[UP]
[1][TOP] >UniRef100_C6T2Y8 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T2Y8_SOYBN Length = 116 Score = 75.9 bits (185), Expect = 9e-12 Identities = 56/129 (43%), Positives = 71/129 (55%) Frame = +1 Query: 139 MGTAILRSHDCLQQGRFLPNDAFSIPSSQIRSRKNSNPNCKSYVNNNNHNQNRRRKRSPV 318 MGT++L SHDCLQ +DA S S IRS++N NP+ Y Q RRR+ Sbjct: 1 MGTSLLLSHDCLQGH----HDALSPTPSSIRSQRNPNPSPNPY-------QTRRRR---- 45 Query: 319 ANVNHNDRKQSVDRTVAPVNLVMGQVKILKRGEKLSPEKFNVVEENRKVKDLDRPDLLLG 498 ++ DR V + + NLVMG VKILKRGE LS E + D + DL+LG Sbjct: 46 --LHDGDRSGMVVKGPS-ANLVMGHVKILKRGETLSAE--------TRGGDDEGFDLVLG 94 Query: 499 STDRFGPDP 525 ST+R GPDP Sbjct: 95 STNRLGPDP 103 [2][TOP] >UniRef100_B9SC19 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9SC19_RICCO Length = 171 Score = 72.4 bits (176), Expect = 1e-10 Identities = 45/103 (43%), Positives = 60/103 (58%), Gaps = 9/103 (8%) Frame = +1 Query: 274 NNNHNQNRRRK--RSPVANVNHNDRKQSVDRTVAPVNLVMGQVKILKRGEKLSPEKFNVV 447 N N + +RRRK R+P A +H R ++ N VMG+VKILKRGE L+ + Sbjct: 22 NPNFSDSRRRKPPRNPQAFNHHRSRSGAMVAKFPSRNFVMGEVKILKRGESLAKVDKRGL 81 Query: 448 EENRK-------VKDLDRPDLLLGSTDRFGPDPVTMQKQIRVS 555 + K +K PDL+LGSTDR GPDP T+Q+QIR+S Sbjct: 82 SKKEKRKHPTMIMKIEKDPDLILGSTDRLGPDPETVQEQIRLS 124 [3][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 70.1 bits (170), Expect = 5e-10 Identities = 30/56 (53%), Positives = 31/56 (55%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIP 731 C P P+ PPP PPPPPP PPPPPPPPPP PPP P C P C P Sbjct: 129 CPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPP 184 Score = 59.7 bits (143), Expect = 6e-07 Identities = 30/59 (50%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Frame = +3 Query: 564 CSPGDPLVLERPPPYP---PPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIP 731 C P P PPP P PPPPP PPPPPPPPPP PPP P V P C P Sbjct: 119 CPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPP 177 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/48 (52%), Positives = 27/48 (56%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 P P+ L PPP PPPPPP P PPPPPP P PP P +C P Sbjct: 187 PPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPPPACPAP 234 Score = 57.0 bits (136), Expect = 4e-06 Identities = 29/59 (49%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPP---PPPPPPPXPPPHTNAKSPYVSCFLPNFDCIP 731 C P P PPP P PPPP PPP PPPPPPP PPP P C P C P Sbjct: 169 CPPPPPCP---PPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCPP 224 Score = 55.8 bits (133), Expect = 9e-06 Identities = 27/60 (45%), Positives = 28/60 (46%), Gaps = 10/60 (16%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPP----------PPXPPPHTNAKSPYVSCFLP 713 C+P P PPP PPPPPP PPPPPPPP PP P P P C P Sbjct: 136 CAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPP 195 [4][TOP] >UniRef100_UPI000186A01D hypothetical protein BRAFLDRAFT_106142 n=1 Tax=Branchiostoma floridae RepID=UPI000186A01D Length = 550 Score = 68.6 bits (166), Expect = 1e-09 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 +P P L PPPYPPPPPP PPPPPPPP PPP +K PY Sbjct: 101 NPPSPPPLPTPPPYPPPPPPPPPPPPPPPNSLPPPPPQSKPPY 143 [5][TOP] >UniRef100_UPI0001797605 PREDICTED: bromodomain containing 4 n=1 Tax=Equus caballus RepID=UPI0001797605 Length = 1364 Score = 68.2 bits (165), Expect = 2e-09 Identities = 66/238 (27%), Positives = 88/238 (36%), Gaps = 25/238 (10%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPX------------PPPHTNAKSPYVSCFLP 713 P PL + PP PPPP PPPPPPPP PPP A+ P + LP Sbjct: 754 PQQPLPPPQQPPPPPPPQQQQQPPPPPPPPAMPQQTAPTMKSSPPPFIAAQVPVLEPQLP 813 Query: 714 NFDCIPL*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFLFPP--------LN 869 P+ ++ + HL + P L PP LN Sbjct: 814 GSVFDPI---------------------GHFSQPILHLPQPDLPPHLPPPPEHSTPPHLN 852 Query: 870 Q-----TPLVRQTNSRMPLNPSSFSHSLFLNPKGPPISIIFTIDPPLRTRHPQP*MMQTP 1034 Q P + + P PS+ + +L P PP PPL PQP M Q P Sbjct: 853 QHSVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALSQPPLL---PQPPMAQPP 909 Query: 1035 PIYYYKHYH**PSP*LNPSDTLPSTLTALNFKKSQGIPLALVPSTKIFTTIPPPPISP 1208 + + P P ++ L +K Q P L+PS K+ + PPPP+ P Sbjct: 910 QVLLQED----EEPPAPPLTSMQMQLYLQQLQKVQP-PTPLLPSVKVQSQ-PPPPMPP 961 [6][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/46 (58%), Positives = 28/46 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 P P PPP PPPPPP PPPPPPPPPP PPP + K P F Sbjct: 344 PQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTKPPQALSF 389 Score = 65.5 bits (158), Expect = 1e-08 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P + PPP PPPPPP PPPPPPPPPP PPP + P Sbjct: 343 PPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTKP 383 [7][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 67.0 bits (162), Expect = 4e-09 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 6/53 (11%) Frame = +3 Query: 558 FACSPGDPLVLERPPPYPPPPPPYPPPPPPPPP------PXPPPHTNAKSPYV 698 F CSP P PPP PPPPPP PPPPPPPPP P PPP + PYV Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYV 424 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 558 FACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 F+ P D PP PPPPPP PPPPPPPPPP PPP Sbjct: 362 FSSYPIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPP 399 Score = 56.2 bits (134), Expect = 7e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPPY P PPPPPP PPP+ P Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 [8][TOP] >UniRef100_C6XK60 OmpA/MotB domain protein n=1 Tax=Hirschia baltica ATCC 49814 RepID=C6XK60_HIRBI Length = 386 Score = 66.2 bits (160), Expect = 7e-09 Identities = 27/43 (62%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNA-KSPYVSCFLPNFD 722 PPP PPPPPP PPPPPPPPPP PPP T ++P V+C + D Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPETLVEEAPVVNCVAQSQD 276 [9][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 66.2 bits (160), Expect = 7e-09 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P L PP PPPPPP PPPPPPPPPP PPPH SP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP PL PPP PPPPPP PPPPPPPPPP PPP Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 64.7 bits (156), Expect = 2e-08 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFD-CI 728 P PL PPP PPPPPP PPPPPPPPPP P P + P V P+ + CI Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPPSCEVCI 724 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP SP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P PL PPP PPPPPP PPPP PPPPP PPP Sbjct: 216 PPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPP 249 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP P PPPP PPPPPPPPPP PPP Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPP 254 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PP PPPPPP PPPPPPPPPP PPP Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 58.9 bits (141), Expect = 1e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PP PPPPPPP PPP Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP P P + P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPP PP PPPPPPPPPP PPP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 SP P PPP PPPPPP PPPPP PPPP PPP A P Sbjct: 678 SPPPPPPPPPPPPPPPPPPP-PPPPPHPPPPSPPPLVPALPP 718 Score = 56.2 bits (134), Expect = 7e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PP PPPP PP PPP Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPP 234 [10][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 66.2 bits (160), Expect = 7e-09 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 PPP PPPPPP PPPPPPPPPP PPP P + CF Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLCCF 87 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSC 704 PPP PPPPPP PPPPPPPPPP PPP P C Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLC 85 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 [11][TOP] >UniRef100_Q9ESU6 Bromodomain-containing protein 4 n=1 Tax=Mus musculus RepID=BRD4_MOUSE Length = 1400 Score = 66.2 bits (160), Expect = 7e-09 Identities = 67/245 (27%), Positives = 90/245 (36%), Gaps = 32/245 (13%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPP-------PPPPPPP------------XPPPHTNAKSP 692 P V ++PPP P PPP PPP PPPPPPP PPP A+ P Sbjct: 749 PAPAPVPQQPPPPPQQPPPPPPPQQQQQQPPPPPPPPSMPQQTAPAMKSSPPPFITAQVP 808 Query: 693 YVSCFLPNFDCIPL*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFLFPP--- 863 + LP P+ ++ + HL + P L P Sbjct: 809 VLEPQLPGSVFDPI---------------------GHFTQPILHLPQPELPPHLPQPPEH 847 Query: 864 -----LNQ-----TPLVRQTNSRMPLNPSSFSHSLFLNPKGPPISIIFTIDPPLRTRHPQ 1013 LNQ P + + P PS+ + +L P PP PPL PQ Sbjct: 848 STPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPTRPPAVSPALAQPPLL---PQ 904 Query: 1014 P*MMQTPPIYYYKHYH**PSP*LNPSDTLPSTLTALNFKKSQGIPLALVPSTKIFTTIPP 1193 P M+Q P + P P ++ L +K Q P L+PS K+ + PP Sbjct: 905 PPMVQPPQVLLEDE-----EPPAPPLTSMQMQLYLQQLQKVQP-PTPLLPSVKV-QSQPP 957 Query: 1194 PPISP 1208 PP+ P Sbjct: 958 PPLPP 962 [12][TOP] >UniRef100_B9RNY9 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RNY9_RICCO Length = 189 Score = 66.2 bits (160), Expect = 7e-09 Identities = 54/133 (40%), Positives = 71/133 (53%), Gaps = 4/133 (3%) Frame = +1 Query: 139 MGTAILRSHDCLQQGRFLPNDAFSIPSSQIRSRKNSN-PNCKSYVNNNNHNQNRRRKRSP 315 MG A+L DCLQ D S+P +N N P+ K+ N +N Q RRKRSP Sbjct: 1 MGVAVLSPQDCLQNPLSSRRDLISLPPRMKPPPRNPNGPDPKA--NRSNRPQPNRRKRSP 58 Query: 316 VANVNHNDRKQSVDRTVAPVNLVMGQVKILKRGEKL---SPEKFNVVEENRKVKDLDRPD 486 N + R + + VA V+GQVKILKRGE+L +PEK V+ + K+ ++ Sbjct: 59 --NTSPPSRAAVLPKVVAAP--VIGQVKILKRGEQLPKTTPEK--VLSQPIKI-EMKNKY 111 Query: 487 LLLGSTDRFGPDP 525 LGST R GPDP Sbjct: 112 GDLGSTQRLGPDP 124 [13][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 65.9 bits (159), Expect = 9e-09 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +3 Query: 555 GFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 G C+ P V + PPP PPPPPP PPPPPPPPPP PPP Sbjct: 308 GIYCNGFTPDVEQPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +3 Query: 555 GFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 GF P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 313 GFTPDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP + P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPEPPP 367 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS 701 PPP PPPPPP PPPPPPPPPP PP P V+ Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPVT 374 [14][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 65.9 bits (159), Expect = 9e-09 Identities = 29/50 (58%), Positives = 31/50 (62%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIPL*FCC 746 PPP PPPPPP PPPPPPPPPP PPP P V +L F P+ CC Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPGYLVFF--CPIGVCC 130 Score = 63.2 bits (152), Expect = 6e-08 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 582 LVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 ++L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 68 VILTPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 71 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 [15][TOP] >UniRef100_B3M2B3 GF17078 n=1 Tax=Drosophila ananassae RepID=B3M2B3_DROAN Length = 599 Score = 65.9 bits (159), Expect = 9e-09 Identities = 27/45 (60%), Positives = 28/45 (62%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIP 731 PPP PPPPPP PPPPPPPPPP PPPH P + F IP Sbjct: 157 PPPPPPPPPPPPPPPPPPPPPPPPPHHPHHHPSPPSVIIPFPVIP 201 [16][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 65.9 bits (159), Expect = 9e-09 Identities = 31/51 (60%), Positives = 32/51 (62%), Gaps = 4/51 (7%) Frame = +3 Query: 558 FACSPGDPLVLE----RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 F C P P V + PPP PPPPPP PPPPPPPPPP PPP A PYV Sbjct: 22 FCCVPFLPFVCQCLCCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPA--PYV 70 [17][TOP] >UniRef100_Q3UH70 Putative uncharacterized protein n=1 Tax=Mus musculus RepID=Q3UH70_MOUSE Length = 1401 Score = 65.5 bits (158), Expect = 1e-08 Identities = 67/245 (27%), Positives = 89/245 (36%), Gaps = 32/245 (13%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPP-------PPPPPPP------------XPPPHTNAKSP 692 P V ++PPP P PPP PPP PPPPPPP PPP A+ P Sbjct: 750 PAPAPVPQQPPPPPQQPPPPPPPQQQQQQPPPPPPPPSMPQQTAPAMKSSPPPFITAQVP 809 Query: 693 YVSCFLPNFDCIPL*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFLFPP--- 863 + LP P+ ++ + HL + P L P Sbjct: 810 VLEPQLPGSVFDPI---------------------GHFTQPILHLPQPELPPHLPQPPEH 848 Query: 864 -----LNQ-----TPLVRQTNSRMPLNPSSFSHSLFLNPKGPPISIIFTIDPPLRTRHPQ 1013 LNQ P + + P PS+ + +L P PP PPL PQ Sbjct: 849 STPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPTRPPAVSPALAQPPLL---PQ 905 Query: 1014 P*MMQTPPIYYYKHYH**PSP*LNPSDTLPSTLTALNFKKSQGIPLALVPSTKIFTTIPP 1193 P M Q P + P P ++ L +K Q P L+PS K+ + PP Sbjct: 906 PPMAQPPQVLLEDE-----EPPAPPLTSMQMQLYLQQLQKVQP-PTPLLPSVKV-QSQPP 958 Query: 1194 PPISP 1208 PP+ P Sbjct: 959 PPLPP 963 [18][TOP] >UniRef100_B0V2V7 Bromodomain containing 4 n=1 Tax=Mus musculus RepID=B0V2V7_MOUSE Length = 1400 Score = 65.5 bits (158), Expect = 1e-08 Identities = 67/245 (27%), Positives = 89/245 (36%), Gaps = 32/245 (13%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPP-------PPPPPPP------------XPPPHTNAKSP 692 P V ++PPP P PPP PPP PPPPPPP PPP A+ P Sbjct: 749 PAPAPVPQQPPPPPQQPPPPPPPQQQQQQPPPPPPPPSMPQQTAPAMKSSPPPFITAQVP 808 Query: 693 YVSCFLPNFDCIPL*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFLFPP--- 863 + LP P+ ++ + HL + P L P Sbjct: 809 VLEPQLPGSVFDPI---------------------GHFTQPILHLPQPELPPHLPQPPEH 847 Query: 864 -----LNQ-----TPLVRQTNSRMPLNPSSFSHSLFLNPKGPPISIIFTIDPPLRTRHPQ 1013 LNQ P + + P PS+ + +L P PP PPL PQ Sbjct: 848 STPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPTRPPAVSPALAQPPLL---PQ 904 Query: 1014 P*MMQTPPIYYYKHYH**PSP*LNPSDTLPSTLTALNFKKSQGIPLALVPSTKIFTTIPP 1193 P M Q P + P P ++ L +K Q P L+PS K+ + PP Sbjct: 905 PPMAQPPQVLLEDE-----EPPAPPLTSMQMQLYLQQLQKVQP-PTPLLPSVKV-QSQPP 957 Query: 1194 PPISP 1208 PP+ P Sbjct: 958 PPLPP 962 [19][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = +3 Query: 522 SGYYAETD*GFGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 SG Y + G S P PPP PPPPPP PPPPPPPPPP PPP A+ Sbjct: 287 SGQYTDQSLTVGLRYSFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAFEAR 341 [20][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = +3 Query: 528 YYAETD*GFGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +Y+++ FA P L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 404 FYSQSQPSLPFAPLPQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 59.7 bits (143), Expect = 6e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHT 677 PPP PPPPPP PPPPPPPPPP PP T Sbjct: 147 PPPPPPPPPPPPPPPPPPPPPPKPPKT 173 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFL 710 PPP PPPPPP PPPPPPPPPP PP P +S FL Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPLLPP---PPPPSISSFL 465 Score = 58.5 bits (140), Expect = 1e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 + PPP PPPPPP PPPPPPPPPP P P Sbjct: 144 QTPPPPPPPPPPPPPPPPPPPPPPPKP 170 Score = 56.2 bits (134), Expect = 7e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +3 Query: 609 PPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPPPPP PPPPPPPPPP PPP K+ +V Sbjct: 147 PPPPPPPPPPPPPPPPPPPPPPKPPKTQHV 176 [21][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/52 (53%), Positives = 30/52 (57%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 + F P P PPP PPPPPP PPPPPPPPPP PPP A +V F Sbjct: 236 YAFGAEPAAP-----PPPPPPPPPPPPPPPPPPPPPPPPPAKPAARQFVVYF 282 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFD 722 P PPPPPP PPPPPPPPPP PPP P F+ FD Sbjct: 242 PAAPPPPPPPPPPPPPPPPPPPPPPPPPPAKPAARQFVVYFD 283 [22][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 PPP PPPPPP PPPPPPPPPP PPP PY+ F Sbjct: 228 PPPPPPPPPPPPPPPPPPPPPPPPPPPCNTGPYIVFF 264 Score = 62.8 bits (151), Expect = 8e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 E PPP PPPPPP PPPPPPPPPP PPP Sbjct: 222 EAPPPPPPPPPPPPPPPPPPPPPPPPP 248 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPP 249 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPP 250 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPP 659 FG P P PPP PPPPPP PPPPPPPPPP Sbjct: 219 FGGEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 [23][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PPP PPPPPP PPPPPPPPPP PPP K+P + P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFP 54 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP P T A P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPP 55 [24][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPH-TNAKSPYVSCFL 710 PPP PPPPPP PPPPPPPPPP PPPH T P+ + + Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPHITKISLPFFNALI 71 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS-CFLPNFDCI 728 PPP PPPPPP PPPPPPPPPP PPP P+++ LP F+ + Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKISLPFFNAL 70 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 [25][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 64.7 bits (156), Expect = 2e-08 Identities = 59/217 (27%), Positives = 80/217 (36%), Gaps = 7/217 (3%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPP--YPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIPL*FC 743 P P V PPP PPPPPP Y PPPPPPPPP PP ++ P S P P Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVY 533 Query: 744 CI*K**VQPNCG-----*KQI*HPYYRILLFHLQSSSIDPFLFPPLNQTPLVRQTNSRMP 908 C P+ PYY SS P PP + P + P Sbjct: 534 CTRPPPPPPHSPPPPQFSPPPPEPYY-------YSSPPPPHSSPPPHSPP--PPHSPPPP 584 Query: 909 LNPSSFSHSLFLNPKGPPISIIFTIDPPLRTRHPQP*MMQTPPIYYYKHYH**PSP*LNP 1088 + P +L+P PP + P+ + P P ++ PP P P + Sbjct: 585 IYP-------YLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPP----------PPPCIEY 627 Query: 1089 SDTLPSTLTALNFKKSQGIPLALVPSTKIFTTIPPPP 1199 S P + + + + P ++ + PPPP Sbjct: 628 SPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPP 664 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPP--YPPPPPPPPPPXPPP 671 P P V PPP PPPPPP Y PPPPPPPPP PPP Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P V PPP PPPPP Y PPPPPPPPP PP ++ P Sbjct: 433 PPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 470 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P+ PPP PPPPPP PPPPPPPP PPP + P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P + PPP PPPPPP PPPPPPPP PPP Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 [26][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P+ PPP PPPPPP PPPPPPPPPP PPP Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPP 144 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHT 677 PPP PPPPPP PPPPPPPPPP PPP T Sbjct: 122 PPPPPPPPPPPPPPPPPPPPPPPPPPT 148 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/41 (58%), Positives = 26/41 (63%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P + P P PPPPPP PPPPPPPPPP PPP +P Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 149 Score = 59.3 bits (142), Expect = 8e-07 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 9/47 (19%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXP---------PPHTN 680 +P P PPP PPPPPP PPPPPPPPPP P PPH N Sbjct: 117 TPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPRFTTRGVSFPPHGN 163 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P DP P PPPPPP PPPPPPPPPP PPP Sbjct: 107 APPDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPP 141 [27][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P+ PPP PPPPPP PPPPPPPPPP PPP Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPP 144 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P + P P PPPPPP PPPPPPPPPP PPP Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPP 142 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHT 677 PPP PPPPPP PPPPPPPPPP PP T Sbjct: 122 PPPPPPPPPPPPPPPPPPPPPPPPLFT 148 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P DP P PPPPPP PPPPPPPPPP PPP Sbjct: 107 APPDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPP 141 [28][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSC 704 P P PPP PPPPPP PPPPPPPPPP PPP A SC Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSC 419 Score = 61.6 bits (148), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 369 PPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PPPPPP PPP PPPPPP PPP Sbjct: 354 CQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 389 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PPPPPP PPPPPPPPP PPP Sbjct: 357 CPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/37 (62%), Positives = 25/37 (67%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 + +P P PPP PPPPPP PPPPPP PPP PPP Sbjct: 350 SANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 386 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXP 665 SP P PPP PPPPPP PPPPPPPPPP P Sbjct: 379 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 AC P P P PPPPPP PPPPPPPPPP PP Sbjct: 343 ACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPP 378 [29][TOP] >UniRef100_UPI0000F2C563 PREDICTED: similar to functional smad suppressing element 18 n=1 Tax=Monodelphis domestica RepID=UPI0000F2C563 Length = 1158 Score = 64.3 bits (155), Expect = 3e-08 Identities = 50/145 (34%), Positives = 61/145 (42%), Gaps = 5/145 (3%) Frame = +3 Query: 303 EKKSGGERQSQRSETICRSYGGAGKSCYGTSKDSQKRREVESGEVQRGGGESEG*GSGSS 482 E SG S S GGAG G +K S+ ++ GG G G+G S Sbjct: 668 ESPSGSGDCSAGSTPPAEGAGGAGGG--GGTKGSRVPAPHHPHLLEGPGGRKAGGGTGGS 725 Query: 483 *FVIRIHGSVWT*SGYYAETD*----GFGFACSPGDPLVLERPPPYPPPPPPYPPPPPPP 650 H S + G +++ A P +P P PPPPPP PPPPPPP Sbjct: 726 SSSGYHHSSAFRPVGGKDDSESLAKLHGASAGQPEEPGPERHHPAPPPPPPPPPPPPPPP 785 Query: 651 PPPXPPPHTNAKSP-YVSCFLPNFD 722 PPP P PH SP SC P+ D Sbjct: 786 PPPPPQPHHRLLSPGGTSCSYPSED 810 [30][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 67 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 63.9 bits (154), Expect = 3e-08 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 4/43 (9%) Frame = +3 Query: 555 GFACSPGDPLVLER----PPPYPPPPPPYPPPPPPPPPPXPPP 671 G+ P P+ ER PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 GYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 62.8 bits (151), Expect = 8e-08 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSC 704 P P PPP PPPPPP PPPPPPPPPP PPP P C Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 105 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P RP P PPPPPP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDC 725 PPP PPPPPP PPPPPPPPPP P P P P +C Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHEC 124 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPP P PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPP 70 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP P PPPPPPPP PPP Sbjct: 55 PPPPPPPPPPRPCPPPPPPPPPPPP 79 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCP 68 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/28 (78%), Positives = 22/28 (78%), Gaps = 3/28 (10%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPP---PPPXPPP 671 PPP PPPPPP PPPPPPP PPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/28 (78%), Positives = 22/28 (78%), Gaps = 3/28 (10%) Frame = +3 Query: 597 PPPYPPPPPPYPPP---PPPPPPPXPPP 671 PPP PPPPPP PPP PPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 [31][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 + FA P P PPP PPPPPP PPPPPPPPPP PPP A+ Sbjct: 254 YSFASPPPPP-----PPPPPPPPPPPPPPPPPPPPPPPPPAYEAR 293 [32][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.8 bits (151), Expect = 8e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PPP N Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PPP N Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +3 Query: 576 DPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 DP PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 59.7 bits (143), Expect = 6e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 ++ PPP+ PPPPP PPPPPPPPPP PPP Sbjct: 14 VDPPPPHCPPPPPPPPPPPPPPPPPPPP 41 [33][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 CPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P PL PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.8 bits (151), Expect = 8e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PPP N Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P + PPP PPPPPP PPPPPPPPPP PPP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PPP N Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 576 DPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 DP PPP PPPPP PPPPPPPPPP PPP Sbjct: 15 DPPPPHCPPPPPPPPPLPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PP PPP PPPPPPPPPP PPP Sbjct: 16 PPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPP 49 Score = 55.8 bits (133), Expect = 9e-06 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 ++ PPP+ PPPPP PPP PPPPPP PPP Sbjct: 14 VDPPPPHCPPPPPPPPPLPPPPPPPPPP 41 [34][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 64.3 bits (155), Expect = 3e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 62.8 bits (151), Expect = 8e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PPP N Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPNN 68 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PPP N Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPN 67 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +3 Query: 576 DPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 DP PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 59.7 bits (143), Expect = 6e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 ++ PPP+ PPPPP PPPPPPPPPP PPP Sbjct: 14 VDPPPPHCPPPPPPPPPPPPPPPPPPPP 41 [35][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 64.3 bits (155), Expect = 3e-08 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPH 674 PPP PPPPPP PPPPPPPPPP PPPH Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPH 41 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 PPP PPPPPP PPPPPPPPPP PPP P+ Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 [36][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 PPP PPPPPP PPPPPPPPPP PPP PY Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPRRRPRPY 120 Score = 62.4 bits (150), Expect = 1e-07 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +3 Query: 582 LVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +++ PPP PPPPPP PPPPPPPPPP PPP Sbjct: 71 MMMTTPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 PPP PPPPPP PPPPPPPPPP PPP + Y Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPRRRPRPYY 121 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP + P Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRP 117 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 75 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 60.5 bits (145), Expect = 4e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P ++ PP PPPPPP PPPPPPPPPP PPP Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPPPP 99 [37][TOP] >UniRef100_B9HAT6 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HAT6_POPTR Length = 173 Score = 64.3 bits (155), Expect = 3e-08 Identities = 52/150 (34%), Positives = 69/150 (46%), Gaps = 9/150 (6%) Frame = +1 Query: 139 MGTAILRSHDCLQQGRFLPNDAFSIPSSQIRSRKNSNPNCKSYVNNNNHNQNR----RRK 306 MG ++ DCL+ + S R R NPN NNH NR RRK Sbjct: 1 MGALVVNPQDCLKN---------PLQSQPPRMRFPRNPN------PNNHRPNRAQPNRRK 45 Query: 307 RSPVANVNHNDRKQSVDRTVAPVN---LVMGQVKILKRGEK--LSPEKFNVVEENRKVKD 471 RSP R P N LV GQVKILKRGE+ + P + + + K Sbjct: 46 RSP--------NSSPPSRAAVPKNNNSLVTGQVKILKRGEEGLVKPSRVEAPKGSPIPKV 97 Query: 472 LDRPDLLLGSTDRFGPDPVTMQKQIRVSDS 561 + +L LGST R GPDPV + ++R+++S Sbjct: 98 VKNGNLGLGSTARLGPDPVLVPSRVRLTES 127 [38][TOP] >UniRef100_UPI0000DA2C5A bromodomain containing 4 n=1 Tax=Rattus norvegicus RepID=UPI0000DA2C5A Length = 1403 Score = 63.9 bits (154), Expect = 3e-08 Identities = 67/249 (26%), Positives = 89/249 (35%), Gaps = 36/249 (14%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPP-----------PPPPPPP------------XPPPHTN 680 P V ++PPP P PPP PPP PPPPPPP PPP Sbjct: 749 PAPAPVPQQPPPPPQQPPPPPPPQQQQQQQQQQPPPPPPPPSMPQQTAPAMKSSPPPFIT 808 Query: 681 AKSPYVSCFLPNFDCIPL*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFLFP 860 A+ P + LP P+ ++ + HL + P L Sbjct: 809 AQVPVLEPQLPGSVFDPI---------------------GHFTQPILHLPQPELPPHLPQ 847 Query: 861 P--------LNQ-----TPLVRQTNSRMPLNPSSFSHSLFLNPKGPPISIIFTIDPPLRT 1001 P LNQ P + + P PS+ + +L P PP PPL Sbjct: 848 PPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALAQPPLL- 906 Query: 1002 RHPQP*MMQTPPIYYYKHYH**PSP*LNPSDTLPSTLTALNFKKSQGIPLALVPSTKIFT 1181 PQP M Q P + P P ++ L +K Q P L+PS K+ Sbjct: 907 --PQPPMAQPPQVLLEDE-----EPPAPPLTSMQMQLYLQQLQKVQP-PTPLLPSVKV-Q 957 Query: 1182 TIPPPPISP 1208 + PPPP+ P Sbjct: 958 SQPPPPLPP 966 [39][TOP] >UniRef100_UPI0000DBF793 Brd4 protein n=1 Tax=Rattus norvegicus RepID=UPI0000DBF793 Length = 1404 Score = 63.9 bits (154), Expect = 3e-08 Identities = 67/249 (26%), Positives = 89/249 (35%), Gaps = 36/249 (14%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPP-----------PPPPPPP------------XPPPHTN 680 P V ++PPP P PPP PPP PPPPPPP PPP Sbjct: 750 PAPAPVPQQPPPPPQQPPPPPPPQQQQQQQQQQPPPPPPPPSMPQQTAPAMKSSPPPFIT 809 Query: 681 AKSPYVSCFLPNFDCIPL*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFLFP 860 A+ P + LP P+ ++ + HL + P L Sbjct: 810 AQVPVLEPQLPGSVFDPI---------------------GHFTQPILHLPQPELPPHLPQ 848 Query: 861 P--------LNQ-----TPLVRQTNSRMPLNPSSFSHSLFLNPKGPPISIIFTIDPPLRT 1001 P LNQ P + + P PS+ + +L P PP PPL Sbjct: 849 PPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALAQPPLL- 907 Query: 1002 RHPQP*MMQTPPIYYYKHYH**PSP*LNPSDTLPSTLTALNFKKSQGIPLALVPSTKIFT 1181 PQP M Q P + P P ++ L +K Q P L+PS K+ Sbjct: 908 --PQPPMAQPPQVLLEDE-----EPPAPPLTSMQMQLYLQQLQKVQP-PTPLLPSVKV-Q 958 Query: 1182 TIPPPPISP 1208 + PPPP+ P Sbjct: 959 SQPPPPLPP 967 [40][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/48 (60%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY-VSCFLPNFDCI 728 L+ PPP PPPPPP PPPPPPPPPP PPP + VS LP F I Sbjct: 2005 LQAPPPTPPPPPPPPPPPPPPPPPPPPPSAPQQVQLPVSLDLPLFPSI 2052 [41][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/39 (66%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNA--KSPYVSCF 707 PPP PPPPPP PPPPPPPPPP PPP T PY+ F Sbjct: 223 PPPPPPPPPPPPPPPPPPPPPPPPPPTTPCNTGPYIVFF 261 Score = 58.5 bits (140), Expect = 1e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 56.2 bits (134), Expect = 7e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +3 Query: 603 PYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P PPPPPP PPPPPPPPPP PPP +P Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPPTTP 251 [42][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 63.9 bits (154), Expect = 3e-08 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP T +P Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP +P Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPP 1433 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PP A P Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 59.3 bits (142), Expect = 8e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 555 GFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 G A P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPP-PPPPPPPPPPTPPP 1443 Score = 58.5 bits (140), Expect = 1e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPP PPPPPP PPP Sbjct: 1430 PPPPPPPPPPTPPPAPPPPPPPPPP 1454 [43][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 + FA P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 211 YSFAAPPPPP-----PPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 55.8 bits (133), Expect = 9e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +3 Query: 609 PPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSC 704 PPPPPP PPPPPPPPPP PPP P +C Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAC 247 [44][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPPPP PPP K+P V Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPV 78 Score = 56.6 bits (135), Expect = 5e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPP PPP P P T P Sbjct: 49 PPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDP 80 Score = 56.2 bits (134), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +3 Query: 609 PPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPPPPP PPPPPPPPPP PPP T P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPP 71 [45][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPPPP PPP K+P V Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPV 78 Score = 56.6 bits (135), Expect = 5e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPP PPP P P T P Sbjct: 49 PPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDP 80 Score = 56.2 bits (134), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +3 Query: 609 PPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPPPPP PPPPPPPPPP PPP T P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPP 71 [46][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 SP P PPP PPPP P PPPPPPPPPP PPP + P Sbjct: 224 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PP PPP PPPPPPPPPP PPP SP Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPP--XPPPHTNAKSPYVSCFLPN 716 PPP PPPPPP PPPPPPPPPP PPP N P PN Sbjct: 239 PPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPN 280 Score = 59.7 bits (143), Expect = 6e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+ PPP PPPPPP PPPPPP PPP PPP Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPPPP 249 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/54 (48%), Positives = 28/54 (51%), Gaps = 9/54 (16%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPH---------TNAKSPYVSC 704 P P PPP PPPPPP PPPPPPP PP P P+ T PY +C Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNNFPYCNC 287 [47][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PPP PPPPPP PPPPPPPPPP PPP P S LP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILP 51 Score = 63.2 bits (152), Expect = 6e-08 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +E PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 MEPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP P P +P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPQPSEILPAP 53 [48][TOP] >UniRef100_B6AF23 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AF23_9CRYT Length = 876 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPN 716 P PL PP +PPPPPP PPPPPPPPPP PPP +++ S S LPN Sbjct: 180 PSPPLY--PPPLHPPPPPPPPPPPPPPPPPPPPPSSHSSS---STHLPN 223 [49][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 SP P PPP PPPP P PPPPPPPPPP PPP + P Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPPP PPPP PPPPP PPP Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPP PPP PPP Sbjct: 251 PSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PP PPPPPPP PPP Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PPP PPPPPP PPPPPPPPPP P P K P S +P Sbjct: 274 PPPSPPPPPP-PPPPPPPPPPPPSPSPPRKPPSPSPPVP 311 Score = 57.0 bits (136), Expect = 4e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP P PPPP PPPPPPPPPP PP + + P Sbjct: 272 PPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP 303 Score = 56.6 bits (135), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP P PPPP PPPPPPPPPP P P Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSP 278 Score = 56.6 bits (135), Expect = 5e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PP PPPP P PPPPPPPPPP PPP + P Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPP 280 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P RPP PPP P PPPPPPPPPP PPP + P Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPP 281 [50][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 63.5 bits (153), Expect = 4e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP A P Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 576 DPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 850 EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 881 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+V E P PPPPPP PPPPPPPPPP PPP Sbjct: 845 PMVCEEPTTPPPPPPPPPPPPPPPPPPPPPP 875 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 853 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 935 PPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPP PPP A P Sbjct: 943 PPPPPPPPPPPPPPPPPPPPGAPPPPPPALPP 974 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/41 (58%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = +3 Query: 597 PPPYPPPPPPYPPPP----PPPPPPXPPPHTNAKSPYVSCF 707 PPP PPPPPP PPPP PPPPPP PP P + CF Sbjct: 946 PPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPALPCF 986 [51][TOP] >UniRef100_Q4THH6 Chromosome undetermined SCAF2934, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4THH6_TETNG Length = 300 Score = 63.5 bits (153), Expect = 4e-08 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFL 710 PPP PPPPPP PPPPPP PPP PPP KS SC L Sbjct: 261 PPPAPPPPPPPPPPPPPTPPPPPPPPPERKSEKNSCKL 298 [52][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 63.5 bits (153), Expect = 4e-08 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 PPP PPPPPP PPPPPPPPPP PP + PY+ F Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPAPVCQQGPYIVFF 253 Score = 58.5 bits (140), Expect = 1e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 215 PPPPPPPPPPPPPPPPPPPPPPPP 238 Score = 57.0 bits (136), Expect = 4e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +3 Query: 603 PYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P PPPPPP PPPPPPPPPP PPP +P Sbjct: 213 PVPPPPPPPPPPPPPPPPPPPPPPPPPPAP 242 [53][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 63.5 bits (153), Expect = 4e-08 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +3 Query: 576 DPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 + +V+E PPP PP PPP PPPPPPPPPP PPP Sbjct: 48 EKMVIELPPPLPPAPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 PL PPP PPPPPP PPPPPPPPPP PPP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFL 710 PPP PPPPPP PPPPPPPPP PPP + ++ ++ L Sbjct: 82 PPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLHLELIL 119 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPP 104 [54][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 63.5 bits (153), Expect = 4e-08 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PPP PPPPPP PPPPPPPPPP PPP S + S +P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIP 538 Score = 62.8 bits (151), Expect = 8e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 F P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 483 FSHLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +3 Query: 582 LVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 LV P PPPPPP PPPPPPPPPP PPP Sbjct: 481 LVFSHLSPPPPPPPPPPPPPPPPPPPPPPP 510 [55][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 63.5 bits (153), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +3 Query: 573 GDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKS 689 G P PPP PPPPPP PPPPPPPPPP PPP S Sbjct: 492 GGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPPPSVTLSS 530 [56][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 63.5 bits (153), Expect = 4e-08 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP + P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYP 54 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 PPP PPPPPP PPPPPPPPPP PPP ++ Y Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRY 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 6e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPP 671 R PP PPPPPP PPPPPPPPPP PPP Sbjct: 1 RVPPPPPPPPPPPPPPPPPPPPPPPP 26 [57][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 63.5 bits (153), Expect = 4e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PPP N Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPENN 35 Score = 63.2 bits (152), Expect = 6e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PPP PPPPPP PPPPPPPPPP PPP YV P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQADPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 [58][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 63.5 bits (153), Expect = 4e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 582 LVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 L+ RPPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 LLPPRPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PPP N Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPLPPPPRN 104 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/46 (58%), Positives = 28/46 (60%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIPL 734 PPP PPPPPP PPPPPPPPPP PPP P P + IPL Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPL 108 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPP 86 [59][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/52 (55%), Positives = 31/52 (59%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIPL 734 P L PPP PPPPPP PPPPPPPPPP PPP P +P+ IPL Sbjct: 980 PNGLSPPPPPPPPPPPPPPPPPPPPPPPPPP---PPPPGFKGIIPSSSGIPL 1028 [60][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 63.5 bits (153), Expect = 4e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP SP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSP 90 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP + P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +3 Query: 573 GDPLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 G P L PPP PPPPPP PPPPPPPPPP PP Sbjct: 57 GVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 59.3 bits (142), Expect = 8e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 PL PPP PPPPPP PPPPPPPPPP PP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPP 91 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPP PP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPP PPP PPP Sbjct: 72 PPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPP PPPP PPP Sbjct: 73 PPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPP PPPPP PPP Sbjct: 74 PPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPP PPPPPP PPP Sbjct: 75 PPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PP PPPPPPP PPP Sbjct: 76 PPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPPPPP PPPPPPPPPP PPP + P Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 56.6 bits (135), Expect = 5e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNA 683 PPP PPPPPP P PPPPPPPP PP +A Sbjct: 77 PPPPPPPPPPPPSPPPPPPPPPPPQRRDA 105 [61][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 63.2 bits (152), Expect = 6e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 165 SPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 161 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 PPP PPPPPP PPPPPPPPPP PP NA+ Sbjct: 179 PPPPPPPPPPPPPPPPPPPPPPPPVDRNAR 208 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPP PPPPPPPPPP PPP Sbjct: 159 SPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 193 Score = 59.3 bits (142), Expect = 8e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PP PPP PPPPPPPPPP PPP Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPP PPP Sbjct: 153 PPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPP 186 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPP PP PPPPPPPPPP PPP Sbjct: 157 PPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 190 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PP PPPPPP PPPPPPPPPP PPP Sbjct: 164 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P P P PPPPPP PPPPPPPPPP PPP Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 57.0 bits (136), Expect = 4e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P +P PPP PPPPPP PPPPP PPP PPP Sbjct: 125 PPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPP 158 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 C P P PPP PPP PP PP PPPPPPP PPP + P Sbjct: 130 CPPPPP---PSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPP 169 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPP PPPPPPP PP PPP Sbjct: 145 SPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPP 179 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPP P PPPPPPPP PPP Sbjct: 151 SPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPP 185 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPP PPP PPP Sbjct: 139 PPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPP 172 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPP PP PP PPPPPPP PPP Sbjct: 143 PPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPP 176 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPP PPPPPP PPP PPP Sbjct: 147 PPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPP 180 [62][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [63][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [64][TOP] >UniRef100_UPI0000D9E82E PREDICTED: similar to additional sex combs like 1 isoform 4 n=1 Tax=Macaca mulatta RepID=UPI0000D9E82E Length = 2250 Score = 63.2 bits (152), Expect = 6e-08 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 3/44 (6%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYP---PPPPPPPPPXPPPHTNAKSP 692 P LV PPP PPPPPP P PPPPPPPPP PPP NA+ P Sbjct: 2010 PNKALVHPPPPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVP 2053 [65][TOP] >UniRef100_UPI0000D9E82D PREDICTED: similar to additional sex combs like 1 isoform 2 n=3 Tax=Macaca mulatta RepID=UPI0000D9E82D Length = 2249 Score = 63.2 bits (152), Expect = 6e-08 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 3/44 (6%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYP---PPPPPPPPPXPPPHTNAKSP 692 P LV PPP PPPPPP P PPPPPPPPP PPP NA+ P Sbjct: 2009 PNKALVHPPPPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVP 2052 [66][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 1492 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1524 [67][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 1488 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1520 [68][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 1488 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 1520 [69][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [70][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [71][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [72][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 63.2 bits (152), Expect = 6e-08 Identities = 34/76 (44%), Positives = 37/76 (48%), Gaps = 11/76 (14%) Frame = +3 Query: 522 SGYYAETD*GFGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP--- 692 S Y A T G F+C+P P PPP PPPPP PPPP PPPP PPP P Sbjct: 1156 STYLAGTVMGKYFSCNPPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPL 1215 Query: 693 --------YVSCFLPN 716 YVS F P+ Sbjct: 1216 IPGGWKGQYVSIFPPD 1231 Score = 59.7 bits (143), Expect = 6e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PP PPPPPP PPPPPPPPPP PPP + P Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPP 235 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P L PPP PPPP P PP PPPPPPP PPP + P Sbjct: 208 PPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPP 248 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/46 (54%), Positives = 25/46 (54%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 P P PPP P PPPP PPPPPPP PP PPP SCF Sbjct: 224 PSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTGRSCF 269 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPP P PPPPP PPPP PPP Sbjct: 225 SPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/34 (67%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = +3 Query: 597 PPPYPPPPPPYP--PPPPPPPPPXPPPHTNAKSP 692 PPP PPPP P+P PPPP PPPP PPP T SP Sbjct: 2253 PPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSP 2286 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPP---PPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPP PP PPP PPPPPP PPP SP Sbjct: 2259 PPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSP 2302 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFD 722 SP P PPP PP PPP PPPP PPPP PPP S C FD Sbjct: 2276 SPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPPPCHQVWFD 2327 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 CSP P PP PP PPP PPPP PPPP PPP + SP Sbjct: 2527 CSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSP 2569 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/46 (52%), Positives = 25/46 (54%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSC 704 SP PL PP P PPPP PPP PPPP P P P + PY C Sbjct: 2544 SPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPPC 2589 [73][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 63.2 bits (152), Expect = 6e-08 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP +P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPAAKPSAP 95 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 RP P PPPPPP PPPPPPPPPP PPP AK Sbjct: 61 RPTPPPPPPPPPPPPPPPPPPPPPPPPPAAK 91 [74][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 63.2 bits (152), Expect = 6e-08 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 582 LVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +V+ PPP PPPPPP PPPPPPPPPP PPP Sbjct: 74 IVIPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 62.8 bits (151), Expect = 8e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSC 704 PPP PPPPPP PPPPPPPPPP PPP P +C Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTC 117 Score = 62.8 bits (151), Expect = 8e-08 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSC 704 PPP PPPPPP PPPPPPPPPP PPP P C Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPC 119 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPP 105 [75][TOP] >UniRef100_A8ISR1 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8ISR1_CHLRE Length = 2032 Score = 63.2 bits (152), Expect = 6e-08 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHT 677 FG C + PPP PPPPPP PPPPPPP PP PPP T Sbjct: 1783 FGMQCLGNASYDVSPPPPSPPPPPPSPPPPPPPSPPPPPPPT 1824 [76][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 573 GDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 GD + +PPP PPPPPP PPPPPPPPPP PPP Sbjct: 92 GDGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPP 124 Score = 62.8 bits (151), Expect = 8e-08 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 L+ PPP PPPPPP PPPPPPPPPP PPP Sbjct: 98 LQPPPPPPPPPPPPPPPPPPPPPPPPPP 125 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKS 689 PPP PPPPPP PPPPPPPPPP PPP +A++ Sbjct: 102 PPPPPPPPPPPPPPPPPPPPPPPPPPGSAEA 132 [77][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 63.2 bits (152), Expect = 6e-08 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 AC P + PPP PPPPPP PPPPPPPPPP PPP Sbjct: 43 ACQPICCVPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 49 CVPAPP----PPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/44 (56%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = +3 Query: 564 CSPG-DPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 C+P P+ PP PPPPPP PPPPPPPPPP PPP + P Sbjct: 40 CAPACQPICCVPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQP 83 [78][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 63.2 bits (152), Expect = 6e-08 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 A SP P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 42 AHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPQWEPADP 105 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PP A P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPQWEPADPP 106 [79][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 PPP PPPPPP PPPPPPPPPP PPP P + F Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLSALF 110 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPP 97 [80][TOP] >UniRef100_B2KTD4 Minicollagen 1 n=1 Tax=Clytia hemisphaerica RepID=B2KTD4_9CNID Length = 149 Score = 63.2 bits (152), Expect = 6e-08 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 AC+P V PPP PPPPPP PPPPPPPPPP PP Sbjct: 40 ACAPACAPVCCAPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPAPIP 79 [81][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P V PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1027 PAVTAVPPPPPPPPPPPPPPPPPPPPPPPPP 1057 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNA 683 PPP PPPPPP PPPPPPPPPP PPP +A Sbjct: 1034 PPPPPPPPPPPPPPPPPPPPPPPPPPMSA 1062 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 7/51 (13%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPP-------PPPPPXPPPHTNAKSP 692 A P P PPP PPPPPP PPPPP PPPPP PPP SP Sbjct: 1031 AVPPPPPPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMSP 1081 [82][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 63.2 bits (152), Expect = 6e-08 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PG P PPP PPPPPP PPPPPPPPPP PPP P++ Sbjct: 268 PGPP---PPPPPPPPPPPPPPPPPPPPPPPPPPPPFILPPPFI 307 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 PGDP P PPPPPP PPPPPPPPPP PPP Sbjct: 258 PGDPFQEITGPGPPPPPPPPPPPPPPPPPPPPPP 291 [83][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [84][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [85][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2366 [86][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 63.2 bits (152), Expect = 6e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +PPP PPPPPP PPPPPPPPPP PP T+ K P Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPP 2336 [87][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 62.8 bits (151), Expect = 8e-08 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 PL PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PLPPPPPPPRPPPPPPPPPPPPPPPPPPPPP 47 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPP 671 RPPP PPPPPP PPPPPPPPPP P P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPLP 51 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P L PPP P PPPP PPPPPPPPPP PPP Sbjct: 15 PPPLPPPPPPPRPPPPPPPPPPPPPPPPPPP 45 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPPPPP PPPPPPPPPP PPP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXP 665 P P PPP PPPPPP PPPPPPPPPP P Sbjct: 20 PPPPPPRPPPPPPPPPPPPPPPPPPPPPPPLP 51 [88][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 62.8 bits (151), Expect = 8e-08 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 L PPP PPPPPP PPPPPPPPPP PPP ++P Sbjct: 1474 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPRTP 1508 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 PL PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1503 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 1472 PPLPPPPPPPPPPPPPPPPPPPPP 1495 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 E PP PPPPPP PPPPPPPPPP PPP Sbjct: 1470 ETPPLPPPPPPPPPPPPPPPPPPPPPP 1496 [89][TOP] >UniRef100_UPI0000EE3DB8 zinc finger homeodomain 4 n=1 Tax=Homo sapiens RepID=UPI0000EE3DB8 Length = 3571 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCI 728 L+ PPP PPPPPP PPPPPPPPPP PP VS LP F I Sbjct: 1990 LQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVSLDLPLFPSI 2036 [90][TOP] >UniRef100_UPI00004576BB Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Homo sapiens RepID=UPI00004576BB Length = 3567 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCI 728 L+ PPP PPPPPP PPPPPPPPPP PP VS LP F I Sbjct: 1990 LQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVSLDLPLFPSI 2036 [91][TOP] >UniRef100_C5CX67 FHA domain containing protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CX67_VARPS Length = 645 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/54 (51%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +3 Query: 561 ACSPGDPLV---LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 A P +P V +E PP PPPPPP PPPPPPPPPP PP +P V P Sbjct: 361 AAKPAEPRVSAQVEPPPSAPPPPPPPPPPPPPPPPPPPPAPVPVAAPRVENVAP 414 [92][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 62.8 bits (151), Expect = 8e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPPPP PPP SP + Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPVETSPKI 505 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 SP P PPP PPPPPP PPPPPPPPP PP T+ K Sbjct: 467 SPPPPPPPPPPPPPPPPPPP--PPPPPPPPPPPPVETSPK 504 [93][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 62.8 bits (151), Expect = 8e-08 Identities = 26/48 (54%), Positives = 30/48 (62%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFL 710 SP P PPP PPPPPP PPPPPPPPPP P P T + P + ++ Sbjct: 504 SPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIPGYI 551 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNF 719 PP PPPPPP PPPPPPPPPP PPP + +P V +P + Sbjct: 510 PPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIPGY 550 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 P P PPP P PPPP PPPPPPPPPP PPP SP P Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRP 545 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPP PP PPP + P Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 58.5 bits (140), Expect = 1e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPP PP PPP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPP PP PPPPPPPPPP PPP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PP PPP PPPPPPPPPP PPP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +3 Query: 597 PPPYPPPPPPY--PPPPPPPPPPXPPPHTNAKSPYVSCFLPN 716 PPP PPPPPP PPPPPPPPPP PPP P S P+ Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPS 542 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPP PPPPPP PPP PPP Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 [94][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 62.8 bits (151), Expect = 8e-08 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPPP PPPPPPPPPP PPP + P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P PL PPP PP PPP PPPPPPPPPP PPP Sbjct: 217 APPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPP 251 Score = 61.6 bits (148), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PPP PPPPPP PPP PPPPPP PPP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 59.3 bits (142), Expect = 8e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPP PPPPPP PPP Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 Score = 59.3 bits (142), Expect = 8e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPP PP PPPPPPPPPP PPP Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PP PPPPPP PPPPPPPPPP PPP + P Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPP PPPP PPP Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPP PPP PPP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PP PPPPPPP PPP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP P PPPPPPPP PPP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPP PPP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPP PPPPPPPPPP PPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPP 291 [95][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 62.8 bits (151), Expect = 8e-08 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P PL PPP PP PPP PPPPPPPPPP PPP + P Sbjct: 251 PPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPP 291 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 SP P L PP PPPP P PPPPPPPPPP PPP + P Sbjct: 248 SPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 289 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PP PPPPPP PPPPPPPPPP PPP Sbjct: 247 PSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPP 280 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 SP P PP PPPP P PP PPPPPPP PPP Sbjct: 235 SPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPP 269 Score = 55.8 bits (133), Expect = 9e-06 Identities = 27/67 (40%), Positives = 29/67 (43%), Gaps = 21/67 (31%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPP---------------------PPPPXPPPHTNA 683 SP P PPP PPPPPP PPPPPP PPPP PPP + Sbjct: 258 SPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKRPPPPAPPPPPRS 317 Query: 684 KSPYVSC 704 P+ C Sbjct: 318 DFPFCQC 324 [96][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 62.8 bits (151), Expect = 8e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 E PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 ETPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSC 704 PPP PPPPPP PPPPPPPPPP PPP P C Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPC 65 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+ R P PPPPPP PPPPPPPPPP PPP Sbjct: 9 PVASTRETPPPPPPPPPPPPPPPPPPPPPPP 39 [97][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 62.8 bits (151), Expect = 8e-08 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP ++P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 5e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP P ++P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAP 47 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKS 689 PPP PPPPPP PPPPPPPPPP P A S Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPLRAPKGRAPS 48 [98][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 62.8 bits (151), Expect = 8e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 E PP PPPPPP PPPPPPPPPP PPP T + P Sbjct: 143 EPAPPPPPPPPPPPPPPPPPPPPPPPPPTTLEPP 176 Score = 62.8 bits (151), Expect = 8e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP PPP T P Sbjct: 146 PPPPPPPPPPPPPPPPPPPPPPPPPTTLEPPP 177 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = +3 Query: 573 GDPLVLERPPPYPPPPPPYPPPPPPPPP-----PXPPPHTNAKSP 692 G+P PPP PPPPPP PPPPPPPPP P PPP T+++ P Sbjct: 142 GEPAPPPPPPPPPPPPPPPPPPPPPPPPPTTLEPPPPPPTSSEPP 186 Score = 57.4 bits (137), Expect = 3e-06 Identities = 29/67 (43%), Positives = 34/67 (50%), Gaps = 7/67 (10%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPP----PPPPPP---XPPPHTNAKSPYVSCFL 710 FG P P PPP PPPPPP PPPP PPPPPP PPP + + S + Sbjct: 141 FGEPAPPPPPPPPPPPPPPPPPPPPPPPPPTTLEPPPPPPTSSEPPPPPSTSATPTSSAV 200 Query: 711 PNFDCIP 731 P+ +P Sbjct: 201 PSSSVVP 207 [99][TOP] >UniRef100_Q86UP3 Zinc finger homeobox protein 4 n=1 Tax=Homo sapiens RepID=ZFHX4_HUMAN Length = 3567 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCI 728 L+ PPP PPPPPP PPPPPPPPPP PP VS LP F I Sbjct: 1990 LQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVSLDLPLFPSI 2036 [100][TOP] >UniRef100_C1N329 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N329_9CHLO Length = 1456 Score = 62.8 bits (151), Expect = 8e-08 Identities = 44/96 (45%), Positives = 47/96 (48%), Gaps = 11/96 (11%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG---------LQANPKP*SVSA**PDQ 518 GGG GGGGGGGGGG GGGGGG G G T G G A P S S Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGSGDGNLPTGGGGGRAGAGACLARDAAAAPASGSG---GG 322 Query: 517 VQTDPWILITNQDDPDP*PSD--SPPPR*TSPDSTS 416 + D + DD P P+D SPPPR TSPD S Sbjct: 323 EEKDADAAARDGDDATP-PNDSASPPPRETSPDDDS 357 [101][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P V+ PPP PPPPPP PPPPPPPPPP PPP Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPP 262 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PPP PPPPPP PPPPPPP PP PPP P S LP Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLP 292 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PPP PPPPPP PPPPP PPPP PPP P + LP Sbjct: 256 PPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLP 294 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPP 274 [102][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/55 (50%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPP-PPPXPPPHTNAKSPYVSCFLPNFDCI 728 +P P +PPP PPPPPP PPPPPPP PPP PPP P PN D + Sbjct: 86 APSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPPPTPPPTPPPTPPPTPNPDAV 140 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/41 (56%), Positives = 26/41 (63%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P++ PP PP PP PPPPPPPPPP PPP T +P Sbjct: 79 PPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTP 119 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIPL 734 PPP PPPPPP PPP PPP PP PP T +P +P PL Sbjct: 104 PPPPPPPPPPTPPPTPPPTPPPTPPPTPPPTPNPDAVIPPITRPPL 149 [103][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 + FA P PPP PPPPPP PPPPPPPPPP PPP P Sbjct: 226 YSFAAPPA-------PPPPPPPPPPPPPPPPPPPPPPPPPPEETTPP 265 [104][TOP] >UniRef100_A4TTR4 Putative uncharacterized protein n=1 Tax=Magnetospirillum gryphiswaldense RepID=A4TTR4_9PROT Length = 118 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 5/37 (13%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPP-----PPPXPPPHTNAKSP 692 PPP PPPPPPYPPPPPPP PPP PPP + SP Sbjct: 33 PPPLPPPPPPYPPPPPPPPSPILPPPAPPPSPLSSSP 69 [105][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 + PPP PPPPPP PPPPPPPPPP PPP +P Sbjct: 229 DAPPPPPPPPPPPPPPPPPPPPPPPPPPAPEPAP 262 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 PPP PPPPPP PPPPPPPPPP P P PY+ F Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPAPEPAPCNTGPYIVFF 272 [106][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PP PPPPPP PPPP PPPPP PPP +KSP Sbjct: 40 PSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPPPPPPPSKSP 80 [107][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPPPP PPP + Y+ Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYM 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 [108][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHT 677 PPP PPPPPP PPPPPPPPPP PPP T Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPT 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 [109][TOP] >UniRef100_B4M7B5 GJ16487 n=1 Tax=Drosophila virilis RepID=B4M7B5_DROVI Length = 880 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/46 (54%), Positives = 30/46 (65%) Frame = +3 Query: 552 FGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKS 689 + ACS + +E PPP PPPPPP PPPPPPPPPP P ++ S Sbjct: 171 YASACSLEPAVDMETPPPPPPPPPPPPPPPPPPPPPPPESASSCSS 216 [110][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 PPP PPPPPP PPPPPPPPPP PPP A+ Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPRRAR 62 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 LTPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 +P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 [111][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 249 PPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPCPPP 286 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPP--PPPXPPP 671 C P P PPP PPPPPP PPPPPPP PPP PPP Sbjct: 253 CPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPP 290 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPP--PPPPPPPPXPPP 671 C P P PPP PPPPPP PP PPPPPPPP PPP Sbjct: 294 CPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPP 331 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPP PPP Sbjct: 284 PPPCPPPPPPCPPPPPPPPPCPPPP 308 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPP PP PPPPPPPPPP PPP Sbjct: 288 PPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPP 321 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/52 (50%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPP-----PPPPPPPXPPPHTNAKSPYVSC 704 C P PPP PPPPPP PPP PPPPPPP PPP P C Sbjct: 232 CPSAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPC 283 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPP PPPPPP PPP Sbjct: 273 PPPPPPPPPPCPPPCPPPPPPCPPP 297 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 C P P PP PPPPPP PPPPPPPPPP PP Sbjct: 283 CPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPP 317 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PP PPP PPPPPPPPP PPP Sbjct: 287 CPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPP 322 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +3 Query: 597 PPPYPPPPPPYPP--PPPPPPPPXPPPHTNAKSPYVSC 704 PPP PPPPPP PP PPPPPPPP PPP P C Sbjct: 291 PPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPC 328 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C P P PPP PPPPPP PP PPP PPP PPP Sbjct: 304 CPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPP 339 [112][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 62.0 bits (149), Expect = 1e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHT 677 PPP PPPPPP PPPPPPPPPP PP H+ Sbjct: 2805 PPPTPPPPPPPPPPPPPPPPPPPPQHS 2831 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPP P PPPPPPPPPP PPP Sbjct: 2800 PPPPPPPPTPPPPPPPPPPPPPPPP 2824 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPP PP PPPPPPPPPP PPP Sbjct: 2801 PPPPPPPTPPPPPPPPPPPPPPPPP 2825 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PP PPP PPPPPPPPPP PPP Sbjct: 2802 PPPPPPTPPPPPPPPPPPPPPPPPP 2826 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP P PPPP PPPPPPPPPP PPP Sbjct: 2803 PPPPPTPPPPPPPPPPPPPPPPPPP 2827 [113][TOP] >UniRef100_UPI0000E1F767 PREDICTED: formin-like 2 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F767 Length = 994 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+V PP PPPPPP PPPPPPPPPP PPP Sbjct: 444 PVVASVTPPMPPPPPPPPPPPPPPPPPPPPP 474 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 451 PPMPPPPPPPPPPPPPPPPPPPPPP 475 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPLPGP 479 [114][TOP] >UniRef100_UPI0000E1F766 PREDICTED: formin-like 2 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E1F766 Length = 1026 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+V PP PPPPPP PPPPPPPPPP PPP Sbjct: 495 PVVASVTPPMPPPPPPPPPPPPPPPPPPPPP 525 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPP 526 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPLPGP 530 [115][TOP] >UniRef100_UPI0000E1F765 PREDICTED: formin-like 2 isoform 7 n=1 Tax=Pan troglodytes RepID=UPI0000E1F765 Length = 1045 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+V PP PPPPPP PPPPPPPPPP PPP Sbjct: 495 PVVASVTPPMPPPPPPPPPPPPPPPPPPPPP 525 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPP 526 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPLPGP 530 [116][TOP] >UniRef100_UPI0000E1F763 PREDICTED: formin-like 2 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F763 Length = 1037 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+V PP PPPPPP PPPPPPPPPP PPP Sbjct: 495 PVVASVTPPMPPPPPPPPPPPPPPPPPPPPP 525 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPP 526 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPLPGP 530 [117][TOP] >UniRef100_UPI00005A3937 PREDICTED: similar to formin-like 2 isoform B n=1 Tax=Canis lupus familiaris RepID=UPI00005A3937 Length = 1119 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+V PP PPPPPP PPPPPPPPPP PPP Sbjct: 569 PVVASVTPPMPPPPPPPPPPPPPPPPPPPPP 599 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPLPGP 603 [118][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 S G P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 648 SVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 PPP PPPPPP PPPPPPPPPP PPP A + Sbjct: 660 PPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAF 692 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 659 PPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 +P P PPP PPPPPP PPPPPPPPPP PP Sbjct: 651 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 [119][TOP] >UniRef100_B9PQH8 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9PQH8_TOXGO Length = 137 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 7/55 (12%) Frame = +3 Query: 573 GDPLVLERPPP-------YPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPN 716 GDP +L P P +PPPPPP PPPPPPPPPP PP +P + LP+ Sbjct: 59 GDPRLLHFPAPSFPHLFAFPPPPPPCPPPPPPPPPPPPPGRIPEPTPNTNPLLPS 113 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/45 (55%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPP---PXPPPHTNAKSP 692 +P P + PPP PP PPP PPPPPPPPP P P P+TN P Sbjct: 68 APSFPHLFAFPPPPPPCPPPPPPPPPPPPPGRIPEPTPNTNPLLP 112 [120][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFL 710 PPP PPPPPP PPPPPPPPPP PPP P C L Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCNL 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 [121][TOP] >UniRef100_P08001 Acrosin heavy chain n=1 Tax=Sus scrofa RepID=ACRO_PIG Length = 415 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 PPP PPPPPP PPPPPPPPPP PP +AK P F Sbjct: 344 PPPAPPPPPP-PPPPPPPPPPPPPQQVSAKPPQALSF 379 [122][TOP] >UniRef100_UPI0001796908 PREDICTED: zinc finger homeobox 4 n=1 Tax=Equus caballus RepID=UPI0001796908 Length = 3574 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/47 (59%), Positives = 30/47 (63%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCI 728 L+ PPP PPPPPP PPPPPPPPPP P + P VS LP F I Sbjct: 1994 LQAPPPTPPPPPPPPPPPPPPPPPPPSAPPQVQLP-VSLDLPLFPSI 2039 [123][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 LPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPRP 58 [124][TOP] >UniRef100_UPI0000E24CFF PREDICTED: KIAA1713 n=1 Tax=Pan troglodytes RepID=UPI0000E24CFF Length = 2197 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYP-PPPPPPPPPXPPPHTNAKSP 692 P LV PPP PPPPPP PPPPPPPPP PPP NA+ P Sbjct: 1959 PNKALVHPPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVP 2000 [125][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFD 722 PPP PPP PP PPPPPPPPPP PPP A + C +D Sbjct: 474 PPPVPPPTPPPPPPPPPPPPPPPPPPVKAPPIVIICCSTCYD 515 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 E+PPP PPP P PPPPPPPPPP PPP P V Sbjct: 471 EKPPPPVPPPTPPPPPPPPPPPPPPPPPPVKAPPIV 506 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +3 Query: 570 PGDPLVLERPPPYP-PPPPPYPPPPPPPPPPXPPP 671 P P L PPP P PPP P PPPPPPPPPP PPP Sbjct: 372 PPPPPPLPPPPPRPVPPPAPPPPPPPPPPPPRPPP 406 Score = 55.8 bits (133), Expect = 9e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P PL P P PPP PP PPPPPPPPP PPP + P Sbjct: 374 PPPPLPPPPPRPVPPPAPPPPPPPPPPPPRPPPPPAIVRPP 414 [126][TOP] >UniRef100_UPI0000DA3E0C PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3E0C Length = 542 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFD 722 PPP PPP PP PPPPPPPPPP PPP A + C +D Sbjct: 412 PPPVPPPTPPPPPPPPPPPPPPPPPPVKAPPIVIICCSTCYD 453 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 E+PPP PPP P PPPPPPPPPP PPP P V Sbjct: 409 EKPPPPVPPPTPPPPPPPPPPPPPPPPPPVKAPPIV 444 [127][TOP] >UniRef100_UPI00001809D7 UPI00001809D7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI00001809D7 Length = 3593 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/47 (59%), Positives = 30/47 (63%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCI 728 L+ PPP PPPPPP PPPPPPPPPP P + P VS LP F I Sbjct: 2015 LQAPPPTPPPPPPPPPPPPPPPPPPPSAPPQVQLP-VSLDLPLFPSI 2060 [128][TOP] >UniRef100_UPI000184A164 Bromodomain-containing protein 4 (HUNK1 protein). n=1 Tax=Canis lupus familiaris RepID=UPI000184A164 Length = 1361 Score = 61.6 bits (148), Expect = 2e-07 Identities = 64/232 (27%), Positives = 85/232 (36%), Gaps = 28/232 (12%) Frame = +3 Query: 597 PPPYPPPPPPY-------PPPPPPPPPP--------XPPPHTNAKSPYVSCFLPNFDCIP 731 PP PPPPPP PPPPPP PP PPP A+ P + LP P Sbjct: 760 PPQQPPPPPPPQQQQQAPPPPPPPSIPPQAAPTMKSSPPPFIAAQVPVLEPQLPGSVFDP 819 Query: 732 L*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFLFPP--------LNQ----- 872 + ++ + HL + P L P LNQ Sbjct: 820 I---------------------GHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHSVVS 858 Query: 873 TPLVRQTNSRMPLNPSSFSHSLFLNPKGPPISIIFTIDPPLRTRHPQP*MMQTPPIYYYK 1052 P + + P PS+ + +L P PP PPL PQP M Q P + + Sbjct: 859 PPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALAQPPLL---PQPPMAQPPQVLLQE 915 Query: 1053 HYH**PSP*LNPSDTLPSTLTALNFKKSQGIPLALVPSTKIFTTIPPPPISP 1208 P P ++ L +K Q P L+PS K+ + PPPP+ P Sbjct: 916 D----EEPPAPPLTSMQMQLYLQQLQKVQP-PTPLLPSVKV-QSQPPPPLPP 961 [129][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 61.6 bits (148), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 255 PPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/57 (50%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +3 Query: 570 PGDPLVLERPPPYP---PPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIP 731 P P RPPP P PPPPP PPPPPPPPPP PPP P LP P Sbjct: 232 PSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFP 288 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/45 (57%), Positives = 27/45 (60%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIP 731 PPP PPPPPP PPPPPPP PP PPP P + LP F P Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKP 291 Score = 55.8 bits (133), Expect = 9e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 S P P P PPPPP PPPPPPPPPP PPP + P Sbjct: 227 SASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPP 268 [130][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 A +P P PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 AVNPAPP-----PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 PPP PPPPPP PPPPPPPPPP PP A P+ Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPVKLIASIPF 83 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P V P PPPPPP PPPPPPPPPP PPP Sbjct: 36 PEVTAVNPAPPPPPPPPPPPPPPPPPPPPPP 66 [131][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 61.6 bits (148), Expect = 2e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHT 677 PPP PPPPPP PPPPPPPPPP PPP + Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPQS 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 [132][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS 701 PPP PPPPPP PPPPPPPPPP PPP P S Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPS 115 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPP 104 [133][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 61.6 bits (148), Expect = 2e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 + PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 QAPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 4e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 E+ PP PPPPPP PPPPPPPPPP PPP Sbjct: 39 EQAPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.1 bits (144), Expect = 5e-07 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 PPP PPPPPP PPPPPPPPPP PP T+ Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPKKTS 70 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPPPP P ++ K V Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPKKTSDTKKKIV 77 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 PPP PPPPPP PPPPPPPPPP T K Y Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPKKTSDTKKKIVY 78 [134][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 840 LPPPPPPPPPPPPPPPPPPPPPPPPPPP 867 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 558 FACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 + C P PP PPPPPP PPPPPPPPPP PPP Sbjct: 827 YPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPP 864 [135][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 918 LPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 558 FACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 + C P PP PPPPPP PPPPPPPPPP PPP Sbjct: 905 YPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPP 942 [136][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 61.6 bits (148), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 L PPP PPPPPP PPPPPPPPPP PPP Sbjct: 918 LPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 558 FACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 + C P PP PPPPPP PPPPPPPPPP PPP Sbjct: 905 YPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPP 942 [137][TOP] >UniRef100_Q9C0F0 Putative Polycomb group protein ASXL3 n=2 Tax=Homo sapiens RepID=ASXL3_HUMAN Length = 2248 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYP-PPPPPPPPPXPPPHTNAKSP 692 P LV PPP PPPPPP PPPPPPPPP PPP NA+ P Sbjct: 2010 PNKALVHPPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVP 2051 [138][TOP] >UniRef100_Q9GP44 NONA protein (Fragment) n=1 Tax=Drosophila virilis RepID=Q9GP44_DROVI Length = 165 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 [139][TOP] >UniRef100_Q95UX5 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX5_DROVI Length = 162 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 103 [140][TOP] >UniRef100_Q95UX4 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX4_DROVI Length = 163 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 104 [141][TOP] >UniRef100_Q95UX3 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX3_DROVI Length = 161 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 102 [142][TOP] >UniRef100_Q95UX2 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX2_DROVI Length = 165 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 [143][TOP] >UniRef100_Q95UW8 No on or off transient A (Fragment) n=1 Tax=Drosophila americana texana RepID=Q95UW8_DROAE Length = 168 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 77 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 110 [144][TOP] >UniRef100_Q95UW2 No on or off transient A (Fragment) n=1 Tax=Drosophila montana RepID=Q95UW2_DROMN Length = 165 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 74 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 107 [145][TOP] >UniRef100_Q95UW1 No on or off transient A (Fragment) n=1 Tax=Drosophila kanekoi RepID=Q95UW1_DROKA Length = 159 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 100 [146][TOP] >UniRef100_Q95NU6 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NU6_DROVI Length = 163 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 104 [147][TOP] >UniRef100_Q95NR6 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NR6_DROVI Length = 165 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 [148][TOP] >UniRef100_Q95NP2 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NP2_DROVI Length = 164 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 105 [149][TOP] >UniRef100_B4M1S7 NonA n=1 Tax=Drosophila virilis RepID=B4M1S7_DROVI Length = 699 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 GGG GGGGGGGGGG GGGGGG GGGR R GS G Sbjct: 202 GGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 235 [150][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2344 PPPPPPPPPPPPPPPPPPPPPLPPP 2368 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 2342 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2372 [151][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1282 PPPPPPPPPPPPPPPPPPPPPLPPP 1306 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 1280 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 1310 [152][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2344 PPPPPPPPPPPPPPPPPPPPPLPPP 2368 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 2342 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2372 [153][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPP 668 L PPP PPPPPP PPPPPPPPPP PP Sbjct: 459 LPPPPPPPPPPPPPPPPPPPPPPPPPP 485 [154][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2347 PPPPPPPPPPPPPPPPPPPPPLPPP 2371 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 2345 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2375 [155][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2406 PPPPPPPPPPPPPPPPPPPPPLPPP 2430 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 2404 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2434 [156][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2406 PPPPPPPPPPPPPPPPPPPPPLPPP 2430 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 2404 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2434 [157][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 555 GFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 GFA P P PPP PPPPPP PPPPPPPPPP PP Sbjct: 229 GFAPPPPPPP--PPPPPPPPPPPPPPPPPPPPPPPFQPP 265 Score = 56.6 bits (135), Expect = 5e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +3 Query: 603 PYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 P PPPPPP PPPPPPPPPP PPP P+ Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPF 262 [158][TOP] >UniRef100_Q2RTE8 Putative uncharacterized protein n=1 Tax=Rhodospirillum rubrum ATCC 11170 RepID=Q2RTE8_RHORT Length = 208 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 93 PPPPPPPPPPPPPPPPPPPPPEPPP 117 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS 701 + P P PPPPPP PPPPPPPPPP PPP P+VS Sbjct: 86 IPEPEPEPPPPPPPPPPPPPPPPPPPPPE---PPPFVS 120 [159][TOP] >UniRef100_B4RDQ2 OmpA family protein n=1 Tax=Phenylobacterium zucineum HLK1 RepID=B4RDQ2_PHEZH Length = 410 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = +3 Query: 522 SGYYAETD*GFGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 SG Y ++ G S P PPP PPPPPP PPPPPPPPPP P P AK Sbjct: 252 SGEYRDSSVTLGLRYSFAAP----PPPPPPPPPPPPPPPPPPPPPPPPAPAYEAK 302 [160][TOP] >UniRef100_B1KJL7 Putative lipoprotein n=1 Tax=Shewanella woodyi ATCC 51908 RepID=B1KJL7_SHEWM Length = 508 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHT 677 +E PP PPPPPP PPPPPPPPPP PPP T Sbjct: 34 VEIAPPPPPPPPPPPPPPPPPPPPPPPPET 63 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = +3 Query: 549 GFGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXP 665 G G + +P + + + PPP PPPPPP PPPPPPPPPP P Sbjct: 23 GGGGSSTPEEKVEIAPPPPPPPPPPPPPPPPPPPPPPPP 61 [161][TOP] >UniRef100_Q9WX60 Ccp protein n=1 Tax=Gluconacetobacter xylinus RepID=Q9WX60_ACEXY Length = 329 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXP 665 P+V E PPP PPPPPP PPPPPPPPPP P Sbjct: 85 PIVEEAPPPPPPPPPPPPPPPPPPPPPAP 113 [162][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPPP PP PPPPPPP PPP N P Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P + P P PPPPPP PPPPPPPPPP PPP Sbjct: 76 PPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPP 109 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P V PPP PPPPPP PPPPPPPPP PPP Sbjct: 90 PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPP 123 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPP PPP PPP + SP Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/41 (58%), Positives = 26/41 (63%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P + PPP PPPPPP P PPPPPPPP PPP + P Sbjct: 89 PPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 SP P PPP PPPPPP PPP PPPPPP PPP + P Sbjct: 86 SPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPP 127 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPPP PPPPPPPPP PPP+ P Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 SP P P P PPPPPP PPPPP PPPP PPP SP Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSP 125 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPPP PP PPPPPPP PP + SP Sbjct: 116 PPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSP 156 Score = 55.8 bits (133), Expect = 9e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPPPPP P PPPPPPPP PPP + P Sbjct: 83 PSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 [163][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPY--PPPPPPPPPPXPPP 671 C P + +V +PPP PPPPPP PPPPPPPPPP PPP Sbjct: 194 CCPQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPP 231 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPPP PPPPPPPP P PPP + SP Sbjct: 233 PPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSP 273 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPP PPPPPPPPPP PPP SP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPP PPPPP PPP + P Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PP Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 242 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPPP PPPPPPPPPP PP Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/53 (50%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPN-FDC 725 P P PPP PPPP P PPPPPP P P PPP + P F+P FDC Sbjct: 244 PPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFVPGFFDC 296 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPP PPPPPPPPPP PPP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPP PP PPPPPPPP P PPP + SP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSP 264 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPP PPPPP PPPP PPP + P Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP P PPPP PPPPPP PPP PPP + + P Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPP PPPPP PPPP PPP + P Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 [164][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPTPPP 443 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPP PPP SP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPTPPPPPPRPPSP 451 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPP PP PPP + P Sbjct: 422 PPPPPPPPPPPPPPPPPPTPPPPPPRPPSPPP 453 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPP P PPP P V Sbjct: 421 PPPPPPPPPPPPPPPPPPPTPPPPPPRPPSPPPV 454 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +3 Query: 558 FACSPGDPLVLERPPPYPPPPPPYPPPPPPPP-PPXPPP 671 FA +P P PPP PPPPPP P PPPPPP PP PPP Sbjct: 415 FAAAPPPPPPPPPPPPPPPPPPPPPTPPPPPPRPPSPPP 453 Score = 56.2 bits (134), Expect = 7e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PP PPPPPP PPPPPPPPPP PP + P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPTPPPPPPRPP 449 [165][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/48 (56%), Positives = 28/48 (58%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFD 722 P L PPP PPP PP PPP PPP PP PPPH + P F P FD Sbjct: 2136 PAPLPPPPPSPPPSPP-PPPSPPPSPPAPPPHPPPEPPAPPSFPPQFD 2182 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P L PPP P PPPP PPP PPPPP PPP Sbjct: 2026 PPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPP 2059 [166][TOP] >UniRef100_C1E3W3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E3W3_9CHLO Length = 7500 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPP PPP PPP + SP Sbjct: 4464 PPPSPPPPPPSPPPPPPSPPPSPPPPSPPPSP 4495 [167][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPY 695 PPP PPPPPP PPPPPPPPPP PP A P+ Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPIKLIASIPF 83 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P V PP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PEVTAVNPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXP 665 A +P P PPP PPPPPP PPPPPPPPPP P Sbjct: 40 AVNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [168][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPP 25 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPP 79 [169][TOP] >UniRef100_A7RNZ0 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RNZ0_NEMVE Length = 370 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 4/37 (10%) Frame = +3 Query: 597 PPPYPPPPPPY----PPPPPPPPPPXPPPHTNAKSPY 695 P PYPPPPPPY PPPPPPPPPP PPP PY Sbjct: 304 PTPYPPPPPPYPEQVPPPPPPPPPPPPPPPYPYPYPY 340 [170][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPPP 2361 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2365 [171][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPPP 2361 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2365 [172][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP PPP Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPPP 2361 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAK 686 +PPP PPPPPP PPPPPPPPPP PP T+ K Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2365 [173][TOP] >UniRef100_O60885 Bromodomain-containing protein 4 n=1 Tax=Homo sapiens RepID=BRD4_HUMAN Length = 1362 Score = 61.2 bits (147), Expect = 2e-07 Identities = 66/241 (27%), Positives = 89/241 (36%), Gaps = 31/241 (12%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPP-----PPPPPPPP------------XPPPHTNAKSPYVSCF 707 P+ + PPP PPPP PP PPPPPPPP PPP + P + Sbjct: 752 PVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQ 811 Query: 708 LPNFDCIPL*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFLFPP-------- 863 LP P+ ++ + HL + P L P Sbjct: 812 LPGSVFDPI---------------------GHFTQPILHLPQPELPPHLPQPPEHSTPPH 850 Query: 864 LNQ-----TPLVRQTNSRMPLNPSSFSHSLFLNPKGPP-ISIIFTIDPPLRTRHPQP*MM 1025 LNQ P + + P PS+ + +L P PP +S T P L PQP M Sbjct: 851 LNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL----PQPPMA 906 Query: 1026 QTPPIYYYKHYH**PSP*LNPSDTLPSTLTALNFKKSQGIPLALVPSTKIFTTIPPPPIS 1205 Q P + P P ++ L +K Q P L+PS K+ + PPPP+ Sbjct: 907 QPPQVLLEDE-----EPPAPPLTSMQMQLYLQQLQKVQP-PTPLLPSVKV-QSQPPPPLP 959 Query: 1206 P 1208 P Sbjct: 960 P 960 [174][TOP] >UniRef100_C6TFE9 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=C6TFE9_SOYBN Length = 187 Score = 61.2 bits (147), Expect = 2e-07 Identities = 48/148 (32%), Positives = 69/148 (46%) Frame = +1 Query: 139 MGTAILRSHDCLQQGRFLPNDAFSIPSSQIRSRKNSNPNCKSYVNNNNHNQNRRRKRSPV 318 MGT +LR DC Q +P FS + N N N +Y N R +R V Sbjct: 1 MGTEVLRPQDCFTQRIGVPPPGFSRRRTHGAHHNNKNNNVNNYFRGNRKPTTRPEQRKRV 60 Query: 319 ANVNHNDRKQSVDRTVAPVNLVMGQVKILKRGEKLSPEKFNVVEENRKVKDLDRPDLLLG 498 D++ S+D + +L M +V IL+RGE L + E +K D +L++ Sbjct: 61 V-----DKRPSLDDSRFS-SLEMEKVTILRRGESLDSKL--KTEALKKEGD----NLVVV 108 Query: 499 STDRFGPDPVTMQKQIRVSDSPAARGIH 582 T R GPDP + KQIR+ D + R I+ Sbjct: 109 GTQRLGPDPDMVPKQIRIVDFRSGREIY 136 [175][TOP] >UniRef100_UPI0001926BAB PREDICTED: similar to mini-collagen n=1 Tax=Hydra magnipapillata RepID=UPI0001926BAB Length = 149 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C+P V PP PPPPPP PPPPPPPPPP PPP Sbjct: 39 CAPACLQVCCMAPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAP 76 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPAPLP 78 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPPP P N P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPAPLPGNPGPP 84 [176][TOP] >UniRef100_UPI0000F2C4EF PREDICTED: similar to junction-mediating and regulatory protein isoform 2 n=1 Tax=Monodelphis domestica RepID=UPI0000F2C4EF Length = 714 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHT 677 +PG V+ PPP PP PPP PPPPPPPPPP P P T Sbjct: 519 TPGTVTVVPLPPPLPPSPPPPPPPPPPPPPPPPLPTT 555 [177][TOP] >UniRef100_UPI0000F2C4EE PREDICTED: similar to junction-mediating and regulatory protein isoform 1 n=1 Tax=Monodelphis domestica RepID=UPI0000F2C4EE Length = 967 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHT 677 +PG V+ PPP PP PPP PPPPPPPPPP P P T Sbjct: 772 TPGTVTVVPLPPPLPPSPPPPPPPPPPPPPPPPLPTT 808 [178][TOP] >UniRef100_UPI00016E4781 UPI00016E4781 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4781 Length = 906 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS 701 P P PPPPPP PPPPPPPPPP PP H K+ +S Sbjct: 604 PTPRPPPPPPPPPPPPPPPPPPPPQHPEGKATPLS 638 [179][TOP] >UniRef100_B4W7V0 OmpA family protein n=1 Tax=Brevundimonas sp. BAL3 RepID=B4W7V0_9CAUL Length = 384 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +3 Query: 609 PPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFD 722 PPPPPP PPPPPPPPPP PPP A++P F+ FD Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPAPVAQAPVARQFVVYFD 283 [180][TOP] >UniRef100_Q00484 Mini-collagen n=1 Tax=Hydra sp. RepID=Q00484_9CNID Length = 149 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 C+P V PPP PPPPPP PPPPPPPPPP P P Sbjct: 41 CAPACAPVCCYPPPPPPPPPPPPPPPPPPPPPPPAP 76 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPAPLP 78 [181][TOP] >UniRef100_A5DRR5 Putative uncharacterized protein n=1 Tax=Lodderomyces elongisporus RepID=A5DRR5_LODEL Length = 996 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 8/49 (16%) Frame = +3 Query: 555 GFACSPGDPLVLERPPPYPPPPP--------PYPPPPPPPPPPXPPPHT 677 G SP P PPP PPPPP P PPPPPPPPPP PPPH+ Sbjct: 930 GNQASPPQPQPPSPPPPPPPPPPSLIPFGASPPPPPPPPPPPPPPPPHS 978 [182][TOP] >UniRef100_A5XS09 Single-stranded DNA-binding protein n=3 Tax=Burkholderia mallei RepID=A5XS09_BURMA Length = 212 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 2/40 (5%) Frame = -1 Query: 670 GGGXGGGGGGGG--GGYGGGGGGYGGGRSRTSGSPGLQAN 557 GGG GGGGGGGG GGYGGGGGGYGGGR G G +A+ Sbjct: 130 GGGGGGGGGGGGDDGGYGGGGGGYGGGRDMERGGGGGRAS 169 [183][TOP] >UniRef100_C9K0J5 Putative uncharacterized protein RAPH1 n=1 Tax=Homo sapiens RepID=C9K0J5_HUMAN Length = 1302 Score = 60.1 bits (144), Expect(2) = 3e-07 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNF 719 P +P P PPPPP PPPPPPPPPP PPP + +P P F Sbjct: 670 PYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMF 716 Score = 20.4 bits (41), Expect(2) = 3e-07 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +2 Query: 800 LLSNSSFPPSIIIYRSLSISPPKSDPPRST 889 ++ + S P I++ + + PP PP T Sbjct: 743 VMQSQSVKPQILVPPNGVVPPPPPPPPPPT 772 [184][TOP] >UniRef100_Q70E73 Ras-associated and pleckstrin homology domains-containing protein 1 n=1 Tax=Homo sapiens RepID=RAPH1_HUMAN Length = 1250 Score = 60.1 bits (144), Expect(2) = 3e-07 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNF 719 P +P P PPPPP PPPPPPPPPP PPP + +P P F Sbjct: 618 PYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMF 664 Score = 20.4 bits (41), Expect(2) = 3e-07 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +2 Query: 800 LLSNSSFPPSIIIYRSLSISPPKSDPPRST 889 ++ + S P I++ + + PP PP T Sbjct: 691 VMQSQSVKPQILVPPNGVVPPPPPPPPPPT 720 [185][TOP] >UniRef100_UPI00019829F7 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019829F7 Length = 610 Score = 58.5 bits (140), Expect(2) = 3e-07 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 8/42 (19%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPP--------PXPPPHTNAKSP 692 E PPP PPPP P PPPPPPPPP P PP H+N+ P Sbjct: 75 ESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPPPSHSNSSPP 116 Score = 21.9 bits (45), Expect(2) = 3e-07 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = +1 Query: 703 ASYPILTVFRCNFVVYKNSKSSQIVVENKYSIPIIEFFFSTFNHH 837 A IL + FVV + K V+ KY+ P + + H+ Sbjct: 151 AGVVILALVAIFFVVSRRKKKHSGVIPAKYNPPTASYSVKSNGHY 195 [186][TOP] >UniRef100_UPI0000E2427E PREDICTED: guanine nucleotide binding protein, alpha activating polypeptide O n=1 Tax=Pan troglodytes RepID=UPI0000E2427E Length = 537 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +3 Query: 573 GDPLVLERPP----PYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 GD L PP P+P PPPP PPPPPPPPPP PPP A P Sbjct: 105 GDAHALAAPPNSLPPHPAPPPPPPPPPPPPPPPPPPPAAAAAGP 148 [187][TOP] >UniRef100_UPI0000D9F166 PREDICTED: similar to guanine nucleotide binding protein, alpha activating polypeptide O n=1 Tax=Macaca mulatta RepID=UPI0000D9F166 Length = 571 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = +3 Query: 573 GDPLVLERPP----PYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 GD L PP P+P PPPP PPPPPPPPPP PPP A P Sbjct: 139 GDAHALAAPPNSLPPHPAPPPPPPPPPPPPPPPPPPPAAAAAGP 182 [188][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 60.5 bits (145), Expect = 4e-07 Identities = 44/148 (29%), Positives = 61/148 (41%), Gaps = 16/148 (10%) Frame = +3 Query: 558 FACSPGDPLVLERPPPYPPPPPPYPPP-----------PPPPPPPXPPPHTNAKSPYVSC 704 + SP P PPP PPPPPP PPP PPPPPPP PPP + P V Sbjct: 1922 YPISPSSPETPPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSAPPQVQ- 1980 Query: 705 FLPNFDCIPL*FCCI*K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFL---FPPLN-- 869 LP +PL + I++ +Q ++ P L PP++ Sbjct: 1981 -LPVSLDLPL----------------------FPPIMMQPVQHPALPPQLALQLPPMDTL 2017 Query: 870 QTPLVRQTNSRMPLNPSSFSHSLFLNPK 953 L + ++ L+P+ HS F P+ Sbjct: 2018 SADLTQLCQQQLGLDPNFLRHSQFKRPR 2045 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPP 659 +P PL+ PPP PPPPPP PPPPPPPPPP Sbjct: 3057 APSKPLLQTPPPPPPPPPPPPPPPPPPPPPP 3087 [189][TOP] >UniRef100_A5V4K4 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V4K4_SPHWW Length = 373 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 E P PPPPPP PPPPPPPPPP PPP P++ F Sbjct: 231 EPAAPPPPPPPPPPPPPPPPPPPPPPPVVETPGPFIVFF 269 [190][TOP] >UniRef100_Q3ECQ3 Uncharacterized protein At1g54215.1 n=1 Tax=Arabidopsis thaliana RepID=Q3ECQ3_ARATH Length = 169 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +3 Query: 576 DPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTN 680 DP + + PP PPPPPP PPPPPPPPPP PPP N Sbjct: 34 DPPLFPQSPPPPPPPPP-PPPPPPPPPPPPPPAVN 67 Score = 55.8 bits (133), Expect(2) = 7e-07 Identities = 24/41 (58%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +3 Query: 597 PPPYP--PPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PP +P PPPPP PPPPPPPPPP PPP A + V +P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIP 75 Score = 23.5 bits (49), Expect(2) = 7e-07 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 821 PPSIIIYRSLSISPPKSDPPRS 886 PP + + LS PP PPRS Sbjct: 79 PPVTDMIKPLSSPPPPQPPPRS 100 Score = 59.3 bits (142), Expect = 8e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXP 665 S PL + PPP PPPPPP PPPPPPPPPP P Sbjct: 32 SQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 [191][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPP-PPPPXPPPHTNAKSP 692 PG P PPP PPPPPP PPPPPP PPPP PPP + P Sbjct: 1200 PGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPP 1241 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/33 (69%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +3 Query: 597 PPPYPPPPPPYPPPP-PPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPP PPPPPP PPP + P Sbjct: 1216 PPPPPPPPPPLPPPPSPPPPPPSPPPPSPPPPP 1248 [192][TOP] >UniRef100_A4RZU2 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RZU2_OSTLU Length = 779 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPP 671 LE PP PPPPPP PPPPPPPPPP PPP Sbjct: 337 LECAPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXP 665 PL PPP PPPPPP PPPPPPPPPP P Sbjct: 336 PLECAPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 55.1 bits (131), Expect(2) = 5e-06 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS 701 PPP PPPPPP PPPPPPPPPP ++A P V+ Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPGFKLSSASMPKVA 377 Score = 21.2 bits (43), Expect(2) = 5e-06 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +2 Query: 821 PPSIIIYRSLSISP 862 PP ++ +RS+S++P Sbjct: 389 PPPVVQFRSVSLTP 402 [193][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 7/49 (14%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYP-------PPPPPPPPPXPPPHTNAKSP 692 SP PL PPP PPP PP P PPPPPPPPP PPP A +P Sbjct: 111 SPSPPLSYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAPAP 159 [194][TOP] >UniRef100_A9JZM2 Single-stranded DNA-binding protein n=1 Tax=Burkholderia mallei ATCC 10399 RepID=A9JZM2_BURMA Length = 209 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPGLQAN 557 GGG GGGGGG GGYGGGGGGYGGGR G G +A+ Sbjct: 129 GGGGGGGGGGDDGGYGGGGGGYGGGRDMERGGGGGRAS 166 [195][TOP] >UniRef100_B9HYA3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HYA3_POPTR Length = 206 Score = 60.5 bits (145), Expect = 4e-07 Identities = 53/162 (32%), Positives = 74/162 (45%), Gaps = 22/162 (13%) Frame = +1 Query: 139 MGTAILRSHDCLQQGRFLPNDAFSIPSSQIRSRKN-------SNPNC---KSYVNNNNHN 288 MGT + R DCL + I S R R SNPN SY NN+N Sbjct: 1 MGTEVARPQDCLIE---------RIRVSPCRRRNYYYGNGNVSNPNAYSTNSYCNNSNPR 51 Query: 289 QNRR-----------RKRSPVANVNHNDRKQSVDRTVAPVN-LVMGQVKILKRGEKLSPE 432 NR+ RK+ P +++ + +VD P N VM +V IL+RGE L + Sbjct: 52 FNRKPTAVRFERSGQRKKQPEPSISK--KSGTVDDLKIPRNNKVMEKVTILRRGESLDTK 109 Query: 433 KFNVVEENRKVKDLDRPDLLLGSTDRFGPDPVTMQKQIRVSD 558 + + K + + D ++ STDR GPDP + KQIR+ D Sbjct: 110 IKSSDTASLKKEQGNGGDFVVASTDRLGPDPKVVSKQIRIVD 151 [196][TOP] >UniRef100_B9HM93 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HM93_POPTR Length = 215 Score = 60.5 bits (145), Expect = 4e-07 Identities = 55/169 (32%), Positives = 81/169 (47%), Gaps = 25/169 (14%) Frame = +1 Query: 139 MGTAILRSHDCL-QQGRFLP-----------NDAFSIPSSQIRSRKNSNPNCKSYVNNNN 282 MGT +LR DCL ++ R P N F+ P+ + +NP Sbjct: 1 MGTEVLRPQDCLTERTRVSPCRRRNYYYGNGNGNFANPNVYSSNNNRNNPRFNRKPTAVR 60 Query: 283 HNQNRRRKRSPVANVNHNDRKQSVDRTV------APVNLVMGQVKILKRGEKL-----SP 429 +++ +RK+ +V+ R SVD V + N VM +V IL+RGE L S Sbjct: 61 SDRSDQRKKQSEPSVSKKSR--SVDDFVKIYKNNSSNNKVMEKVTILRRGESLDSKIKSS 118 Query: 430 EKFNVVEENRKVKDLDRPDLLLGSTDRFGPDPVTMQKQIRVSD--SPAA 570 E + ++K + + DL++ STDR GPDP T+ KQIR+ D SP A Sbjct: 119 ETASATVSSKKEQG-NGGDLVVTSTDRLGPDPKTVSKQIRIVDLRSPVA 166 [197][TOP] >UniRef100_B7PFH2 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PFH2_IXOSC Length = 120 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/52 (57%), Positives = 34/52 (65%), Gaps = 5/52 (9%) Frame = -1 Query: 709 KKQETYGDLALVCGG-----GXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPG 569 KK+ET+G + GG G GG GGGGGGGYGGGGG YGGG + GS G Sbjct: 45 KKRETFGGQSSSGGGSFGSSGGGGYGGGGGGGYGGGGGSYGGGGGGSYGSSG 96 [198][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPPPP PP N ++P + Sbjct: 339 PPPRPPPPPP-PPPPPPPPPPPPPALKNVENPMI 371 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPP PP PPPPPPPPPP PPP Sbjct: 335 PPPPPPPRPPPPPPPPPPPPPPPPP 359 Score = 57.0 bits (136), Expect = 4e-06 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PP PPPP P PPPPPPPPPP PP N ++P + Sbjct: 782 PPPPPPPRPPPPPPPPPPPPPPPALKNVENPMI 814 [199][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXP 665 +P PL L+ PPP PPPPPP PPPPPPPPPP P Sbjct: 3059 APSKPL-LQTPPPPPPPPPPPPPPPPPPPPPPP 3090 [200][TOP] >UniRef100_UPI0000D9B690 PREDICTED: similar to diaphanous 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9B690 Length = 1269 Score = 60.1 bits (144), Expect = 5e-07 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = +3 Query: 570 PGDPLVLERPPPYP----PPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIP 731 PGD + RPPP P PPPP PPPPPPPPPP PPP + + LP IP Sbjct: 615 PGDSGTIIRPPPAPGDSTTPPPPPPPPPPPPPPPPPPPLIGSVCISSTPSLPGGTAIP 672 [201][TOP] >UniRef100_A5V8M1 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V8M1_SPHWW Length = 373 Score = 60.1 bits (144), Expect = 5e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +3 Query: 603 PYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCF 707 P PPPPPP PPPPPPPPPP PPP P++ F Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPVVETPGPFIVFF 270 Score = 57.0 bits (136), Expect = 4e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P PPPPPP PPPPPPPPPP PPP ++P Sbjct: 233 PAAPPPPPPPPPPPPPPPPPPPPPPPVVETP 263 [202][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPPP PPPPPPPPPP PP + P Sbjct: 219 PSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 59.3 bits (142), Expect = 8e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP PPPPP PPPPPPPPPP PPP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPP 241 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPP PPPPPPPPPP PPP + P Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 SP P PP PPPPPP PPP PPPPPP PPP + P Sbjct: 214 SPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPP PP PPPPPPPP P PPP SP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSP 262 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 P P PPP PPPPPP PPPPPPPPP P P P S LP Sbjct: 218 PPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLP 265 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P PPP P PPPP PPPPPP PPP PPP Sbjct: 212 PPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPP 245 [203][TOP] >UniRef100_B9SPF0 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9SPF0_RICCO Length = 84 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFL 710 P+ ++PPP PPPPPP PPPPPPPP P PPP A +P+ +L Sbjct: 17 PVETQQPPP-PPPPPPQPPPPPPPPQPVPPP--AATAPFFPAYL 57 [204][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = +3 Query: 549 GFGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 G G C P P+ PPP PPPPP PPPPPPPPP PPP Sbjct: 1189 GHGDVCVPA-PVPAGPPPPLTPPPPPLPPPPPPPPPLPPPP 1228 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PP PPPPPPP PPP Sbjct: 1221 PPPLPPPPPPPPPLPPPPPPPPPPP 1245 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P PL PPP P PPPP PPPP PPPPP PPP Sbjct: 1210 PPPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPPP 1243 [205][TOP] >UniRef100_B7PLD9 Circumsporozoite protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PLD9_IXOSC Length = 188 Score = 60.1 bits (144), Expect = 5e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHT 677 PPP PPPPPP PPPPPPPPPP PP T Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPAPPSET 54 Score = 59.7 bits (143), Expect = 6e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 E PPP PPPPPP PPPPPPPPPP PP Sbjct: 25 ETPPPPPPPPPPPPPPPPPPPPPPAPP 51 [206][TOP] >UniRef100_Q7SC01 Putative uncharacterized protein n=1 Tax=Neurospora crassa RepID=Q7SC01_NEUCR Length = 1395 Score = 60.1 bits (144), Expect = 5e-07 Identities = 27/49 (55%), Positives = 29/49 (59%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 SP P + P P PPPPPP PPPPPPPPPP PP P VS +P Sbjct: 317 SPRTPSTPQLPIPTPPPPPPPPPPPPPPPPPPIPPQL---PPQVSAHIP 362 [207][TOP] >UniRef100_C1H5C0 Decaprenyl-diphosphate synthase subunit 1 n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1H5C0_PARBA Length = 533 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/46 (54%), Positives = 29/46 (63%) Frame = +3 Query: 555 GFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 G A S L + PP PPPPPP PPPPPPPPPP PP +++P Sbjct: 101 GSAVSAAQNLFSKNNPPPPPPPPPPPPPPPPPPPPPPPSLQPSQTP 146 [208][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P ++ PPP PPPPPP PPPPPP PPP PPP P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 5/40 (12%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPP-----PPPXPPPHTNAKSPYVS 701 PPP PPPPPP PPPPPPP PPP PP T A+ P +S Sbjct: 362 PPPPPPPPPPRPPPPPPPIKKGAPPPAPPKATMARFPKLS 401 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = +3 Query: 561 ACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 A S L+ PPP PPPPPP PPPPP PPPP PP A P Sbjct: 344 ATSDAPKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 [209][TOP] >UniRef100_B7QAD8 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QAD8_IXOSC Length = 164 Score = 60.1 bits (144), Expect = 5e-07 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -1 Query: 670 GGGXGGGGGGGGGGYGGGGGGYGGGRSRTSGSPGLQANPK 551 GGG GGGGGGGGGG GGGGGG GGG G G Q +PK Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGTGPQRSPK 91 [210][TOP] >UniRef100_UPI0001926BC7 PREDICTED: similar to mini-collagen isoform 3 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC7 Length = 148 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +3 Query: 564 CSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 C+P + PPP PPPPPP PPPPPPPPPP PP Sbjct: 39 CAPACLPICCVPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 57.4 bits (137), Expect = 3e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPLPLP 77 Score = 55.8 bits (133), Expect = 9e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 603 PYPPPPPPYPPPPPPPPPPXPPP 671 P PPPPPP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPP 72 [211][TOP] >UniRef100_UPI0001923DA0 PREDICTED: similar to predicted protein n=1 Tax=Hydra magnipapillata RepID=UPI0001923DA0 Length = 1853 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/43 (55%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +3 Query: 570 PGDPLVLERPPPYPP-PPPPYPPPPPPPPPPXPPPHTNAKSPY 695 P P PPP+ P PPPP PPPPPPPPPP PPP + P+ Sbjct: 1384 PSQPTYFPPPPPHLPLPPPPPPPPPPPPPPPPPPPSPPLQIPF 1426 [212][TOP] >UniRef100_UPI0000DB6FAC PREDICTED: similar to Protein cappuccino n=1 Tax=Apis mellifera RepID=UPI0000DB6FAC Length = 1007 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 9/45 (20%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPP---------PPPPPPXPPPHT 677 P PL PPP PPPPPP PPPP PPPPPP PPP T Sbjct: 450 PPSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPT 494 [213][TOP] >UniRef100_UPI0000D9B853 PREDICTED: similar to Formin-1 isoform IV (Limb deformity protein) n=1 Tax=Macaca mulatta RepID=UPI0000D9B853 Length = 1164 Score = 59.7 bits (143), Expect = 6e-07 Identities = 27/51 (52%), Positives = 30/51 (58%), Gaps = 9/51 (17%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPP---------PPPPPPPPXPPPHTNAKSP 692 +P P V PPP PPPPPP PP PPPPPPPP PPP N+ +P Sbjct: 673 APPVPPVSAGPPPPPPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPNSPAP 723 [214][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 59.7 bits (143), Expect = 6e-07 Identities = 41/133 (30%), Positives = 57/133 (42%), Gaps = 5/133 (3%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIPL*FCCI 749 P PL P P P P PP PPPPPPPPPP PPP + P V LP +PL Sbjct: 790 PPPPLPPAPPQPAPAPTPPPPPPPPPPPPPPPPPPPPSAPPQVQ--LPVSLDLPL----- 842 Query: 750 *K**VQPNCG*KQI*HPYYRILLFHLQSSSIDPFL---FPPLN--QTPLVRQTNSRMPLN 914 + I++ +Q ++ P L PP++ L + ++ L+ Sbjct: 843 -----------------FPSIMMQSVQHPALPPQLALQLPPMDTLSADLTQLCQQQLGLD 885 Query: 915 PSSFSHSLFLNPK 953 P+ HS F P+ Sbjct: 886 PNFLRHSQFKRPR 898 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/54 (53%), Positives = 30/54 (55%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCI 728 +P P PPP PPPPPP PPPPPPPPPP PP VS LP F I Sbjct: 797 APPQPAPAPTPPPPPPPPPP-PPPPPPPPPPSAPPQVQLP---VSLDLPLFPSI 846 [215][TOP] >UniRef100_C3PP34 Actin polymerization protein RickA n=1 Tax=Rickettsia africae ESF-5 RepID=C3PP34_RICAE Length = 500 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = +3 Query: 567 SPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 +P PL PP PPPPPP PPPPPPPP P PPP +P Sbjct: 321 TPPSPLSENNIPPSPPPPPPPPPPPPPPPSPPPPPPPPPMAP 362 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS 701 PPP PPPPPP PPPP PPPPP PPP A++ +S Sbjct: 335 PPPPPPPPPPPPPPPSPPPPPPPPPMAPAQAETLS 369 [216][TOP] >UniRef100_A4TEZ3 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4TEZ3_MYCGI Length = 177 Score = 59.7 bits (143), Expect = 6e-07 Identities = 27/47 (57%), Positives = 28/47 (59%) Frame = +3 Query: 576 DPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPN 716 D L PPP PPPPPP PPPPPPPPP PPP Y+ LPN Sbjct: 119 DALAPPPPPPPPPPPPPGAPPPPPPPPPPPPPPV-----YIPPPLPN 160 [217][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPP-PPPPXPPPHTNAKSP 692 P P PPP PPPPPP PPPPPP PPPP PPP + P Sbjct: 489 PSPPPPPSPPPPSPPPPPPSPPPPPPSPPPPSPPPPPSPSPP 530 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLP 713 PPP PPPPPP PPPP PPPPP P P A P V F P Sbjct: 505 PPPSPPPPPPSPPPPSPPPPPSPSPPPPAPRP-VKIFRP 542 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/61 (44%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = +3 Query: 531 YAETD*GFGFACSPGDPLVLE-------RPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKS 689 + +T G G CS P + + PPP P PPPP PPPPP PPPP PPP + Sbjct: 451 FLDTPIGPGVNCSAPPPPLCDWVPPECTLPPPPPSPPPPSPPPPPSPPPPSPPPPPPSPP 510 Query: 690 P 692 P Sbjct: 511 P 511 Score = 55.8 bits (133), Expect = 9e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPP PPP PPPPPP PPP + P Sbjct: 487 PPPSPPPPPSPPPPSPPPPPPSPPPPPPSPPP 518 [218][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P P P PPPPPP PPPPPPPPPP PPP Sbjct: 1528 PPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPPPP 1561 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Frame = +3 Query: 549 GFGFACSPGDPLVLERPP-----PYPPPPPPYPPPPPPPPPPXPPP 671 G G SP P PP P PPPPPP PPPPPPPPPP PPP Sbjct: 1514 GSGSNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPP 1559 [219][TOP] >UniRef100_Q4DD51 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi RepID=Q4DD51_TRYCR Length = 603 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 5/39 (12%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPP-----PPPPXPPPHTNAKS 689 LE PPP PPPPPP PPPPPP PPPP PPP KS Sbjct: 380 LEAPPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGFKS 418 [220][TOP] >UniRef100_Q4CLZ3 Putative uncharacterized protein (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CLZ3_TRYCR Length = 624 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKS 689 PPP PPPP P PPPPPPPPPP PPP + A S Sbjct: 335 PPPPPPPPSPPPPPPPPPPPPPPPPSSFAAS 365 Score = 55.8 bits (133), Expect = 9e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS 701 PP PPPPP PPPPPPPPPP PPP ++ + V+ Sbjct: 335 PPPPPPPPSPPPPPPPPPPPPPPPPSSFAASLVA 368 [221][TOP] >UniRef100_B4PM92 GE24601 n=1 Tax=Drosophila yakuba RepID=B4PM92_DROYA Length = 595 Score = 59.7 bits (143), Expect = 6e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPPPPP PPPPPPPPPP P PH + P Sbjct: 153 PAPAPPPPPPPPPPPPPPPPPHPHPHPHHPQP 184 [222][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 59.7 bits (143), Expect = 6e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 ++PPP PPPPP PPPPPPPPPP PPP Sbjct: 40 QQPPPPPPPPPASPPPPPPPPPPPPPP 66 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPPP PPPPPPPPPP P P P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 56.6 bits (135), Expect = 5e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 ++ PP PPPPPP PPPPPPPPP PPP Sbjct: 39 QQQPPPPPPPPPASPPPPPPPPPPPPP 65 [223][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 59.7 bits (143), Expect = 6e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 ++PPP PPPPP PPPPPPPPPP PPP Sbjct: 40 QQPPPPPPPPPASPPPPPPPPPPPPPP 66 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P P PPP PPPPPP PPPPPPPPPP P P P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 56.6 bits (135), Expect = 5e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +3 Query: 591 ERPPPYPPPPPPYPPPPPPPPPPXPPP 671 ++ PP PPPPPP PPPPPPPPP PPP Sbjct: 39 QQQPPPPPPPPPASPPPPPPPPPPPPP 65 [224][TOP] >UniRef100_C5P8S7 Pherophorin-dz1 protein, putative n=2 Tax=Coccidioides posadasii RepID=C5P8S7_COCP7 Length = 281 Score = 57.0 bits (136), Expect(2) = 7e-07 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 6/38 (15%) Frame = +3 Query: 597 PPPYPPPPPPYP------PPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP P PPPPPPPPP PPP A P Sbjct: 124 PPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKP 161 Score = 22.3 bits (46), Expect(2) = 7e-07 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 466 KDLDRPDLLLGSTDRFGPDPVTMQKQIRVSDSPAA 570 K + P+L +T++ P P TM K SP A Sbjct: 57 KTISPPELTTTTTEQPPPVPTTMYKAPPPPQSPPA 91 [225][TOP] >UniRef100_Q1E016 Predicted protein n=1 Tax=Coccidioides immitis RepID=Q1E016_COCIM Length = 280 Score = 57.0 bits (136), Expect(2) = 7e-07 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 6/38 (15%) Frame = +3 Query: 597 PPPYPPPPPPYP------PPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP P PPPPPPPPP PPP A P Sbjct: 123 PPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKP 160 Score = 22.3 bits (46), Expect(2) = 7e-07 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 466 KDLDRPDLLLGSTDRFGPDPVTMQKQIRVSDSPAA 570 K + P+L +T++ P P TM K SP A Sbjct: 57 KTISPPELTTTTTEQPPPVPTTMYKAPPPPQSPPA 91 [226][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 258 PPMPPPPPPPPPPPPPPPPPPPPP 281 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+ PPP PPPPPP PPPPPPPPPP P P Sbjct: 255 PVTPPMPPPPPPPPPPPPPPPPPPPPPLPGP 285 [227][TOP] >UniRef100_UPI0001797788 PREDICTED: similar to Zinc finger protein 341 n=1 Tax=Equus caballus RepID=UPI0001797788 Length = 844 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 P L +PPP PPPPPP PPPPPP PPP PP Sbjct: 161 PSYLTQPPPPPPPPPPLPPPPPPQPPPPPP 190 [228][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 546 PPMPPPPPPPPPPPPPPPPPPPPP 569 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P PPP PPPPPP PPPPPPPPPP P P Sbjct: 543 PATPPMPPPPPPPPPPPPPPPPPPPPPLPGP 573 [229][TOP] >UniRef100_UPI0001661EAE PREDICTED: similar to Putative acrosin-like protease n=1 Tax=Homo sapiens RepID=UPI0001661EAE Length = 355 Score = 59.3 bits (142), Expect = 8e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P P RPPP PPPPPP PP P PPPPP PPP Sbjct: 271 PRPPAAQPRPPPSPPPPPPPPPSPLPPPPPPPPP 304 [230][TOP] >UniRef100_UPI0000F2AE0C PREDICTED: similar to hCG1781691 n=1 Tax=Monodelphis domestica RepID=UPI0000F2AE0C Length = 358 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 16 PPQPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.8 bits (133), Expect = 9e-06 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 594 RPPPYPPPPPPYPPPPPPPPPPXPP 668 +PP PPPPPP PPPPPPPPPP PP Sbjct: 15 QPPQPPPPPPPPPPPPPPPPPPPPP 39 [231][TOP] >UniRef100_UPI0000E23E7D PREDICTED: WAS protein homology region 2 domain containing 1 n=1 Tax=Pan troglodytes RepID=UPI0000E23E7D Length = 813 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPP 668 L PPP PPPPPP PPPPPPPPPP PP Sbjct: 636 LSLPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 58.5 bits (140), Expect = 1e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 57.0 bits (136), Expect = 4e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 603 PYPPPPPPYPPPPPPPPPPXPPPHTNAKS 689 P PPPPPP PPPPPPPPPP PPP A S Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPLRALS 667 [232][TOP] >UniRef100_UPI0000E20C65 PREDICTED: similar to Family with sequence similarity 44, member B n=1 Tax=Pan troglodytes RepID=UPI0000E20C65 Length = 282 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = +3 Query: 558 FACSPGDPLVLER--PPPYPPPPPPYPPPPPPPPPPXPPP 671 F P PL+ +R PP PPPPPP P PPPPPPPP PPP Sbjct: 19 FLPRPPQPLLYQRGPSPPPPPPPPPPPSPPPPPPPPSPPP 58 [233][TOP] >UniRef100_UPI0000E1F764 PREDICTED: formin-like 2 isoform 6 n=1 Tax=Pan troglodytes RepID=UPI0000E1F764 Length = 1032 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 518 PPMPPPPPPPPPPPPPPPPPPPPP 541 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/60 (46%), Positives = 33/60 (55%), Gaps = 8/60 (13%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPP-------PHTNAKSPYVSCF-LPNFDCIPL 734 P+ PPP PPPPPP PPPPPPPPPP P P K P + F +P F+ + L Sbjct: 515 PVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETGPSVKIKKPIKTKFRMPVFNWVAL 574 [234][TOP] >UniRef100_UPI0000E1F761 PREDICTED: formin-like 2 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E1F761 Length = 1087 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 550 PPMPPPPPPPPPPPPPPPPPPPPP 573 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 550 PPMPPPPPPPPPPPPPPPPPPPPPP 574 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPLPGP 578 Score = 55.8 bits (133), Expect = 9e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 P+ PPP PPPPPP PPPPPPPPPP P Sbjct: 547 PVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 576 [235][TOP] >UniRef100_UPI0000E1F760 PREDICTED: formin-like 2 isoform 8 n=1 Tax=Pan troglodytes RepID=UPI0000E1F760 Length = 1093 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 550 PPMPPPPPPPPPPPPPPPPPPPPP 573 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 550 PPMPPPPPPPPPPPPPPPPPPPPPP 574 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPP 671 PPP PPPPPP PPPPPPPPPP P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPLPGP 578 Score = 55.8 bits (133), Expect = 9e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 P+ PPP PPPPPP PPPPPPPPPP P Sbjct: 547 PVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 576 [236][TOP] >UniRef100_UPI000069F105 Formin-like protein 3 (Formin homology 2 domain-containing protein 3). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069F105 Length = 1108 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +3 Query: 603 PYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P PPPPPP PPPPPPPPPP PPP K P Sbjct: 608 PAPPPPPPPPPPPPPPPPPPPPPMPTGKCP 637 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPP------XPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPPPP PPP + SP V Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPMPTGKCPPPPPLPSSSPSV 649 [237][TOP] >UniRef100_UPI0001B798A6 UPI0001B798A6 related cluster n=1 Tax=Homo sapiens RepID=UPI0001B798A6 Length = 625 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 88 PPMPPPPPPPPPPPPPPPPPPPPP 111 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+ PPP PPPPPP PPPPPPPPPP P P Sbjct: 85 PVTPPMPPPPPPPPPPPPPPPPPPPPPLPGP 115 [238][TOP] >UniRef100_UPI0001951250 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Canis lupus familiaris RepID=UPI0001951250 Length = 1052 Score = 59.3 bits (142), Expect = 8e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPP 671 PP PPPPPP PPPPPPPPPP PPP Sbjct: 509 PPMPPPPPPPPPPPPPPPPPPPPP 532 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P+ PPP PPPPPP PPPPPPPPPP P P Sbjct: 506 PVTPPMPPPPPPPPPPPPPPPPPPPPPLPGP 536 [239][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 59.3 bits (142), Expect = 8e-07 Identities = 29/59 (49%), Positives = 32/59 (54%), Gaps = 10/59 (16%) Frame = +3 Query: 555 GFACSPGDPLVLERPPPYPPPP----------PPYPPPPPPPPPPXPPPHTNAKSPYVS 701 G A P P LERPPP P PP PP PPPPPPPPPP PPP ++ + S Sbjct: 404 GPAPQPTAPEPLERPPPPPAPPLPGPTTAPRPPPPPPPPPPPPPPPPPPLPGMRAAFPS 462 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/49 (55%), Positives = 28/49 (57%), Gaps = 11/49 (22%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPP-----------PPPXPPPHTNA 683 PG P RPPP PPPPPP PPPPPPP PPP PPP N+ Sbjct: 427 PG-PTTAPRPPPPPPPPPPPPPPPPPPLPGMRAAFPSPPPPPPPPLPNS 474 [240][TOP] >UniRef100_Q8YQB7 All3916 protein n=1 Tax=Nostoc sp. PCC 7120 RepID=Q8YQB7_ANASP Length = 383 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 P DP PPP P PPPP PPPP PPPPP PPP + P Sbjct: 315 PSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPP 355 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPP---PPPPPXPPPHTNAKSP 692 P DP + PPP PPPPP PPPPP PPPPP PPP P Sbjct: 332 PPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPP 375 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 P DP + PPP PPPPP PPPP PPPPP P P Sbjct: 327 PPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDP 360 [241][TOP] >UniRef100_B0SVF7 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0SVF7_CAUSK Length = 409 Score = 59.3 bits (142), Expect = 8e-07 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = +3 Query: 510 VWT*SGYYAETD*GFGFACSPGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPP 671 V T G Y +T G + G P PP PPPPPP PPPPPPP PP PPP Sbjct: 243 VGTFEGKYKDTSLTLGIRYTFGSP------PPPPPPPPPPPPPPPPPEPPAPPP 290 [242][TOP] >UniRef100_A3PW04 U5 snRNP spliceosome subunit-like protein n=1 Tax=Mycobacterium sp. JLS RepID=A3PW04_MYCSJ Length = 137 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +3 Query: 588 LERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 L PPP PPPPPP PPPPPPPPP PPP P V Sbjct: 82 LPPPPPPPPPPPPGAPPPPPPPPPPPPPPVYVPPPPV 118 [243][TOP] >UniRef100_B4Y9V9 Intracellular mobility A n=1 Tax=Burkholderia pseudomallei RepID=B4Y9V9_BURPS Length = 365 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/43 (58%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = +3 Query: 573 GDPLVLERPPPYPPPPPPYPPPPPPP---PPPXPPPHTNAKSP 692 GD + + PP PPPPPP PPPPPPP PPP PPP T P Sbjct: 75 GDRTLPNKVPPPPPPPPPPPPPPPPPSTTPPPPPPPSTTPSPP 117 [244][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PP PPP P PPPPPPPP PPP N +P Sbjct: 792 PPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTP 823 [245][TOP] >UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S5R2_RICCO Length = 210 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = +3 Query: 570 PGDPLVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVS 701 P P PPP PPPP P PPPPPPPP P PPP T+ S +S Sbjct: 43 PPPPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLS 86 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +3 Query: 582 LVLERPPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 L+++ PPP PPP PP P PPPP PPP PPP + SP Sbjct: 38 LIVQPPPPPPPPSPPPPSPPPPSPPPPPPPPPPSPSP 74 [246][TOP] >UniRef100_B9RYC5 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RYC5_RICCO Length = 510 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = +3 Query: 579 PLVLERPPPY---PPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PL PPP PPPPPP PPPPPPPPPP PPP P + Sbjct: 90 PLPPPSPPPPKHPPPPPPPSPPPPPPPPPPPPPPRPTGLPPNI 132 [247][TOP] >UniRef100_B5DWM1 GA26446 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DWM1_DROPS Length = 580 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYV 698 PPP PPPPPP PPPPPPPPPP P H + P + Sbjct: 141 PPPGPPPPPPPPPPPPPPPPPPPHHHHHPHPPII 174 [248][TOP] >UniRef100_B3P3J0 GG21917 n=1 Tax=Drosophila erecta RepID=B3P3J0_DROER Length = 573 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 597 PPPYPPPPPPYPPPPPPPPPPXPPPHTNAKSP 692 PPP PPPPPP PPPPPPPPP P PH + P Sbjct: 152 PPPPPPPPPPPPPPPPPPPPSYPHPHPHPHHP 183 [249][TOP] >UniRef100_A8PJG9 Ground-like domain containing protein n=1 Tax=Brugia malayi RepID=A8PJG9_BRUMA Length = 211 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +3 Query: 600 PPYPPPPPPYPPPPPPPPPPXPPPHTNAKSPYVSCFLPNFDCIPL 734 PP PP PP PPPPPPPPPP PPP +A P LP IP+ Sbjct: 49 PPQPPCPPQLPPPPPPPPPPPPPPQASAPCPQQPLCLPCPPPIPM 93 [250][TOP] >UniRef100_Q504V9 ZNF341 protein (Fragment) n=1 Tax=Homo sapiens RepID=Q504V9_HUMAN Length = 795 Score = 59.3 bits (142), Expect = 8e-07 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 579 PLVLERPPPYPPPPPPYPPPPPPPPPPXPP 668 P L +PPP PPPPPP PPPPPP PPP PP Sbjct: 113 PSYLTQPPPPPPPPPPLPPPPPPQPPPPPP 142