPTPPPAPN 91 NPP PPPLP PPP P PPP PPP PPP PN Sbjct: 101 NPPSPPPLPTPPPYPPPPPPPPPPPPPPPN 130 [169][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/68 (42%), Positives = 34/68 (50%), Gaps = 10/68 (14%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPP----------PAPNINAYDLLFSASPANLRETTV 151 P PPPPP PPPPP P PPP PPP PP P P + S ++L + T Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPLDVGEASNLQPPPPLPPPPYSCDPSGSDLPQDTK 519 Query: 152 VLQSIYKL 175 VLQ + L Sbjct: 520 VLQYYFNL 527 [170][TOP] >UniRef100_UPI0000D9E82E PREDICTED: similar to additional sex combs like 1 isoform 4 n=1 Tax=Macaca mulatta RepID=UPI0000D9E82E Length = 2250 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPP--APMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP PN Sbjct: 2018 PPPPPPPPPPPPPLALPPPPPPPPPLPPPLPN 2049 [171][TOP] >UniRef100_UPI0000D9E82D PREDICTED: similar to additional sex combs like 1 isoform 2 n=3 Tax=Macaca mulatta RepID=UPI0000D9E82D Length = 2249 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPP--APMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP PPP PPP PN Sbjct: 2017 PPPPPPPPPPPPPLALPPPPPPPPPLPPPLPN 2048 [172][TOP] >UniRef100_UPI00006A0DA0 zinc finger homeodomain 4 n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A0DA0 Length = 1612 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP----PPAPPPTPPPAP 88 P PPPPP PPPPP +P PPAPPPTPPP P Sbjct: 32 PPPPPPPPPPPPPTSLPAQALPPAPPPTPPPPP 64 [173][TOP] >UniRef100_UPI00016E10B6 UPI00016E10B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B6 Length = 1270 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 2 PNPPPPPLPPPPPA----PMPPPAPPPTPPPAPNI 94 P PPPPP PPPPPA P PPP PPP PPP P + Sbjct: 685 PPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGV 719 [174][TOP] >UniRef100_UPI00016E10B5 UPI00016E10B5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B5 Length = 1246 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 2 PNPPPPPLPPPPPA----PMPPPAPPPTPPPAPNI 94 P PPPPP PPPPPA P PPP PPP PPP P + Sbjct: 661 PPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGV 695 [175][TOP] >UniRef100_UPI00016E10B4 UPI00016E10B4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B4 Length = 1323 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 2 PNPPPPPLPPPPPA----PMPPPAPPPTPPPAPNI 94 P PPPPP PPPPPA P PPP PPP PPP P + Sbjct: 738 PPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGV 772 [176][TOP] >UniRef100_UPI00016E10A1 UPI00016E10A1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10A1 Length = 1396 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 2 PNPPPPPLPPPPPA----PMPPPAPPPTPPPAPNI 94 P PPPPP PPPPPA P PPP PPP PPP P + Sbjct: 811 PPPPPPPPPPPPPALLASPPPPPPPPPPPPPPPGV 845 [177][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPPLPP PP P P P PPP PPP P Sbjct: 787 PPPPPPPLPPAPPQPAPAPTPPPPPPPPP 815 [178][TOP] >UniRef100_A4TEZ3 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4TEZ3_MYCGI Length = 177 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP PPP PPP PPP P Sbjct: 123 PPPPPPPPPPPPPGAPPPPPPPPPPPPPP 151 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 PPPPP PPPPP PPP PPP PPP P + Sbjct: 124 PPPPPPPPPPPPGAPPPPPPPPPPPPPPV 152 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 6/38 (15%) Frame = +2 Query: 2 PNPPPPPLPPP--PPAPMPPPAPPP----TPPPAPNIN 97 P PPPPP PPP PP P PPP PPP PPP PN+N Sbjct: 125 PPPPPPPPPPPGAPPPPPPPPPPPPPPVYIPPPLPNVN 162 [179][TOP] >UniRef100_Q7XHB6 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa RepID=Q7XHB6_ORYSJ Length = 773 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PP PP PPPPPAP PP PPP PPP P Sbjct: 437 PSPPAPPPPPPPPAPSPPAPPPPPPPPPP 465 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P P PP PPPPPAP PP PPP PPPAP+ Sbjct: 423 PAPSPPAPPPPPPAPSPPAPPPPPPPPAPS 452 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPAP PPP PPP PPAP Sbjct: 442 PPPPPPPPAPSPPAPPPPPPPPPPCPPAP 470 [180][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P PPPPP PPPP P PPP PPP PPP P + Sbjct: 437 PPPPPPPPPPPPTPPPPPPRPPPPPPPPPPV 467 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PP PPP PPP P Sbjct: 433 PPPPPPPPPPPPPPPPTPPPPPPRPPPPP 461 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 434 PPPPPPPPPPPPPPPTPPPPPPRPPPPPP 462 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PPP P Sbjct: 436 PPPPPPPPPPPPPTPPPPPPRPPPPPPPP 464 [181][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P+PP PP PPPPP P PPP PPP+PPP Sbjct: 1086 PSPPSPPSPPPPPPPSPPPPPPPSPPP 1112 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 3/33 (9%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPP---APPPTPPPAPN 91 P P PPP PPPPP+PMPPP PPP PPP P+ Sbjct: 1157 PPPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPS 1189 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/41 (53%), Positives = 26/41 (63%), Gaps = 11/41 (26%) Frame = +2 Query: 2 PNPPPPPLPPPP-----------PAPMPPPAPPPTPPPAPN 91 P+PPPPP PPPP P P PPP+PPP+PPP P+ Sbjct: 1130 PSPPPPPSPPPPTPDAPPPSPPPPPPSPPPSPPPSPPPPPS 1170 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP PP P Sbjct: 1094 PPPPPPPSPPPPPPPSPPPPRPPPPPSPP 1122 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLP-PPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPPP+PMPPP P PPP+P Sbjct: 1199 PSPPPPPNPSPPPPSPMPPPPSPMPPPPSP 1228 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPP-PAPPPTPPP 82 P PPP P+PPPPP+P PP P PPP+PPP Sbjct: 1165 PPPPPSPMPPPPPSPPPPRPPPPPSPPP 1192 [182][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP PP PPP+P Sbjct: 421 PSPPPPPPPPPPPPPPPPPFPPFPPPPSP 449 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PP PPP+PPP Sbjct: 425 PPPPPPPPPPPPPPPFPPFPPPPSPPP 451 [183][TOP] >UniRef100_A4S1A8 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S1A8_OSTLU Length = 388 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P P PPP PPP P P PPP+PPP+PPP+P N Sbjct: 110 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPN 141 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 90 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 118 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 94 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 122 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 98 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 126 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 102 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 130 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 106 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 134 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P P PPP PPP P P PPP+PPP+PPP+P + Sbjct: 138 PPPNPPPSPPPSPPPSPPPSPPPSPPPSPPV 168 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP PPP+P Sbjct: 118 PPPSPPPSPPPSPPPSPPPSPPPNPPPSP 146 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 126 PPPSPPPSPPPSPPPNPPPSPPPSPPPSP 154 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 130 PPPSPPPSPPPNPPPSPPPSPPPSPPPSP 158 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 134 PPPSPPPNPPPSPPPSPPPSPPPSPPPSP 162 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP P Sbjct: 114 PPPSPPPSPPPSPPPSPPPSPPPSPPPNP 142 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP PPP+PPP+P Sbjct: 122 PPPSPPPSPPPSPPPSPPPNPPPSPPPSP 150 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP PPP P P PPP+PPP+PPP+P Sbjct: 88 PSPPPSPPPSPPPSPPPSPPPSPPPSP 114 [184][TOP] >UniRef100_B4LT77 GJ19953 n=1 Tax=Drosophila virilis RepID=B4LT77_DROVI Length = 609 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 P PPPPP PPPPP P PP PPP PPP P + Y + Sbjct: 496 PPPPPPPPPPPPPPPTEPP-PPPPPPPEPRVKKYSYFY 532 [185][TOP] >UniRef100_B2KTD4 Minicollagen 1 n=1 Tax=Clytia hemisphaerica RepID=B2KTD4_9CNID Length = 149 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PPPPP P PPP PPP PPPAP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPAP 77 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PPP P P P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPAPIP 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPP PPP P P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPAPIP 79 [186][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPL-PPPPPAPMPPPAPPPTPPPAP 88 P+PPPPPL PPPP P PPP PPP+PPP P Sbjct: 133 PSPPPPPLLSPPPPPPSPPPPPPPSPPPPP 162 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAP---PPTPPPAP 88 P+PPPPPL PPPP P PPP P PP PPP+P Sbjct: 119 PSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSP 150 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP+ PPP PPP+PPP P Sbjct: 56 PPPPPPSQPPPPPSSPPPPPPPPSPPPPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP PP PPP P Sbjct: 144 PPPPPSPPPPPPPSPPPPPPSPPPPLP 170 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPA 85 P PPPPP PPPPP P PPP PP PPP+ Sbjct: 226 PPPPPPPSPPPPPPPSPPPPSPPPPPPS 253 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PP PPLPPPPP PPP+PPP PPP+P Sbjct: 217 PSPPSPPLPPPPP---PPPSPPPPPPPSP 242 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP PPP PPP+PPP P Sbjct: 1 PPPPPSPPPPPPPPSSPPPPPPPSPPPPP 29 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P PP PPP+PPP P Sbjct: 8 PPPPPPPSSPPPPPPPSPPPPPPSPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%), Gaps = 6/35 (17%) Frame = +2 Query: 2 PNPPP------PPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP PP PPPPP P PPP PPP+PPP P Sbjct: 176 PPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPP 210 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PP PPP P Sbjct: 9 PPPPPPSSPPPPPPPSPPPPPPSPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 4/31 (12%) Frame = +2 Query: 8 PPPPPLPPPPPAPMP----PPAPPPTPPPAP 88 PPPPP PPPPP P P PP+PPP PPP+P Sbjct: 26 PPPPPSPPPPPPPSPPSPLPPSPPPPPPPSP 56 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP P P PPP PPP+PPP P Sbjct: 32 PPPPPPPSPPSPLPPSPPPPPPPSPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 3/30 (10%) Frame = +2 Query: 8 PPPPPLPPPPP---APMPPPAPPPTPPPAP 88 PPPPP PPPPP P PPP+PPP PPP+P Sbjct: 129 PPPPPSPPPPPLLSPPPPPPSPPPPPPPSP 158 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 24/35 (68%), Gaps = 6/35 (17%) Frame = +2 Query: 2 PNPPPPPLPPPPPAP------MPPPAPPPTPPPAP 88 P PPP PLPPPPP+P PPP PPP+PPP P Sbjct: 168 PLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPP 202 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+ PPPP P PPP P+ PP PPP+PPP P Sbjct: 111 PSSPPPPPPSPPPPPLSPPPPPPSPPPPP 139 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP PPP PPP+P P P Sbjct: 150 PPPPPPPSPPPPPPSPPPPLPPPSPLPPP 178 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PP P PP PPP+PPP P Sbjct: 223 PLPPPPPPPPSPPPPPPPSPPPPSPPPPP 251 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP P PPP P Sbjct: 72 PPPPPPPSPPPPPPPSPPPPLPSPPPPPP 100 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPP-PAP 88 P PPPPP PPPPP P PPP P P+PP P+P Sbjct: 190 PPPPPPPSPPPPPPPSPPPPPLPSPPAPSP 219 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/32 (65%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPP--APMPPPAPPPTPPPAPN 91 P PPPPP PPPPP P PPP+ PP PPP P+ Sbjct: 48 PPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPS 79 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = +2 Query: 8 PPPPPLP---PPPPAPMPPPAPPPTPPPAP 88 PPPPPLP PPPP P PP PPP+PPP P Sbjct: 96 PPPPPLPSPPPPPPLPSSPPPPPPSPPPPP 125 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 4/31 (12%) Frame = +2 Query: 8 PPPPPL----PPPPPAPMPPPAPPPTPPPAP 88 PPPPPL PPPPP+P PPP PP PPP+P Sbjct: 105 PPPPPLPSSPPPPPPSPPPPPLSPPPPPPSP 135 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPP--APPPTPPPAP 88 P PPP P PPPPP+P PPP PPP PPP+P Sbjct: 144 PPPPPSPPPPPPPSPPPPPPSPPPPLPPPSP 174 [187][TOP] >UniRef100_P27483 Glycine-rich cell wall structural protein n=1 Tax=Arabidopsis thaliana RepID=GRP1_ARATH Length = 349 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGG GGGIG G GGG+GGGGGLG Sbjct: 132 GAGGGSGGGLGGGIGGGAGGGAGGGGGLG 160 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGGAGGG G G GGG+GGGGG+G Sbjct: 54 GAGGGFGGGAGGGAGGGLGGGAGGGGGIG 82 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGG GGGIG G GGG+GGGGG G Sbjct: 190 GAGGGSGGGLGGGIGGGAGGGAGGGGGAG 218 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAGGG G GGG G G GGGLG Sbjct: 66 GAGGGLGGGAGGGGGIGGGAGGGAGGGLG 94 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/31 (77%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGG--GGGLG 1 GAGGG+GGG GGGIG G GGGSGG GGG+G Sbjct: 116 GAGGGLGGGHGGGIGGGAGGGSGGGLGGGIG 146 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/31 (77%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGG--GGGLG 1 GAGGG+GGG GGGIG G GGGSGG GGG+G Sbjct: 174 GAGGGLGGGHGGGIGGGAGGGSGGGLGGGIG 204 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G+GGG GGGAGGG G G GGG GGGGG G Sbjct: 314 GSGGGFGGGAGGGAGGGAGGGFGGGGGAG 342 [188][TOP] >UniRef100_UPI0000D9B853 PREDICTED: similar to Formin-1 isoform IV (Limb deformity protein) n=1 Tax=Macaca mulatta RepID=UPI0000D9B853 Length = 1164 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 7/37 (18%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPM-------PPPAPPPTPPPAPN 91 P PPPPP PPPPP P+ PPP PPP PPP PN Sbjct: 683 PPPPPPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPN 719 [189][TOP] >UniRef100_UPI0001951234 Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein). n=1 Tax=Canis lupus familiaris RepID=UPI0001951234 Length = 1045 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PPPAP P PPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPAPAPAPPP 889 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PPPPP P PPP PPP P PAP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPAPAPAP 887 [190][TOP] >UniRef100_Q2NNX0 ORF63 peptide n=1 Tax=Hyphantria cunea nucleopolyhedrovirus RepID=Q2NNX0_NPVHC Length = 178 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP PAP PPP P PTPPP P Sbjct: 47 PPPTPPPTPPPTPAPTPPPTPAPTPPPTP 75 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P P P PPP PAP PPP PPPTPPP P Sbjct: 55 PPPTPAPTPPPTPAPTPPPTPPPTPPPTP 83 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRE 142 P P PPP P P P P PPP PPPTPPP P + F A N + Sbjct: 59 PAPTPPPTPAPTPPPTPPPTPPPTPPPTPAPLGDPMYFPAHITNTEQ 105 [191][TOP] >UniRef100_Q8YQB7 All3916 protein n=1 Tax=Nostoc sp. PCC 7120 RepID=Q8YQB7_ANASP Length = 383 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP P P PPP P Sbjct: 338 PDPPPPPDPPPPPDPPPPPPPDPPPPPDP 366 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPPPP P PPP PPP PPP P Sbjct: 332 PPDPPPPDPPPPPDPPPPPDPPPPPPPDP 360 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 +PPPPP PPPPP P PP PPP PPP P+ Sbjct: 317 DPPPPPDPPPPPDPPPPDPPPPDPPPPPD 345 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPPP PPPP P P P PPP PPP P+ Sbjct: 322 PDPPPPPDPPPPDPPPPDPPPPPDPPPPPD 351 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P+PPPP PPPPP P PPP PPP PP P+ Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPPPPDPPPPD 339 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP P PPP P P PP P Sbjct: 344 PDPPPPPDPPPPPPPDPPPPPDPPPPDRP 372 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP---PPAPPPTPPPAP 88 P PPPPP PPPPP P P PP PPP PPP P Sbjct: 352 PPPPPPPDPPPPPDPPPPDRPPPPPPEPPPPP 383 [192][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 24/33 (72%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAP----PPTPPPAP 88 P PPPPP PPPPP P PPP+P PP PPPAP Sbjct: 273 PPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAP 305 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PPAP PPP PP PPP P Sbjct: 282 PPPPPPPPPPSPPAPAPPPPPPAPPPPPP 310 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPP 300 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 6/35 (17%) Frame = +2 Query: 2 PNPPPPPLPPPP------PAPMPPPAPPPTPPPAP 88 P PPPPP PPPP PAP PPP PP PPPAP Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAP 312 [193][TOP] >UniRef100_Q9LW52 Genomic DNA, chromosome 3, P1 clone: MLM24 n=1 Tax=Arabidopsis thaliana RepID=Q9LW52_ARATH Length = 452 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGGAGGG G GGGGG GGGGG G Sbjct: 63 GAGGGFGGGAGGGFGGGGGGGGGGGGGGG 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGGVGGGAGGG G G GGG GGGGG G Sbjct: 55 GAGGGVGGGAGGGFGGGAGGGFGGGGGGG 83 [194][TOP] >UniRef100_Q8H797 Putative uncharacterized protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q8H797_ARATH Length = 105 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGGAGGG G GGGGG GGGGG G Sbjct: 63 GAGGGFGGGAGGGFGGGGGGGGGGGGGGG 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGGVGGGAGGG G G GGG GGGGG G Sbjct: 55 GAGGGVGGGAGGGFGGGAGGGFGGGGGGG 83 [195][TOP] >UniRef100_Q43688 Glycin-rich protein (Fragment) n=1 Tax=Vigna unguiculata RepID=Q43688_VIGUN Length = 408 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG GGG GGG+GGG G GGGGG+GGGGG+G Sbjct: 377 FGGGGGFGGGSGGGGGFGGGGGAGGGGGIG 406 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGGAGGG+G G GGG G GGG+G Sbjct: 30 GAGGGFGGGAGGGVGGGAGGGFGKGGGIG 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGGVGGGAGGG G GGG G G GGG G Sbjct: 38 GAGGGVGGGAGGGFGKGGGIGGGAGGGFG 66 [196][TOP] >UniRef100_Q013M1 Chromosome 08 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri RepID=Q013M1_OSTTA Length = 442 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 26/35 (74%), Gaps = 6/35 (17%) Frame = +2 Query: 2 PNPPPPPLP------PPPPAPMPPPAPPPTPPPAP 88 PNPPP P P PPPP+P PPP+PPP+PPP+P Sbjct: 186 PNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSP 220 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP PPP PPP+P Sbjct: 164 PPPSPPPSPPPNPPPNPPPNPPPNPPPSP 192 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPP PPP P P PPP PPP PPP P Sbjct: 160 PLSPPPPSPPPSPPPNPPPNPPPNPPPNP 188 [197][TOP] >UniRef100_Q00ZZ2 Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins (ISS) n=1 Tax=Ostreococcus tauri RepID=Q00ZZ2_OSTTA Length = 685 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/61 (45%), Positives = 35/61 (57%), Gaps = 13/61 (21%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPT-----------PPPAPNINAYDLLFSASPA--NLRE 142 P PPPPP PPPPP P PPP PPPT PPP P+ + +L ++ A +LR+ Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPTTTGGVRSPPSHPPPPPSDDPRSMLMASIQAGVSLRK 583 Query: 143 T 145 T Sbjct: 584 T 584 [198][TOP] >UniRef100_Q00TR5 Homology to unknown gene n=1 Tax=Ostreococcus tauri RepID=Q00TR5_OSTTA Length = 1931 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP PPP P P PPP+PPP+PPP+P Sbjct: 1809 PPPSPPPSPPPSPPPSPPPSPPPSPPPSP 1837 Score = 55.1 bits (131), Expect = 2e-06 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = +2 Query: 11 PPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PPP P P PPP+PPP+PPP+P Sbjct: 1808 PPPPSPPPSPPPSPPPSPPPSPPPSP 1833 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAP 88 P P PPP PPP PP P PPP+PPP+PPP+P Sbjct: 1825 PPPSPPPSPPPSPPPPSPPPSPPPSPPPSP 1854 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPPAPNINAYDL 109 P P PPP PPP PP P PPP+PPP+PPP+ N DL Sbjct: 1842 PPPSPPPSPPPSPPPPSPPPSPPPSPPPSLNGGLTDL 1878 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPP P P PPP+P PPP+PPP+PPP+P Sbjct: 1823 PSPPPSPPPSPPPSP-PPPSPPPSPPPSP 1850 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPP P P PPP+P PPP+PPP+PPP+P Sbjct: 1840 PSPPPSPPPSPPPSP-PPPSPPPSPPPSP 1867 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P P PPP PPP P P PPP+PPP+PPP Sbjct: 1813 PPPSPPPSPPPSPPPSPPPSPPPSPPP 1839 [199][TOP] >UniRef100_C5XMP0 Putative uncharacterized protein Sb03g003710 n=1 Tax=Sorghum bicolor RepID=C5XMP0_SORBI Length = 263 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FG GGG GGG GGG GAG GGG GGGGG+G Sbjct: 105 FGVGGGAGGGLGGGAGAGAGGGMGGGGGIG 134 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGG GGG+G G GGG GGGGG G Sbjct: 158 GAGGGIGGGGGGGLGGGAGGGLGGGGGFG 186 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAG G GGG GGG G GGG G GGGGGLG Sbjct: 61 FGAGAGAGGGLGGGTGLGGGVGGGGGGGLG 90 [200][TOP] >UniRef100_B9SV98 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9SV98_RICCO Length = 197 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGG+GGGAGGG+G G GGG GGGGGLG Sbjct: 57 GGGGGLGGGAGGGLGGGAGGGLGGGGGLG 85 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/31 (80%), Positives = 28/31 (90%), Gaps = 2/31 (6%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGG--GGGSGGGGGLG 1 GAGGG+GGGAGGG+G GG GGG+GGGGGLG Sbjct: 65 GAGGGLGGGAGGGLGGGGGLGGGAGGGGGLG 95 [201][TOP] >UniRef100_B9IPT3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IPT3_POPTR Length = 186 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 90 FGAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGG GGG G GGGGG+GGGGG+G Sbjct: 55 FGAGGGVGGGLGGGAG-GGGGGAGGGGGIG 83 [202][TOP] >UniRef100_B9GME0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GME0_POPTR Length = 164 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGG GGG+G G GGG+GGGGGLG Sbjct: 64 GAGGGLGGGIGGGVGGGFGGGAGGGGGLG 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 5/34 (14%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGG-----GGSGGGGGLG 1 GAGGGVGGG GGG GAGGG GG+GGGGG G Sbjct: 124 GAGGGVGGGVGGGFGAGGGVGGGLGGAGGGGGFG 157 [203][TOP] >UniRef100_A2YLR5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YLR5_ORYSI Length = 356 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGG GGG+G GGGGG GGGGG G Sbjct: 119 GAGGGLGGGGGGGLGGGGGGGVGGGGGQG 147 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGGAGGG G GGGGG GGGGG G Sbjct: 261 GAGGGFGGGAGGGAGQGGGGGLGGGGGGG 289 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 2/32 (6%) Frame = -3 Query: 90 FGAGGGVGG--GAGGGIGAGGGGGSGGGGGLG 1 FGAGGGVGG G GGG+G GGGGG GGGGG G Sbjct: 192 FGAGGGVGGAAGGGGGMGGGGGGGFGGGGGKG 223 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG G G GGG+G GGGGG GGGGG G Sbjct: 269 GAGGGAGQGGGGGLGGGGGGGLGGGGGAG 297 [204][TOP] >UniRef100_Q96VI4 Protease 1 n=1 Tax=Pneumocystis carinii RepID=Q96VI4_PNECA Length = 938 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 P+PPPPP PPP PAP PPP PPP PPP P + Sbjct: 785 PSPPPPPPPPPAPAPAPPP-PPPPPPPRPEL 814 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPP P PPPPP P P PAPPP PPP P Sbjct: 783 PPPSPPPPPPPPPAPAPAPPPPPPPPP 809 [205][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPP--PPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PPP PPPPPAP PP APPP PPP P Sbjct: 702 PKPPSAPPPPPPPPPAPKPPGAPPPPPPPPP 732 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 2/30 (6%) Frame = +2 Query: 5 NPPPPPLPPPPPAPMPP--PAPPPTPPPAP 88 +PPPPP PPPPPAP PP P PPP PP AP Sbjct: 740 HPPPPPPPPPPPAPKPPGAPPPPPKPPSAP 769 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PP AP PPP PP PPP P Sbjct: 745 PPPPPPPAPKPPGAPPPPPKPPSAPPPPP 773 [206][TOP] >UniRef100_UPI0001553827 PREDICTED: additional sex combs like 3 n=1 Tax=Mus musculus RepID=UPI0001553827 Length = 1791 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPM----PPPAPPPTPPPAPNI 94 P PPPPP PPPPP P+ PPP PPP PPP P + Sbjct: 1555 PLPPPPPPPPPPPPPLALPPPPPPPPPLPPPLPTV 1589 [207][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P+P PP PPP P A L SASP Sbjct: 557 PPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPGSASP 598 [208][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P+P PP PPP P A L SASP Sbjct: 569 PPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPGSASP 610 [209][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P+P PP PPP P A L SASP Sbjct: 456 PPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPGSASP 497 [210][TOP] >UniRef100_UPI00004D6F7F Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7F Length = 555 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P+P PP PPP P A L SASP Sbjct: 28 PPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPGSASP 69 [211][TOP] >UniRef100_UPI00004D6F7D Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7D Length = 1054 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASP 127 P PPPPP PPPPP P+P PP PPP P A L SASP Sbjct: 538 PPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPGSASP 579 [212][TOP] >UniRef100_B0UKV8 Putative uncharacterized protein n=1 Tax=Methylobacterium sp. 4-46 RepID=B0UKV8_METS4 Length = 831 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PP PPLPPP P P PPPAPPP PPPAP Sbjct: 581 PPPPAPPLPPPAPPPAPPPAPPP-PPPAP 608 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PP PP P PPPAPPP PPP P Sbjct: 578 PPPPPPPAPPLPP-PAPPPAPPPAPPPPP 605 [213][TOP] >UniRef100_Q8GTL0 Putative glycine-rich cell wall protein n=2 Tax=Oryza sativa Japonica Group RepID=Q8GTL0_ORYSJ Length = 400 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGG+GGGAGGG G G GGGSGGGGGLG Sbjct: 166 GGGGGLGGGAGGGAGGGLGGGSGGGGGLG 194 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAGGG GAG GGG+G GGG G Sbjct: 138 GAGGGLGGGAGGGAGAGVGGGAGAGGGAG 166 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%), Gaps = 2/31 (6%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGG--GGGSGGGGGLG 1 G GGG+GGGAGGG G GG GGG+GGGGGLG Sbjct: 188 GGGGGLGGGAGGGAGVGGGAGGGAGGGGGLG 218 [214][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPP--APPPTPPPAP 88 P PPPPP PPPPP P PPP PPP+PPP P Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 205 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP P PPP PPP+PPP PPP+P Sbjct: 181 PSPPPPPPPSPPPPSPPPPSPPPPPPPSP 209 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPP--PAPMPPPAPPPTPPPAP 88 P PPPPP PPPP P P PPP PPP+PPP P Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 213 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPP PPP P P PPP+PPP PPP+P Sbjct: 189 PSPPPPSPPPPSPPPPPPPSPPPPPPPSP 217 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPP PPPPP P PPP PPP+PPP Sbjct: 193 PPSPPPPSPPPPPPPSPPPPPPPSPPP 219 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 201 PPPPPPPSPPPPPPPSPPPPSPPPPSPPP 229 [215][TOP] >UniRef100_Q01DC8 Plg protein (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01DC8_OSTTA Length = 3738 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPPP+P PP PPP P P P Sbjct: 11 PSPPPPPSPPPPPSPAPPSPPPPPPSPPP 39 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAP-PPTPPPAP 88 P PP PP PPPPP+P PPP+P PP+PPP P Sbjct: 5 PPPPAPPSPPPPPSPPPPPSPAPPSPPPPP 34 [216][TOP] >UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01AC1_OSTTA Length = 872 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P P PPP PPPP+P PPP+PPP+PPP P+ Sbjct: 565 PPPSPPPPSPPPPSPPPPPSPPPSPPPPPS 594 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = +2 Query: 2 PNPPPPPLPPP-PPAPMPPPAPPPTPPP 82 P+P PPP PPP PP P PPP+PPP+PPP Sbjct: 503 PSPSPPPSPPPSPPPPSPPPSPPPSPPP 530 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPP PPPPP+P P P PPP+PPP Sbjct: 571 PPSPPPPSPPPPPSPPPSPPPPPSPPP 597 [217][TOP] >UniRef100_C5X9Y5 Putative uncharacterized protein Sb02g034435 n=1 Tax=Sorghum bicolor RepID=C5X9Y5_SORBI Length = 310 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG GGGAGGG+G GGG G GGGGG+G Sbjct: 190 GAGGGFGGGAGGGVGGGGGLGGGGGGGMG 218 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGG 7 G GGGVGGGAGGG+G GGGGG GGGGG Sbjct: 123 GFGGGVGGGAGGGLGGGGGGGFGGGGG 149 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G G G+GGGAGGG G G GGG GGGGGLG Sbjct: 182 GGGSGLGGGAGGGFGGGAGGGVGGGGGLG 210 [218][TOP] >UniRef100_C1FG60 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FG60_9CHLO Length = 340 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNIN 97 P+PPPPP PPPP+P PP PPP+PPPA N Sbjct: 40 PSPPPPPPSPPPPSPPPPSPPPPSPPPAIGAN 71 [219][TOP] >UniRef100_C1EC31 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC31_9CHLO Length = 939 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 26/30 (86%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPP-TPPPAP 88 P+PPPPP PP PP+P PPP+PPP +PPP+P Sbjct: 485 PSPPPPPPPPSPPSPPPPPSPPPSSPPPSP 514 Score = 54.7 bits (130), Expect = 3e-06 Identities = 31/66 (46%), Positives = 37/66 (56%), Gaps = 11/66 (16%) Frame = +2 Query: 2 PNPPPPPLPPP---PPAPMP-PPAPPPTPPPAPNINA---YDL----LFSASPANLRETT 148 P+PPPPP PPP PP+P P PP PPP PPPAP+ DL F N ET Sbjct: 497 PSPPPPPSPPPSSPPPSPPPFPPRPPPLPPPAPSTRTGTHVDLQVRGAFITDGLNADETE 556 Query: 149 VVLQSI 166 ++ Q+I Sbjct: 557 LLRQAI 562 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 24/34 (70%), Gaps = 5/34 (14%) Frame = +2 Query: 2 PNPPPPPLPP-----PPPAPMPPPAPPPTPPPAP 88 P PPP P PP PPP P PPP+PPP+PPP+P Sbjct: 700 PFPPPVPAPPSPPPSPPPPPSPPPSPPPSPPPSP 733 [220][TOP] >UniRef100_C1E755 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E755_9CHLO Length = 336 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPP-APPPTPPPAP 88 P PPPPP PPPPP P PPP +PPP PPP P Sbjct: 53 PPPPPPPQPPPPPRPPPPPRSPPPPPPPLP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPP----TPPPAPNINAYDLLFSASPANLRETTVVLQS 163 P PPPPP PPPPP P PPP PPP PPP P + PA R TTV +Q+ Sbjct: 47 PPPPPPPPPPPPPQPPPPPRPPPPPRSPPPPPPPLPPGP---REPPAPERPTTVRVQA 101 [221][TOP] >UniRef100_A3BK86 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BK86_ORYSJ Length = 344 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 2/32 (6%) Frame = -3 Query: 90 FGAGGGVGGGA--GGGIGAGGGGGSGGGGGLG 1 FGAGGGVGGGA GGG+G GGGGG GGGGG G Sbjct: 180 FGAGGGVGGGAGGGGGMGGGGGGGFGGGGGKG 211 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 2/32 (6%) Frame = -3 Query: 90 FGAGGGVGGGA--GGGIGAGGGGGSGGGGGLG 1 FGAGGG+GGGA GGG+G GGGGG GGGGG G Sbjct: 214 FGAGGGMGGGAGGGGGLGGGGGGGMGGGGGGG 245 [222][TOP] >UniRef100_A7XYI3 JXC1 n=1 Tax=Monodelphis domestica RepID=A7XYI3_MONDO Length = 918 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 8 PPPP-----PLPPPPPAPMPPPAPPPTPPPAP 88 PPPP PLPPPPP P PPP PPP PPPAP Sbjct: 765 PPPPLLPPLPLPPPPPPPPPPPPPPPPPPPAP 796 [223][TOP] >UniRef100_Q5CLH8 Protease n=1 Tax=Cryptosporidium hominis RepID=Q5CLH8_CRYHO Length = 1569 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 4/33 (12%) Frame = +2 Query: 2 PNPPPPPLPPPPP----APMPPPAPPPTPPPAP 88 P+PPPPP PPPPP +P PPP PPP PPP P Sbjct: 1532 PSPPPPPPPPPPPPSSSSPSPPPPPPPLPPPPP 1564 [224][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPPLPPPPP P PP PPP PPP Sbjct: 275 PPPPPPPLPPPPPPPPLPPQPPPPPPP 301 [225][TOP] >UniRef100_Q8C4A5 Putative Polycomb group protein ASXL3 n=2 Tax=Mus musculus RepID=ASXL3_MOUSE Length = 2259 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPM----PPPAPPPTPPPAPNI 94 P PPPPP PPPPP P+ PPP PPP PPP P + Sbjct: 2023 PLPPPPPPPPPPPPPLALPPPPPPPPPLPPPLPTV 2057 [226][TOP] >UniRef100_UPI0001795A47 PREDICTED: formin 1 n=1 Tax=Equus caballus RepID=UPI0001795A47 Length = 1197 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 7/40 (17%) Frame = +2 Query: 2 PNPPPPPL----PPPPPAPMPP---PAPPPTPPPAPNINA 100 P PPPPP+ PPPPP P+PP P PPP PPP PN +A Sbjct: 674 PAPPPPPVSAGPPPPPPPPLPPSAGPPPPPPPPPLPNFSA 713 [227][TOP] >UniRef100_UPI0000E24CFF PREDICTED: KIAA1713 n=1 Tax=Pan troglodytes RepID=UPI0000E24CFF Length = 2197 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 2 PNPPPPPLPPPPPA-PMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVLQSIYKL 175 P PPPPP PPPP A P PPP PPP PPP PN P++ ++ V +++ +L Sbjct: 1966 PPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEV--------PSDQKQPPVTMETTKRL 2016 [228][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/51 (49%), Positives = 28/51 (54%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVV 154 P PPPPP PPPPP P PPP PP P +P Y A A + TT+V Sbjct: 1493 PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKLAVAATVTSTTIV 1543 [229][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/51 (49%), Positives = 28/51 (54%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVV 154 P PPPPP PPPPP P PPP PP P +P Y A A + TT+V Sbjct: 1489 PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKLAVAATVTSTTIV 1539 [230][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/51 (49%), Positives = 28/51 (54%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVV 154 P PPPPP PPPPP P PPP PP P +P Y A A + TT+V Sbjct: 1489 PPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKLAVAATVTSTTIV 1539 [231][TOP] >UniRef100_UPI0000566A27 formin 1 n=1 Tax=Mus musculus RepID=UPI0000566A27 Length = 973 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 4/37 (10%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP----PPAPPPTPPPAPNINA 100 P PPPP PPPPP P+P PP PPP PPP PN+ A Sbjct: 810 PVSPPPPPPPPPPTPVPPSDGPPPPPPPPPPLPNVLA 846 [232][TOP] >UniRef100_UPI0000566A26 formin 1 n=1 Tax=Mus musculus RepID=UPI0000566A26 Length = 1071 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 4/37 (10%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP----PPAPPPTPPPAPNINA 100 P PPPP PPPPP P+P PP PPP PPP PN+ A Sbjct: 908 PVSPPPPPPPPPPTPVPPSDGPPPPPPPPPPLPNVLA 944 [233][TOP] >UniRef100_Q7TLR4 Putative uncharacterized protein n=1 Tax=Choristoneura fumiferana MNPV RepID=Q7TLR4_NPVCF Length = 251 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P P PPP PPP P+P PPP P PTPPP P+ Sbjct: 39 PPPTPPPTPPPTPSPTPPPTPSPTPPPTPS 68 [234][TOP] >UniRef100_Q7T9Y7 Odv-e66 n=1 Tax=Adoxophyes orana granulovirus RepID=Q7T9Y7_GVAO Length = 747 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP P PPP P P P PPPTPPP P Sbjct: 82 PTPTPPPTPTPPPTPTPTPTPPPTPPPTP 110 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPP P P P P PPPTPPP P Sbjct: 56 PTPPPTPTPPPTPTPPPTPTPPPTPPPTP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P P PPP P PPP P PPP PPPTP P P Sbjct: 60 PTPTPPPTPTPPPTPTPPPTPPPTPTPPP 88 [235][TOP] >UniRef100_B9EHJ5 Fmn1 protein n=1 Tax=Mus musculus RepID=B9EHJ5_MOUSE Length = 1334 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 4/37 (10%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP----PPAPPPTPPPAPNINA 100 P PPPP PPPPP P+P PP PPP PPP PN+ A Sbjct: 810 PVSPPPPPPPPPPTPVPPSDGPPPPPPPPPPLPNVLA 846 [236][TOP] >UniRef100_B7ZW99 Fmn1 protein n=1 Tax=Mus musculus RepID=B7ZW99_MOUSE Length = 1332 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 4/37 (10%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP----PPAPPPTPPPAPNINA 100 P PPPP PPPPP P+P PP PPP PPP PN+ A Sbjct: 810 PVSPPPPPPPPPPTPVPPSDGPPPPPPPPPPLPNVLA 846 [237][TOP] >UniRef100_A3PW04 U5 snRNP spliceosome subunit-like protein n=1 Tax=Mycobacterium sp. JLS RepID=A3PW04_MYCSJ Length = 137 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPP AP PPP PPP PPP Sbjct: 83 PPPPPPPPPPPPGAPPPPPPPPPPPPP 109 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNI 94 PPPPP PPPPP PPP PPP PPP P + Sbjct: 83 PPPPPPPPPPPPGAPPPPPPPPPPPPPPV 111 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPT---PPPAPNINA 100 P PPPPP PPPP P PPP PPP PPP NI+A Sbjct: 88 PPPPPPPGAPPPPPPPPPPPPPPVYVPPPPVGNIDA 123 [238][TOP] >UniRef100_C4B111 Intracellular motility protein A n=4 Tax=Burkholderia mallei RepID=C4B111_BURMA Length = 373 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 PPPPP PPPPP P PPP+PPP PP P+ Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPPS 118 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP+P PP PPP+PPP Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPP 121 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPP 82 P PPPPP PPPPP P PP PPP+PPP Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPP 116 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPN 91 P PPPPP PPPPP PPP+PPP PP P+ Sbjct: 94 PPPPPPPPPPPPPPSPPPPSPPPPSPPPPS 123 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P P P PP PPP+P Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPPSP 119 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PN PPP PPPPP P PPP PP PPP+P Sbjct: 86 PNKVPPPPPPPPPPPPPPPPPPSPPPPSP 114 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP PPPPP P PPP PP P P P Sbjct: 93 PPPPPPPPPPPPPPPSPPPPSPPPPSPPP 121 [239][TOP] >UniRef100_Q9AR23 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q9AR23_ORYSJ Length = 486 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GG +GGGAGGG+G GGGGG GGGGG G Sbjct: 263 GMGGDIGGGAGGGVGGGGGGGMGGGGGFG 291 [240][TOP] >UniRef100_Q1EP07 Putative uncharacterized protein n=1 Tax=Musa acuminata RepID=Q1EP07_MUSAC Length = 390 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPPAP PPP PPP P P P Sbjct: 196 PPPPPAPEPPPPPAPEPPPPPPPKPDPTP 224 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPPAP PPP P P PPP P Sbjct: 188 PPPPPGPEPPPPPAPEPPPPPAPEPPPPP 216 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPP P PPPPP P PPP P P PPP P Sbjct: 180 PPPPPGPEPPPPPGPEPPPPPAPEPPPPP 208 [241][TOP] >UniRef100_Q10MG8 Retrotransposon protein, putative, Ty3-gypsy subclass, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10MG8_ORYSJ Length = 590 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%), Gaps = 2/31 (6%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGG--GGGSGGGGGLG 1 GAGGG+GGGAGGG GAGG GGG+GGGGGLG Sbjct: 217 GAGGGLGGGAGGGGGAGGGLGGGAGGGGGLG 247 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGG+GGGAGGG+G G GGG G GGGLG Sbjct: 209 GGGGGLGGGAGGGLGGGAGGGGGAGGGLG 237 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G GGG G+GGGGGLG Sbjct: 307 GAGGGLGGGAGAGGGLGGGAGAGGGGGLG 335 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G GGG G+GGGGGLG Sbjct: 347 GAGGGLGGGAGAGGGLGGGAGAGGGGGLG 375 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G GGG G+GGGGGLG Sbjct: 387 GAGGGLGGGAGAGGGLGGGAGTGGGGGLG 415 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGG+GGGAGGG+G G GGG G GGGLG Sbjct: 159 GGGGGLGGGAGGGLGGGAGGGGGVGGGLG 187 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G GGG G+GGGGGLG Sbjct: 427 GAGGGLGGGAGAGGGFGGGAGAGGGGGLG 455 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G G GGG+GGGGGLG Sbjct: 267 GAGGGLGGGAGAGGGGGLGGGTGGGGGLG 295 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G G GGG+GGGGGLG Sbjct: 317 GAGGGLGGGAGAGGGGGLGGGAGGGGGLG 345 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G G GGG+GGGGGLG Sbjct: 357 GAGGGLGGGAGAGGGGGLGGGAGGGGGLG 385 [242][TOP] >UniRef100_Q7XRW4 OSJNBb0062H02.5 protein n=2 Tax=Oryza sativa RepID=Q7XRW4_ORYSJ Length = 577 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P PPPPP P PPAP PPP PPP PPP P Sbjct: 262 PAPPPPPPAPSPPAPPPPPPPPPPPPPCP 290 [243][TOP] >UniRef100_C1MSQ5 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MSQ5_9CHLO Length = 1516 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/77 (36%), Positives = 38/77 (49%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPANLRETTVVLQSIYKLFE 181 P PPPPPLP PPP+P PPP+P P+PPP P SPA+ T Y+ Sbjct: 1074 PPPPPPPLPSPPPSP-PPPSPSPSPPPPP-----PYALPTSPADSSSCTHCAAGTYQPSP 1127 Query: 182 GKIACKHTLSQFICEST 232 + +C ++ +T Sbjct: 1128 DQASCVDCAPGYVVATT 1144 [244][TOP] >UniRef100_C1E3W3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E3W3_9CHLO Length = 7500 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPA-PPPTPPPAP 88 P+PPPPP PPPP P PPP+ PPP+PPP+P Sbjct: 4466 PSPPPPPPSPPPPPPSPPPSPPPPSPPPSP 4495 [245][TOP] >UniRef100_B9FZD5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FZD5_ORYSJ Length = 2255 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPP-TPPPAPNIN 97 P PPPPP PPPPP P+PP PPP PPP P +N Sbjct: 429 PLPPPPPPPPPPPPPLPPNMPPPLPPPPEPELN 461 [246][TOP] >UniRef100_B8BBD3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BBD3_ORYSI Length = 2000 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPP-TPPPAPNIN 97 P PPPPP PPPPP P+PP PPP PPP P +N Sbjct: 294 PLPPPPPPPPPPPPPLPPNMPPPLPPPPEPELN 326 [247][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPP P PPP+PPP PP P Sbjct: 489 PSPPPPPSPPPPSPPPPPPSPPPPPPSPP 517 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPP--APPPTPPPAPN 91 P+PPPP PPPPP+P PPP PPP+PPP P+ Sbjct: 495 PSPPPPSPPPPPPSPPPPPPSPPPPSPPPPPS 526 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAP 88 P+PPPPP PPPP+P PPP+P P PPPAP Sbjct: 507 PSPPPPPPSPPPPSPPPPPSPSP-PPPAP 534 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMP--PPAPPPTPPPAP 88 P PPPP PPPPP+P P PP PPP+PPP P Sbjct: 483 PPSPPPPSPPPPPSPPPPSPPPPPPSPPPPP 513 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAP 88 PPPPP PPPPP PPP+PPP P P+P Sbjct: 503 PPPPPSPPPPPPSPPPPSPPPPPSPSP 529 [248][TOP] >UniRef100_A9TLH5 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TLH5_PHYPA Length = 234 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = +2 Query: 2 PNPPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLFSASPAN 133 P P PPLPPPPP P PPP P P PPP+ +Y S SP++ Sbjct: 140 PAAPAPPLPPPPPPPPPPPPPGPRPPPSSPTPSYPSSLSPSPSS 183 [249][TOP] >UniRef100_A3AH89 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3AH89_ORYSJ Length = 590 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%), Gaps = 2/31 (6%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGG--GGGSGGGGGLG 1 GAGGG+GGGAGGG GAGG GGG+GGGGGLG Sbjct: 217 GAGGGLGGGAGGGGGAGGGLGGGAGGGGGLG 247 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGG+GGGAGGG+G G GGG G GGGLG Sbjct: 209 GGGGGLGGGAGGGLGGGAGGGGGAGGGLG 237 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G GGG G+GGGGGLG Sbjct: 347 GAGGGLGGGAGAGGGLGGGAGAGGGGGLG 375 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G GGG G+GGGGGLG Sbjct: 387 GAGGGLGGGAGAGGGLGGGAGAGGGGGLG 415 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 G GGG+GGGAGGG+G G GGG G GGGLG Sbjct: 159 GGGGGLGGGAGGGLGGGAGGGGGVGGGLG 187 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G GGG G+GGGGGLG Sbjct: 427 GAGGGLGGGAGAGGGFGGGAGAGGGGGLG 455 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G G GGG+GGGGGLG Sbjct: 267 GAGGGLGGGAGAGGGGGLGGGTGGGGGLG 295 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G G GGG+GGGGGLG Sbjct: 357 GAGGGLGGGAGAGGGGGLGGGAGGGGGLG 385 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 87 GAGGGVGGGAGGGIGAGGGGGSGGGGGLG 1 GAGGG+GGGAG G G G GGG+GGGGGLG Sbjct: 397 GAGGGLGGGAGAGGGGGLGGGAGGGGGLG 425 [250][TOP] >UniRef100_Q29LJ4 GA17232 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=Q29LJ4_DROPS Length = 596 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/36 (55%), Positives = 22/36 (61%) Frame = +2 Query: 8 PPPPPLPPPPPAPMPPPAPPPTPPPAPNINAYDLLF 115 PPPPP PPPPP P P PPP PPP P + Y + Sbjct: 483 PPPPPPPPPPPPPPPTEPPPPPPPPEPRVKKYSYFY 518