[UP]
[1][TOP] >UniRef100_C3PP34 Actin polymerization protein RickA n=1 Tax=Rickettsia africae ESF-5 RepID=C3PP34_RICAE Length = 500 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/65 (46%), Positives = 37/65 (56%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRPRIGSPGTE 548 PPPP PPPP P P PPPPPPPPP+AP L+ +E T+ + + PRP I + Sbjct: 337 PPPPPPPPPPPPPSPPPPPPPPPMAPAQAETLSKPVESTTVKKLENQ--PRPSIDTSALM 394 Query: 549 LEFTG 563 E G Sbjct: 395 REIAG 399 [2][TOP] >UniRef100_UPI000194C62B PREDICTED: similar to Uncharacterized protein C11orf9 homolog n=1 Tax=Taeniopygia guttata RepID=UPI000194C62B Length = 1185 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/44 (63%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPY---PPPPPPPPPPPLAPKHNS 458 C P LE PPPP PPPP P+ PPPPPPPPP PL P+HNS Sbjct: 234 CHMTPPSRLEHPPPPPPPPPPPHLQGPPPPPPPPPHPLQPQHNS 277 [3][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLS 512 PPPP PPPP P PPPPPPPPPPPL P +++ + + LF SL+ Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPLRTQFFLLFLFISLA 122 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L+ RPPPP PPPP P PPPPPPPPPPP P Sbjct: 22 LLPPRPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPP 94 [4][TOP] >UniRef100_Q6ZQ03 Formin-binding protein 4 n=1 Tax=Mus musculus RepID=FNBP4_MOUSE Length = 1031 Score = 63.2 bits (152), Expect = 4e-08 Identities = 38/86 (44%), Positives = 47/86 (54%), Gaps = 2/86 (2%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRPRI 530 PL LE PPPP PPP SP PPPPPPPPPPPL + +++E + S P Sbjct: 712 PLPLEMPPPPPPPPESPPPPPPPPPPPPPLE-------DGEIQEVEMEDEGSEEPP---- 760 Query: 531 GSPGTELE--FTGRRFTTSVTGNTLV 602 +PGTE + TT+VT +LV Sbjct: 761 -APGTEEDTPLKPSTQTTAVTSQSLV 785 [5][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P+ PPPP PPPP P PPPPPPPPPPP P Sbjct: 129 CPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 165 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPL 440 C+P P PPPP PPPP P PPPPPPPPPPP+ Sbjct: 136 CAPPPP----PPPPPPPPPPPPPPPPPPPPPPPPV 166 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPP---PPPLAP 446 P P+V PPPP PPPP+P PPPPPPPP PPP P Sbjct: 162 PPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPP 199 [6][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHN 455 +P P PPPP PPPPSP PPPPPPPPPPP P N Sbjct: 196 TPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPN 234 [7][TOP] >UniRef100_UPI00001CF1F0 formin binding protein 4 n=1 Tax=Rattus norvegicus RepID=UPI00001CF1F0 Length = 1074 Score = 62.4 bits (150), Expect = 7e-08 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPL 440 PL LE PPPP PPP SP PPPPPPPPPPPL Sbjct: 757 PLPLEMPPPPPPPPESPPPPPPPPPPPPPL 786 [8][TOP] >UniRef100_UPI0001B7B45F Fnbp4 protein. n=1 Tax=Rattus norvegicus RepID=UPI0001B7B45F Length = 1076 Score = 62.4 bits (150), Expect = 7e-08 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPL 440 PL LE PPPP PPP SP PPPPPPPPPPPL Sbjct: 757 PLPLEMPPPPPPPPESPPPPPPPPPPPPPL 786 [9][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 62.4 bits (150), Expect = 7e-08 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P + +V +PPPP PPPP P PPPPPPPPPPP P Sbjct: 194 CCPQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPP 230 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 242 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPPSP PPPPPPPPP P P Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPPSP PPPPPPPPP P P Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPPPP P P Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPP 232 [10][TOP] >UniRef100_B2KTD4 Minicollagen 1 n=1 Tax=Clytia hemisphaerica RepID=B2KTD4_9CNID Length = 149 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C+P V PPPP PPPP P PPPPPPPPPPP AP Sbjct: 41 CAPACAPVCCAPPPPPPPPPPPPPPPPPPPPPPPPAP 77 [11][TOP] >UniRef100_Q9WX60 Ccp protein n=1 Tax=Gluconacetobacter xylinus RepID=Q9WX60_ACEXY Length = 329 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPK 449 P+V E PPPP PPPP P PPPPPPPPP P+ P+ Sbjct: 85 PIVEEAPPPPPPPPPPPPPPPPPPPPPAPVVPE 117 [12][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 CSP P PPPP PPPP P PPPPPPPPPPP Sbjct: 374 CSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 [13][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP PL PPPP PPPP P PPPPPPPPPPP P Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P L PPPP PPPP P PPPPPPPPPPP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P PL PPPP PPPP P PPPPPPPPPPP P Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPPL P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P + PPPP PPPP P PPPPPPPPPPP P Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHP 704 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKH 452 PP P PPPP P PPPPPPPPPPP P H Sbjct: 676 PPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 [14][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 PL PPPP PPPP P PPPPPPPPPPPL P Sbjct: 423 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPLLP 454 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLL 464 + PPPP PPPP P PPPPPPPPPPP PK +L Sbjct: 144 QTPPPPPPPPPPPPPPPPPPPPPPPKPPKTQHVL 177 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLL 464 P PL +PP P PPPP P PPPPPPPPPPP P LL Sbjct: 413 PFAPLPQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPLL 453 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPP L P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPLLPP 455 [15][TOP] >UniRef100_UPI000198409E PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198409E Length = 478 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYP--PPPPPPPPPPLAP 446 +P P+V+ PPPP PPPPSP P PPPP PPPPPL P Sbjct: 196 TPSPPVVVPSPPPPSPPPPSPPPPSPPPPSPPPPPLIP 233 [16][TOP] >UniRef100_UPI0001926BC8 PREDICTED: similar to mini-collagen isoform 1 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC8 Length = 146 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLA 443 C+P + PPPP PPPP P PPPPPPPPPPP+A Sbjct: 39 CAPACTPICCAPPPPPPPPPPPPPPPPPPPPPPPVA 74 [17][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 357 CPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPPPPPP P Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P PP PPPPPPPP P Sbjct: 354 CQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 390 [18][TOP] >UniRef100_Q00485 Mini-collagen (Fragment) n=1 Tax=Hydra sp. RepID=Q00485_9CNID Length = 142 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLA 443 C+P + PPPP PPPP P PPPPPPPPPPP+A Sbjct: 35 CAPACTPICCAPPPPPPPPPPPPPPPPPPPPPPPVA 70 [19][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 60.1 bits (144), Expect = 3e-07 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 PPPP PPPP P PPPPPPPPPPP P++N + Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPENNEV 37 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 PPPP PPPP P PPPPPPPPPPP P N+ Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPENN 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 [20][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P+ PPPP PPPP P PPPPPPPPPPP P Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 124 PPPPPPPPPPPPPPPPPPPPPPPPTPR 150 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPPP 146 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 122 PPPPPPPPPPPPPPPPPPPPPPPPPP 147 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P + P PP PPPP P PPPPPPPPPPP P Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPP 143 [21][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P+ PPPP PPPP P PPPPPPPPPPP P Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPL 440 PPPP PPPP P PPPPPPPPPPPL Sbjct: 123 PPPPPPPPPPPPPPPPPPPPPPPL 146 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P + P PP PPPP P PPPPPPPPPPP P Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPP 143 [22][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P + PPPP PPPP P PPPPPPPPPPP P Sbjct: 343 PPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 344 PQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP + K Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPASTK 382 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLA 443 PPPP PPPP P PPPPPPPPPPP A Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPA 379 [23][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 +P PL L+ PPPP PPPP P PPPPPPPPPPP Sbjct: 3059 APSKPL-LQTPPPPPPPPPPPPPPPPPPPPPPP 3090 [24][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C+ P V + PPPP PPPP P PPPPPPPPPPP P Sbjct: 311 CNGFTPDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPE 364 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPEPP 366 [25][TOP] >UniRef100_B6IMJ6 Putative uncharacterized protein n=1 Tax=Rhodospirillum centenum SW RepID=B6IMJ6_RHOCS Length = 202 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/52 (50%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPL-APKHNSLLNSKLEEDTL 491 +P E PPP PPPP+P PPPPPPPPPPP+ P +L+ E+D L Sbjct: 29 APPAATAAEPEPPPPPPPPAPLPPPPPPPPPPPMPEPPPPVMLDEPAEDDVL 80 [26][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLL 464 PPPP PPPP P PPPPPPPPPPP P N+++ Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 73 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +3 Query: 348 DPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 DP PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPP 66 [27][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 CPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.3 bits (142), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P L PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 59.3 bits (142), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P PL PPPP PPPP P PPPPPPPPPPP P Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLL 464 PPPP PPPP P PPPPPPPPPPP P N+++ Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 73 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P + PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +3 Query: 348 DPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 DP PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 DPPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPP 66 [28][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLL 464 PPPP PPPP P PPPPPPPPPPP P N+++ Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 70 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +3 Query: 348 DPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 DP PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 [29][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPPPPPP P LL S + Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNM 56 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/52 (48%), Positives = 27/52 (51%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRP 524 PPPP PPPP P PPPPPPPPPPPL + S + F RP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKPPRRHIAFTGGGYEENRP 79 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 [30][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/51 (52%), Positives = 32/51 (62%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPR 521 PPPP PPPP P PPPPPPPPPPP P L+ S+ L A+ + +PR Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSR----PLSALFARPVPR 116 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFA 497 PPPP PPPP P PPPPPPPPPPP P L + LFA Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLSALFA 111 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPP 93 [31][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSK 473 PPPP PPPP P PPPPPPPPPPP P H ++ + Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRR 48 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSK 473 PPPP PPPP P PPPPPPPPPPP P + L S+ Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSR 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 [32][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P PPPPPPPPPPP AP Sbjct: 37 CPPPPP-----PPPPPPPPPPPPPPPPPPPPPPPPAP 68 [33][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 E+ PPP PPPP P PPPPPPPPPPP PK S K+ Sbjct: 39 EQAPPPPPPPPPPPPPPPPPPPPPPPPPKKTSDTKKKI 76 [34][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/77 (38%), Positives = 36/77 (46%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRPRIGSPGTE 548 PPPP PPPP P PPPPPPPPPPP P ++ S S + +P P PG Sbjct: 989 PPPPPPPPPPPPPPPPPPPPPPPPPPGFKGIIPSS---------SGIPLPPPPPPPPGPG 1039 Query: 549 LEFTGRRFTTSVTGNTL 599 + TS + L Sbjct: 1040 FKSASSSTRTSARTSLL 1056 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P L PPPP PPPP P PPPPPPPPPPP P Sbjct: 980 PNGLSPPPPPPPPPPPPPPPPPPPPPPPPPPP 1011 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 987 PPPPPPPPPPPPPPPPPPPPPPPPPP 1012 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 988 PPPPPPPPPPPPPPPPPPPPPPPPPP 1013 [35][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +3 Query: 345 GDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 G P L PPPP PPPP P PPPPPPPPPPP +P Sbjct: 57 GVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSP 90 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPP 91 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPP 437 PPPP PPPP P PPPPPPPPPPP Sbjct: 78 PPPPPPPPPPPSPPPPPPPPPPP 100 [36][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPPL P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/76 (46%), Positives = 39/76 (51%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRPRIGSPGTE 548 PPPP PPPP P P PPPPPPPPPL P SL +S ++ P P T+ Sbjct: 259 PPPPPPPPPPPPPLPPPPPPPPPLPPPPPSL-------PLPLPTTSATVAPPSTSQP-TQ 310 Query: 549 LEFTGRRFTTSVTGNT 596 L T TTS TG T Sbjct: 311 LSTTPTSSTTS-TGTT 325 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P V+ PPPP PPPP P PPPPPPPPPPP P Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPP 262 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLP 273 [37][TOP] >UniRef100_B4RDQ2 OmpA family protein n=1 Tax=Phenylobacterium zucineum HLK1 RepID=B4RDQ2_PHEZH Length = 410 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 PPPP PPPP P PPPPPPPPPPP AP + + Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPAPAYEA 301 Score = 55.5 bits (132), Expect = 8e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPP 437 PPPP PPPP P PPPPPPPPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPP 293 [38][TOP] >UniRef100_A7XYI3 JXC1 n=1 Tax=Monodelphis domestica RepID=A7XYI3_MONDO Length = 918 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 5/40 (12%) Frame = +3 Query: 342 PGDPLVLERPPP-----P*PPPPSPYPPPPPPPPPPPLAP 446 P +PL L PPP P PPPP P PPPPPPPPPPP AP Sbjct: 757 PPEPLALVPPPPLLPPLPLPPPPPPPPPPPPPPPPPPPAP 796 [39][TOP] >UniRef100_Q9GP44 NONA protein (Fragment) n=1 Tax=Drosophila virilis RepID=Q9GP44_DROVI Length = 165 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 [40][TOP] >UniRef100_Q95UX5 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX5_DROVI Length = 162 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 103 [41][TOP] >UniRef100_Q95UX4 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX4_DROVI Length = 163 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 104 [42][TOP] >UniRef100_Q95UX3 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX3_DROVI Length = 161 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 102 [43][TOP] >UniRef100_Q95UX2 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX2_DROVI Length = 165 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 [44][TOP] >UniRef100_Q95UW8 No on or off transient A (Fragment) n=1 Tax=Drosophila americana texana RepID=Q95UW8_DROAE Length = 168 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 76 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 110 [45][TOP] >UniRef100_Q95UW2 No on or off transient A (Fragment) n=1 Tax=Drosophila montana RepID=Q95UW2_DROMN Length = 165 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 107 [46][TOP] >UniRef100_Q95UW1 No on or off transient A (Fragment) n=1 Tax=Drosophila kanekoi RepID=Q95UW1_DROKA Length = 159 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 100 [47][TOP] >UniRef100_Q95NU6 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NU6_DROVI Length = 163 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 104 [48][TOP] >UniRef100_Q95NR6 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NR6_DROVI Length = 165 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 [49][TOP] >UniRef100_Q95NP2 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NP2_DROVI Length = 164 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 105 [50][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPPL P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 PL PPPP PPPP P PPPPPPPPPPP P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/35 (65%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = +3 Query: 348 DPLVLERPPP--P*PPPPSPYPPPPPPPPPPPLAP 446 + +V+E PPP P PPPP P PPPPPPPPPPP P Sbjct: 48 EKMVIELPPPLPPAPPPPPPPPPPPPPPPPPPPPP 82 [51][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKH 452 PPPP PPPP P PPPPPPPPPPP P H Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPH 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 [52][TOP] >UniRef100_B4M7B5 GJ16487 n=1 Tax=Drosophila virilis RepID=B4M7B5_DROVI Length = 880 Score = 59.3 bits (142), Expect = 6e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 CS + +E PPPP PPPP P PPPPPPPPPPP Sbjct: 175 CSLEPAVDMETPPPPPPPPPPPPPPPPPPPPPPP 208 [53][TOP] >UniRef100_B4M1S7 NonA n=1 Tax=Drosophila virilis RepID=B4M1S7_DROVI Length = 699 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 201 GGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 235 [54][TOP] >UniRef100_B3M2B3 GF17078 n=1 Tax=Drosophila ananassae RepID=B3M2B3_DROAN Length = 599 Score = 59.3 bits (142), Expect = 6e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHN 455 PPPP PPPP P PPPPPPPPPPP P H+ Sbjct: 159 PPPPPPPPPPPPPPPPPPPPPPPHHPHHH 187 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 372 PPP*PPPPSPYPPPPPPPPPPPLAPKH 452 PPP PPPP P PPPPPPPPPPP P H Sbjct: 157 PPPPPPPPPPPPPPPPPPPPPPPPPHH 183 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHN 455 PPPP PPPP P PPPPPPPPPPP P H+ Sbjct: 157 PPPPPPPPPPPPPPPPPPPPPPP--PPHH 183 [55][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = +3 Query: 342 PGDP---LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 PGDP + PPPP PPPP P PPPPPPPPPPP P Sbjct: 258 PGDPFQEITGPGPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 PG P PPPP PPPP P PPPPPPPPPPP Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 [56][TOP] >UniRef100_UPI0001926BC7 PREDICTED: similar to mini-collagen isoform 3 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC7 Length = 148 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +3 Query: 336 CSPGD-PLVLERPPPP*PPPPSPYPPPPPPPPPPPL 440 C+P P+ PPPP PPPP P PPPPPPPPPPPL Sbjct: 39 CAPACLPICCVPPPPPPPPPPPPPPPPPPPPPPPPL 74 [57][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +3 Query: 366 RPPPP*PPPPSPYPPPPPPPPPPPL 440 RPPPP PPPP P PPPPPPPPPPPL Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPL 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPRPPPPPPPPPPPPPPPPPPPPP 47 [58][TOP] >UniRef100_A4TTR4 Putative uncharacterized protein n=1 Tax=Magnetospirillum gryphiswaldense RepID=A4TTR4_9PROT Length = 118 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/65 (49%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPP----PPPLAPKHNSLLNSKLEEDTLFAISSL 509 P P L PPPP PPPP PYPPPPPPPP PPP P S L+S + S Sbjct: 23 PPLPPSLPLPPPPLPPPPPPYPPPPPPPPSPILPPPAPPP--SPLSSSPSPPPPLHVRSP 80 Query: 510 SIPRP 524 + PRP Sbjct: 81 TPPRP 85 [59][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP AP+ Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPAPE 259 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 + PPPP PPPP P PPPPPPPPPPP P Sbjct: 229 DAPPPPPPPPPPPPPPPPPPPPPPPPPP 256 [60][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPPPPPP P Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPP 126 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPPSP PPPPPPPPPPP P Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 P P V PPPP PPPP P PPPPPPPPPPP Sbjct: 90 PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPP 121 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P PL PPP PPPP P PPPPPPPPPPP +P Sbjct: 77 PQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 P P PPPP PPPP P PPPPPPPPPPP Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 [61][TOP] >UniRef100_Q3ECQ3 Uncharacterized protein At1g54215.1 n=1 Tax=Arabidopsis thaliana RepID=Q3ECQ3_ARATH Length = 169 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 S PL + PPPP PPPP P PPPPPPPPPPP Sbjct: 32 SQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +3 Query: 348 DPLVLERPPPP*PPPPSPYPPPPPPPPPPPLA 443 DP + + PPP PPPP P PPPPPPPPPPP A Sbjct: 34 DPPLFPQSPPPPPPPPPPPPPPPPPPPPPPPA 65 [62][TOP] >UniRef100_C5YU09 Putative uncharacterized protein Sb08g008380 n=1 Tax=Sorghum bicolor RepID=C5YU09_SORBI Length = 149 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +3 Query: 366 RPPPP*PPPPSPYPPPPPPPPPPPLAP 446 RPPPP PPPP P PPPPPPPPPPPL+P Sbjct: 8 RPPPP-PPPPPPPPPPPPPPPPPPLSP 33 [63][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLL 464 PPPP PPPP P PPPPPPPPPPP P+ + +L Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPQPSEIL 50 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +E PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 MEPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 PPPP PPPP P PPPPPPPPPPP P S Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 [64][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +3 Query: 345 GDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 GD + +PPPP PPPP P PPPPPPPPPPP P S Sbjct: 92 GDGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPPPPPGS 129 [65][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEED 485 PPPP PPPP P PPPPPPPPPPP H S+ L E+ Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEE 543 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPP P PPPPPPPPPPP P Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L PPPP PPPP P PPPPPPPPPPP P Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPP 527 [66][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPPPPPP P +L + K+ Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPSVTLSSQKM 533 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 345 GDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 G P PPPP PPPP P PPPPPPPPPPP Sbjct: 492 GGPSSTPPPPPPPPPPPPPPPPPPPPPPPPP 522 [67][TOP] >UniRef100_B3NTG0 GG18108 n=1 Tax=Drosophila erecta RepID=B3NTG0_DROER Length = 1373 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 PG + RPPPP PPP P PPPPPPPPPPP +P Sbjct: 1040 PGPSGIYMRPPPPLQPPPPPPPPPPPPPPPPPPSP 1074 [68][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPP P PPPPPPPPPPP P Sbjct: 165 SPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/51 (50%), Positives = 29/51 (56%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLF 494 P P PPPP PPPP P PPPPPPPPPPP N+ L L+ +F Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNARLKIALKAIRIF 219 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPP P PPPPPPPPPPP P Sbjct: 159 SPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P P PP PPPPSP PPPPPPPPPPP P Sbjct: 155 PPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 189 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPP P PPPPPPPPPP P Sbjct: 151 SPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPP 186 [69][TOP] >UniRef100_UPI0001926BAB PREDICTED: similar to mini-collagen n=1 Tax=Hydra magnipapillata RepID=UPI0001926BAB Length = 149 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP AP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPAP 76 [70][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPP PPP +PK L KL Sbjct: 2346 PPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2381 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2337 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2367 [71][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPP PPP +PK L KL Sbjct: 1284 PPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 1319 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 1275 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 1305 [72][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPP PPP +PK L KL Sbjct: 2346 PPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2381 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2337 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2367 [73][TOP] >UniRef100_UPI0000E20C65 PREDICTED: similar to Family with sequence similarity 44, member B n=1 Tax=Pan troglodytes RepID=UPI0000E20C65 Length = 282 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 4/39 (10%) Frame = +3 Query: 342 PGDPLVLER---PPPP*PPPPSPYPPPPPPPP-PPPLAP 446 P PL+ +R PPPP PPPP P PPPPPPPP PPPL P Sbjct: 23 PPQPLLYQRGPSPPPPPPPPPPPSPPPPPPPPSPPPLPP 61 [74][TOP] >UniRef100_UPI0001B7AE60 UPI0001B7AE60 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7AE60 Length = 1992 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAI 500 + RPP P PPPP P PPPPPPPPP + PK +S+ + +ED+ F + Sbjct: 1524 MTRPPVPIPPPPPP--PPPPPPPPPVIKPKTSSVKQERWDEDSFFGL 1568 [75][TOP] >UniRef100_UPI0001B7AE51 UPI0001B7AE51 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7AE51 Length = 1377 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAI 500 + RPP P PPPP P PPPPPPPPP + PK +S+ + +ED+ F + Sbjct: 773 MTRPPVPIPPPPPP--PPPPPPPPPVIKPKTSSVKQERWDEDSFFGL 817 [76][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 PL P PP PPPP P PPPPPPPPPPP AP+ L Sbjct: 2004 PLQAPPPTPPPPPPPPPPPPPPPPPPPPPSAPQQVQL 2040 [77][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPP PPP +PK L KL Sbjct: 2408 PPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2443 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2399 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2429 [78][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPP PPP +PK L KL Sbjct: 2408 PPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2443 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2399 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2429 [79][TOP] >UniRef100_Q2IEA3 CHRD n=1 Tax=Anaeromyxobacter dehalogenans 2CP-C RepID=Q2IEA3_ANADE Length = 413 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGLQV 332 G GGGGGGGGGGGYGDGGGG GGGG G+ L V Sbjct: 26 GGYGGGGGGGGGGGYGDGGGGGGGGGGGGEPGAAALWV 63 [80][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 C P P PPPP PPPP P PPPPPPPPPPP Sbjct: 67 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +3 Query: 342 PGDPLVLER----PPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P+ ER PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P RP PP PPPP P PPPPPPPPPPP P Sbjct: 57 PPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPP 91 [81][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP AP Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPAP 242 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 215 PPPPPPPPPPPPPPPPPPPPPPPPPP 240 [82][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P RPPPP PPP P PPPPPPPPPPP +P Sbjct: 232 PSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSP 266 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPP 437 PPPP PPPPSP PPPPPPPPPPP Sbjct: 256 PPPPPPPPPSPPPPPPPPPPPPP 278 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPP 267 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 254 PPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLL 464 P P + PPPP PPPP P PPP PPPPPPP P LL Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLL 281 [83][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPPPPPP P Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPP PPPPPPPPPPP P Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 [84][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPPPPPP P Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 PPPP PPPP P PPPPPPPPPPP+ P S+ Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPVYPDQCSV 310 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/37 (64%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +3 Query: 339 SPGDPLVLERPPPP*P-PPPSPYPPPPPPPPPPPLAP 446 +P PL PPPP P PPPSP PPPPPPPP PP +P Sbjct: 217 APPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSP 253 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP P PPPPPPPPP P Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPP 264 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPSP PPPPPPPPPPP P Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPP 268 [85][TOP] >UniRef100_B9SMV7 Vegetative cell wall protein gp1, putative n=1 Tax=Ricinus communis RepID=B9SMV7_RICCO Length = 479 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNS 470 SP P+++ PPPP PPPP P PP PPPP PPP +P L+ S Sbjct: 186 SPPPPVIVPSPPPPSPPPPCPPPPSPPPPSPPPPSPPPPPLVPS 229 [86][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +V+ PPPP PPPP P PPPPPPPPPPP P Sbjct: 74 IVIPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 93 PPPPPPPPPPPPPPPPPPPPPPPTCP 118 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 90 PPPPPPPPPPPPPPPPPPPPPPPPPP 115 [87][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 ++L PPPP PPPP P PPPPPPPPPPP P Sbjct: 68 VILTPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = +3 Query: 324 EI*TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 E+ P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 67 EVILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 T P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 71 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 92 PPPPPPPPPPPPPPPPPPPPPPPPVP 117 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 90 PPPPPPPPPPPPPPPPPPPPPPPPPP 115 [88][TOP] >UniRef100_Q9U2U0 Protein Y116A8C.35, confirmed by transcript evidence n=1 Tax=Caenorhabditis elegans RepID=Q9U2U0_CAEEL Length = 285 Score = 58.5 bits (140), Expect = 1e-06 Identities = 33/67 (49%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = -3 Query: 538 GDPIRGRGIDKLDIANRVSSSNLLLRRELCLGANGGGGGGGGGGGYGDGGG-GYGGGGRS 362 GD + GR + D A S G +GGGGGGGGGGGYG GGG G GGGGR Sbjct: 191 GDRLYGRRGRRADAAGHYPSQR---------GGSGGGGGGGGGGGYGSGGGWGGGGGGRD 241 Query: 361 RTSGSPG 341 R G G Sbjct: 242 RDRGGWG 248 [89][TOP] >UniRef100_Q95UW3 No on or off transient A (Fragment) n=1 Tax=Drosophila lacicola RepID=Q95UW3_DROLA Length = 164 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 442 ANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 A GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 73 ARGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 [90][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPK 449 C P P PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 49 CVPAPP-----PPPPPPPPPPPPPPPPPPPPPPPPPPQ 81 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 PPPP PPPP P PPPPPPPPPPP P L Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPQQPL 84 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/38 (60%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +3 Query: 336 CSPG-DPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C+P P+ PPP PPPP P PPPPPPPPPPP P Sbjct: 40 CAPACQPICCVPAPPPPPPPPPPPPPPPPPPPPPPPPP 77 [91][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/28 (85%), Positives = 24/28 (85%), Gaps = 1/28 (3%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPL-APK 449 PPPP PPPP P PPPPPPPPPPPL APK Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPLRAPK 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 [92][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP PK Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPK 45 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPKTPR 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 [93][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPP PPP +PK L KL Sbjct: 2339 PPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2330 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2360 [94][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P V PPPP PPPP P PPPPPPPPPPP P Sbjct: 1027 PAVTAVPPPPPPPPPPPPPPPPPPPPPPPPPP 1058 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1034 PPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 56.6 bits (135), Expect = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLA 443 PPPP PPPP P PPPPPPPPPPP++ Sbjct: 1037 PPPPPPPPPPPPPPPPPPPPPPPMS 1061 [95][TOP] >UniRef100_P0CB49 YLP motif-containing protein 1 n=1 Tax=Rattus norvegicus RepID=YLPM1_RAT Length = 1376 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAI 500 + RPP P PPPP P PPPPPPPPP + PK +S+ + +ED+ F + Sbjct: 772 MTRPPVPIPPPPPP--PPPPPPPPPVIKPKTSSVKQERWDEDSFFGL 816 [96][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPPPPPP P Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 T S P P PP PPPPSP PPPPPPPPPPP P Sbjct: 236 TASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPP 273 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P RPP P PP PSP PPPPPPPPPPP P Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPP 275 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPP P PPP PPPPPPP P Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPP PPPPPPPPPPP P Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 55.5 bits (132), Expect = 8e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPP 437 PPPP PPPP P PPPPPPPPPPP Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPP 295 [97][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPP PPP +PK L KL Sbjct: 2339 PPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2330 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2360 [98][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPP PPP +PK L KL Sbjct: 2339 PPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2330 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2360 [99][TOP] >UniRef100_A4QSS5 ATP-dependent RNA helicase DBP2 n=1 Tax=Magnaporthe grisea RepID=DBP2_MAGGR Length = 548 Score = 58.5 bits (140), Expect = 1e-06 Identities = 35/104 (33%), Positives = 51/104 (49%), Gaps = 6/104 (5%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGLQVQISFCPERRSTD-NHRRKWKKQ 269 G++GGG GGGGGGGYG GGGGYGGGG G + +++ D N K++K Sbjct: 29 GSHGGGYGGGGGGGYGGGGGGYGGGGGGGFGGGGDRMSNLGAGLQKQDWDINALPKFEKH 88 Query: 268 YPAEEHR*PPPEMEETISRIVTEIEDLRENHHI-----DNPQPL 152 + E + +R E++ R H + D P+P+ Sbjct: 89 FYKEH--------PDVTNRSQAEVDKFRREHSMAVQGSDVPKPV 124 [100][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP AP Sbjct: 940 PPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 T P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 852 TTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +3 Query: 348 DPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +P PPPP PPPP P PPPPPPPPPPP P Sbjct: 850 EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 882 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P+V E P P PPPP P PPPPPPPPPPP P Sbjct: 845 PMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPP 876 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 T P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 853 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 935 PPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 937 PPPPPPPPPPPPPPPPPPPPPPPPPP 962 [101][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPP PPPL P Sbjct: 37 PPPPPPPPPSPPPPPPPPPSPPPLPP 62 [102][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/83 (36%), Positives = 40/83 (48%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPR 521 P P PPP PPPP P PPPPPPPPPPP P + + S E + + + + Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIPGYIVKPALMQK 559 Query: 522 PRIGSPGTELEFTGRRFTTSVTG 590 + + GT E G +F + G Sbjct: 560 MGVAAIGTFHERQGDQFLLNSNG 582 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPPSP PPPPP PPPPP P Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 [103][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +3 Query: 348 DPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +P PPPP PPPP P PPPPPPPPPPP P Sbjct: 241 EPAAPPPPPPPPPPPPPPPPPPPPPPPPPPAKP 273 [104][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 E PPPP PPPP P PPPPPPPPPPP P Sbjct: 222 EAPPPPPPPPPPPPPPPPPPPPPPPPPP 249 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 PPPP PPPP P PPPPPPPPPPP P N+ Sbjct: 228 PPPPPPPPPPPPPPPPPPPPPPPPPPPCNT 257 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPPP 250 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPP 251 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 227 PPPPPPPPPPPPPPPPPPPPPPPPPP 252 [105][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 218 PPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 252 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPPPP P P Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPPSP PPP PPPP PPL P Sbjct: 232 PPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPP 266 [106][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 366 RPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +PP P PPPPSP PPPPPPPPPPPL P Sbjct: 1202 QPPRPAPPPPSPPPPPPPPPPPPPLPP 1228 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPP P PPPP PPPPPP P Sbjct: 1206 PAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPP 1240 [107][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +3 Query: 324 EI*TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPL 440 E+ +P P PPPP PPPP P PPPPPPPPPPP+ Sbjct: 37 EVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 75 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPP 74 [108][TOP] >UniRef100_Q00484 Mini-collagen n=1 Tax=Hydra sp. RepID=Q00484_9CNID Length = 149 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 C+P V PPPP PPPP P PPPPPPPPPPP Sbjct: 41 CAPACAPVCCYPPPPPPPPPPPPPPPPPPPPPPP 74 [109][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/50 (52%), Positives = 29/50 (58%) Frame = +3 Query: 297 SVLLRSGQNEI*TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 S+ L+ +N P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 SLFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPP 97 [110][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 E PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 ETPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 T P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPP 64 [111][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 PPPP PPPP P PPPPPPPPPPP P+ L Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPQREHL 111 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPP 105 [112][TOP] >UniRef100_Q08DX4 WAS/WASL interacting protein family, member 1 n=1 Tax=Bos taurus RepID=Q08DX4_BOVIN Length = 503 Score = 53.1 bits (126), Expect(2) = 1e-06 Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGL-QVQISFCPERRSTDNHRRK 281 GA GGGGGGGGGG GGGG GGGG G PGL + + P+ RST N + Sbjct: 64 GAAAGGGGGGGGGGSYGGGGGGGGGGNFGGGGPPGLGGLFQAGMPKLRSTANRENE 119 Score = 24.6 bits (52), Expect(2) = 1e-06 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = -2 Query: 260 GGAPITTAGNGRNNIPHRNRNRRPP*KPPHRQPTTTLLNNLSPISKPSSKTPNP 99 G P+ AG+ R+ P RNR PP +P +N+ P P TP P Sbjct: 147 GRFPVPPAGH-RSGPPEPQRNRMPPPRP----EVGAKPDNIPP---PVPNTPRP 192 [113][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 287 CPPPPPPC---PPPPPPPPPCPPPPPPPPPPPPPCPP 320 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P PPPPPPP PPP P Sbjct: 253 CPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPP 289 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPP PPPP P PPPPPPPPPPP P Sbjct: 246 CPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 C P P PPPP PPPP P P PPPPPPPPP P Sbjct: 294 CPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPP 330 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +3 Query: 336 CSPGDPLVLERPPPP*PPP-PSPYPPPPPPPPPPPLAP 446 C P P PPPP PPP P P PPPPPPPPPPP P Sbjct: 238 CHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPP 275 [114][TOP] >UniRef100_UPI0001796908 PREDICTED: zinc finger homeobox 4 n=1 Tax=Equus caballus RepID=UPI0001796908 Length = 3574 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L+ PPP PPPP P PPPPPPPPPPP AP Sbjct: 1994 LQAPPPTPPPPPPPPPPPPPPPPPPPSAP 2022 [115][TOP] >UniRef100_UPI00001809D7 UPI00001809D7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI00001809D7 Length = 3593 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L+ PPP PPPP P PPPPPPPPPPP AP Sbjct: 2015 LQAPPPTPPPPPPPPPPPPPPPPPPPSAP 2043 [116][TOP] >UniRef100_Q4SUB2 Chromosome 3 SCAF13974, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SUB2_TETNG Length = 692 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 7/42 (16%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYP-------PPPPPPPPPPLAP 446 P P+ L PPPP PPPP P P PPPPPPPPPPL P Sbjct: 106 PACPVFLPLPPPPPPPPPPPLPSFTLSPPPPPPPPPPPPLPP 147 [117][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PP PPPPPPPPLAP Sbjct: 392 PPPPLPPPPIPPPPSPPPPPPPPLAP 417 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P L PPPP PPPP P PP PPPP PPPL P Sbjct: 1599 PSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPP 1633 [118][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPFQP 264 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPP 261 [119][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPTTP 251 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPP 247 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 223 PPPPPPPPPPPPPPPPPPPPPPPPPP 248 [120][TOP] >UniRef100_B8JHF8 CHRD domain containing protein n=1 Tax=Anaeromyxobacter dehalogenans 2CP-1 RepID=B8JHF8_ANAD2 Length = 412 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGL 338 G GGGGGGGGGGGYGDGGGG GGGG SG GL Sbjct: 26 GGYGGGGGGGGGGGYGDGGGGGGGGG----SGDAGL 57 [121][TOP] >UniRef100_A2SMG9 RNA-binding region RNP-1 n=1 Tax=Methylibium petroleiphilum PM1 RepID=A2SMG9_METPP Length = 162 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 445 GANGGGGGG--GGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGG GGGGGYG GGGGYGGGG R+ G G Sbjct: 102 GGYGGGGGGRSGGGGGYGGGGGGYGGGGGGRSGGGGG 138 [122][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 366 RPPPP*PPPPSPYPPPPPPPPPPPLAP 446 RPPPP PPPPSP PPPPP PPPPP P Sbjct: 319 RPPPPSPPPPSPPPPPPPSPPPPPSPP 345 [123][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +3 Query: 324 EI*TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPL 440 E+ +P P PPPP PPPP P PPPPPPPPPPP+ Sbjct: 37 EVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPI 75 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNS 470 PPPP PPPP P PPPPPPPPPPP P L+ S Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPIKLIAS 80 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPP 71 [124][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +3 Query: 345 GDPLVLERPPPP*PPPPSPYPP-PPPPPPPPPLAP 446 G P L PPPP PPPP P PP PPPPPPPPPL P Sbjct: 1202 GPPPPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPP 1236 [125][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 PPPP PPPP P PPPPPPPPPPP P L Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPTQEDL 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 [126][TOP] >UniRef100_B7PLD9 Circumsporozoite protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PLD9_IXOSC Length = 188 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLL 464 E PPPP PPPP P PPPPPPPPPPP P +++ Sbjct: 25 ETPPPP-PPPPPPPPPPPPPPPPPPAPPSETTII 57 [127][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLN 467 PPPP PPPP P PPPPPPPPPPP P L N Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCN 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 [128][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +++ PPPP PPPP P PPPPPPPPPPP P Sbjct: 71 MMMTTPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 T P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 74 TTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPR 114 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 T P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 75 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P ++ PPP PPPP P PPPPPPPPPPP P Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPP 100 [129][TOP] >UniRef100_UPI0001795F40 PREDICTED: leiomodin 2 (cardiac) n=1 Tax=Equus caballus RepID=UPI0001795F40 Length = 549 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYP---PPPPPPPPPPLAPK 449 P P+V PPPP PPPP P P PPPPPPPPPPL K Sbjct: 416 PQSPVVPPAPPPPPPPPPPPPPQRLPPPPPPPPPPLPEK 454 [130][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHN 455 PPPP PPP P PPPPPPPPPPP P+H+ Sbjct: 2803 PPPPPTPPPPPPPPPPPPPPPPPPPPQHS 2831 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 PPPP P PP P PPPPPPPPPPP P +S+ Sbjct: 2802 PPPPPPTPPPPPPPPPPPPPPPPPPPPQHSI 2832 [131][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 LPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPRP 58 [132][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 1480 PPPPPPPPPPPPPPPPPPPPPPPPLPR 1506 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L PPPP PPPP P PPPPPPPPPPP P Sbjct: 1474 LPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1502 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 PL PPPP PPPP P PPPPPPPPPPP Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP 1501 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1478 PPPPPPPPPPPPPPPPPPPPPPPPPP 1503 [133][TOP] >UniRef100_UPI00016E10B6 UPI00016E10B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B6 Length = 1270 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPP----PPPPPPPPLAP 446 P P +L PPPP PPPP P PPP PPPPPPPP AP Sbjct: 694 PPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAP 732 [134][TOP] >UniRef100_UPI00016E10B5 UPI00016E10B5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B5 Length = 1246 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPP----PPPPPPPPLAP 446 P P +L PPPP PPPP P PPP PPPPPPPP AP Sbjct: 670 PPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAP 708 [135][TOP] >UniRef100_UPI00016E10B4 UPI00016E10B4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B4 Length = 1323 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPP----PPPPPPPPLAP 446 P P +L PPPP PPPP P PPP PPPPPPPP AP Sbjct: 747 PPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAP 785 [136][TOP] >UniRef100_UPI00016E10A1 UPI00016E10A1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10A1 Length = 1396 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPP----PPPPPPPPLAP 446 P P +L PPPP PPPP P PPP PPPPPPPP AP Sbjct: 820 PPPPALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAP 858 [137][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPP 1434 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPP 1435 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPP 1436 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPP 1437 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPP 1439 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPP PP AP Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAP 1445 [138][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 PPPP PPPP P PPPPPPPPPPP P+ + Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPEETT 263 [139][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 S G P PPPP PPPP P PPPPPPPPPPP P Sbjct: 648 SVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFA 497 PPPP PPPP P PPPPPPPPPPP P +L + + T+ A Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAFDRTVAA 698 [140][TOP] >UniRef100_B1KJL7 Putative lipoprotein n=1 Tax=Shewanella woodyi ATCC 51908 RepID=B1KJL7_SHEWM Length = 508 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 +P + + + PPPP PPPP P PPPPPPPPPPP Sbjct: 29 TPEEKVEIAPPPPPPPPPPPPPPPPPPPPPPPP 61 [141][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 PPPP PPPP P PPPPPPPPPPP P S Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPVETS 502 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/40 (55%), Positives = 25/40 (62%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDT 488 PPPP PPPP P PPPPPPPPPPP+ +L D+ Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPVETSPKIVLAGTTANDS 515 [142][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 PPPP PPPP P PPPPPPPPPPP P + + Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPAYEA 292 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPP 287 [143][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP A K Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPAAK 91 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 366 RPPPP*PPPPSPYPPPPPPPPPPPLAP 446 RP PP PPPP P PPPPPPPPPPP P Sbjct: 61 RPTPPPPPPPPPPPPPPPPPPPPPPPP 87 [144][TOP] >UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G232_9DELT Length = 136 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 445 GANGGGGG-GGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGG GGGGGGYG GGGGYGGGG R G G Sbjct: 56 GRGGGGGGRGGGGGGYGGGGGGYGGGGGGRGGGGGG 91 [145][TOP] >UniRef100_Q8LPA7 Cold shock protein-1 n=1 Tax=Triticum aestivum RepID=Q8LPA7_WHEAT Length = 229 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGLQVQIS-FCPE 311 G GGGG GGGGGGYG GGGGYGGGG R G + IS CP+ Sbjct: 102 GGGGGGGYGGGGGGYGGGGGGYGGGGGGRGCYKCGEEGHISRDCPQ 147 [146][TOP] >UniRef100_C5XFL3 Putative uncharacterized protein Sb03g043450 n=1 Tax=Sorghum bicolor RepID=C5XFL3_SORBI Length = 578 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/48 (58%), Positives = 29/48 (60%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGLQVQISFCPERRS 302 G GGGG GGGGGYG GGGGYGGGGR G GL P+ RS Sbjct: 68 GRGRGGGGRGGGGGYGGGGGGYGGGGRGGGRGRDGLDSLALPKPDFRS 115 [147][TOP] >UniRef100_A4RZU2 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RZU2_OSTLU Length = 779 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPP 437 PL PPPP PPPP P PPPPPPPPPPP Sbjct: 336 PLECAPPPPPPPPPPPPPPPPPPPPPPPP 364 [148][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/66 (45%), Positives = 34/66 (51%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRPRIGSPGTE 548 PPPP PPPP P PPPPPPPPPPP P LE + SS R G+ ++ Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRFVLERFSKTCTSS----REAKGAADSQ 82 Query: 549 LEFTGR 566 TGR Sbjct: 83 HSETGR 88 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPP 51 [149][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPR 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 [150][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKL 476 PPPP PPPP P PPPPPPPPPPP P + ++ + Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNI 67 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 LTPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 T P P PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPP 56 [151][TOP] >UniRef100_Q92H62 Arp2/3 complex-activating protein rickA n=1 Tax=Rickettsia conorii RepID=RICKA_RICCN Length = 517 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/71 (43%), Positives = 39/71 (54%), Gaps = 6/71 (8%) Frame = +3 Query: 369 PPPP*PPP------PSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRPRI 530 PPPP PPP PSP PPPP PPPPPP+AP L+ +E T+ +++ PRP I Sbjct: 349 PPPPPPPPLPENNIPSPPPPPP-PPPPPPMAPAQAETLSKPIESTTVKKLANQ--PRPSI 405 Query: 531 GSPGTELEFTG 563 + E G Sbjct: 406 DTSDLMREIAG 416 [152][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKH 452 PPPP PPPP P PPPPPPPPPPP A K+ Sbjct: 338 PPPPRPPPPPPPPPPPPPPPPPPPALKN 365 [153][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%), Gaps = 3/33 (9%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPP---PPPPPPL 440 P VL PPPP PPPPSP PPPPP PPPPPP+ Sbjct: 437 PPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPV 469 [154][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [155][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [156][TOP] >UniRef100_UPI0000F2C630 PREDICTED: similar to zinc finger homeodomain 4, n=1 Tax=Monodelphis domestica RepID=UPI0000F2C630 Length = 3606 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +P PL + PPP PPPP P PPPPPPPPPPP AP Sbjct: 1993 TPPTPL---QAPPPTPPPPPPPPPPPPPPPPPPSAP 2025 [157][TOP] >UniRef100_UPI0000E7FF28 PREDICTED: similar to zinc-finger homeodomain protein 4 isoform 2 n=1 Tax=Gallus gallus RepID=UPI0000E7FF28 Length = 3618 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPP 434 +P PL L+ PPPP PPPP P PPPPPPPPPP Sbjct: 3143 APSKPL-LQTPPPPPPPPPPPPPPPPPPPPPP 3173 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 372 PPP*PPPPSPYPPPPPPPPPPPLAP 446 PPP PPPP P PPPPPPPPPPP AP Sbjct: 2028 PPPTPPPPPPPPPPPPPPPPPPSAP 2052 [158][TOP] >UniRef100_UPI0000E23E7D PREDICTED: WAS protein homology region 2 domain containing 1 n=1 Tax=Pan troglodytes RepID=UPI0000E23E7D Length = 813 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPL 440 PPPP PPPP P PPPPPPPPPPPL Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPL 663 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPP 437 L PPPP PPPP P PPPPPPPPPPP Sbjct: 636 LSLPPPPPPPPPPPPPPPPPPPPPPP 661 [159][TOP] >UniRef100_UPI0000DB6EF9 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6EF9 Length = 283 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGLQVQIS 323 GA GGGGGGGGGGG G GGGG GGGG G PG + S Sbjct: 72 GAGGGGGGGGGGGGSGGGGGGGGGGGYYEHGGFPGNAIATS 112 [160][TOP] >UniRef100_UPI0000DA3CD5 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3CD5 Length = 311 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGLQVQIS 323 G GGGGGGGGGGG G GGGG GGGG R+ G G + +S Sbjct: 204 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGRGILLS 244 [161][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPL 440 PPPP PPPP P PPPPPPPPPPPL Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPL 486 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPP 437 L PPPP PPPP P PPPPPPPPPPP Sbjct: 459 LPPPPPPPPPPPPPPPPPPPPPPPPP 484 [162][TOP] >UniRef100_UPI000184A37E Proline-rich protein 12. n=2 Tax=Canis lupus familiaris RepID=UPI000184A37E Length = 1206 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 +P PL+ E+PPP PP P+P P PPPPPPPPP P Sbjct: 621 TPEPPLLEEKPPPSPPPAPTPQPLPPPPPPPPPALP 656 [163][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 1487 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 1517 [164][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 1483 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 1513 [165][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 1483 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 1513 [166][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2299 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2329 [167][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [168][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2299 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2329 [169][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPP 434 +P PL L+ PPPP PPPP P PPPPPPPPPP Sbjct: 3057 APSKPL-LQTPPPPPPPPPPPPPPPPPPPPPP 3087 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 372 PPP*PPPPSPYPPPPPPPPPPPLAP 446 PPP PPPP P PPPPPPPPPPP AP Sbjct: 1952 PPPTPPPPPPPPPPPPPPPPPPSAP 1976 [170][TOP] >UniRef100_UPI0000ECD10B Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10B Length = 3578 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPP 434 +P PL L+ PPPP PPPP P PPPPPPPPPP Sbjct: 3103 APSKPL-LQTPPPPPPPPPPPPPPPPPPPPPP 3133 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 372 PPP*PPPPSPYPPPPPPPPPPPLAP 446 PPP PPPP P PPPPPPPPPPP AP Sbjct: 1988 PPPTPPPPPPPPPPPPPPPPPPSAP 2012 [171][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P L PPP PPPPSP PPPPPPPPPPP P Sbjct: 248 SPPPPSPLPPSPPP-PPPPSPPPPPPPPPPPPPPPP 282 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +3 Query: 342 PGDPLVLERPPPP*P-PPPSPYPPPPPPPPPPPLAP 446 P PL PPPP P PPP P PPPPPPPPPPP +P Sbjct: 251 PPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSP 286 [172][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%), Gaps = 3/33 (9%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPP---PPPPPPL 440 P VL PPPP PPPPSP PPPPP PPPPPP+ Sbjct: 437 PPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPV 469 [173][TOP] >UniRef100_Q95UX1 No on or off transient A (Fragment) n=1 Tax=Drosophila americana americana RepID=Q95UX1_DROAE Length = 165 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GG G GGGGR R GS G Sbjct: 73 GGGGGGGGGGGGGGGGGGGAGGGGGGRDRNRGSRG 107 [174][TOP] >UniRef100_Q95UX0 No on or off transient A (Fragment) n=1 Tax=Drosophila novamexicana RepID=Q95UX0_9MUSC Length = 166 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GG G GGGGR R GS G Sbjct: 74 GGGGGGGGGGGGGGGGGGGAGGGGGGRDRNRGSRG 108 [175][TOP] >UniRef100_Q95UW9 No on or off transient A (Fragment) n=1 Tax=Drosophila lummei RepID=Q95UW9_9MUSC Length = 163 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 436 GGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 74 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 105 [176][TOP] >UniRef100_Q95UW7 No on or off transient A (Fragment) n=1 Tax=Drosophila americana americana RepID=Q95UW7_DROAE Length = 163 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GG G GGGGR R GS G Sbjct: 71 GGGGGGGGGGGGGGGGGGGAGGGGGGRDRNRGSRG 105 [177][TOP] >UniRef100_Q95UW6 No on or off transient A (Fragment) n=1 Tax=Drosophila ezoana RepID=Q95UW6_DROEZ Length = 161 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 436 GGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 GGGGGGGGGGG G GGGG GGGGR R GS G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 101 [178][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPPPPPP P+ Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPQ 83 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPP 81 [179][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPK 449 P P +P PP PPPP P PPPPPPPPPPP APK Sbjct: 215 PPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPP-APK 249 [180][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/79 (45%), Positives = 41/79 (51%), Gaps = 11/79 (13%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEED----TLFAISSLSI- 515 PL PPPP PPP S PPPPPPPPPPP++P SL S + TL AI SL+ Sbjct: 150 PLPQPPPPPPPPPPASAPPPPPPPPPPPPISP---SLPPSNPPDRGGAFTLPAIMSLTAV 206 Query: 516 ------PRPRIGSPGTELE 554 P P +P T E Sbjct: 207 SSEIAPPNPITQAPATRAE 225 [181][TOP] >UniRef100_Q3IRX0 Putative uncharacterized protein n=1 Tax=Natronomonas pharaonis DSM 2160 RepID=Q3IRX0_NATPD Length = 1147 Score = 57.0 bits (136), Expect = 3e-06 Identities = 47/168 (27%), Positives = 70/168 (41%), Gaps = 15/168 (8%) Frame = -3 Query: 553 SSSVPGDPIRGRGIDKLDIANRVSSSNLLLRRELCLGANGGGGGGGGGGGYGDGGGGYGG 374 S S+P D G L + + + + E NGGGGGGGGGGG GGGG GG Sbjct: 870 SVSIPSDADTGDYDATLSVGDETETRTFEV--EAATTGNGGGGGGGGGGGGAVGGGGGGG 927 Query: 373 GGRSRT---------SGSPGLQVQISFCPERRSTD--NHRRKWKKQYPAEEHR*PPPEME 227 GG S + G PG+ +Q + S + + R PP Sbjct: 928 GGPSTSMSTAIEDSAPGQPGITIQTGRIDDLDSITLFDETATGSVRVNGYGDRLPPRSPS 987 Query: 226 ETISRIVTEIEDLRENHHIDNPQPLS*TISHR----SPNPPQKLPTLR 95 +++ +E + + + D+P L TI +R + P++L LR Sbjct: 988 MGTQPVISAVEVIVPDAYADSPGSLRFTIHNRQLLHADTEPEELRVLR 1035 [182][TOP] >UniRef100_O73590 Zinc finger homeobox protein 4 n=1 Tax=Gallus gallus RepID=ZFHX4_CHICK Length = 3573 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPP 434 +P PL L+ PPPP PPPP P PPPPPPPPPP Sbjct: 3098 APSKPL-LQTPPPPPPPPPPPPPPPPPPPPPP 3128 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 372 PPP*PPPPSPYPPPPPPPPPPPLAP 446 PPP PPPP P PPPPPPPPPPP AP Sbjct: 1983 PPPTPPPPPPPPPPPPPPPPPPSAP 2007 [183][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2299 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2329 [184][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [185][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [186][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +3 Query: 354 LVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 L + PPP PPPP P PPPPPPPPPPPL P Sbjct: 2299 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPP 2329 [187][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 372 PPP*PPPPSPYPPPPPPPPPPPLAP 446 PPP PPPP P PPPPPPPPPPPL P Sbjct: 2346 PPPPPPPPPPPPPPPPPPPPPPLPP 2370 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPPP PPP +PK Sbjct: 2349 PPPPPPPPPPPPPPPPPPPLPPPTSPK 2375 [188][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPP 241 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPP 242 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 219 PPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 220 PPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLA 443 PPPP PPPP P PPPPPPPPPPP A Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPA 246 [189][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLA 443 PPPP PPPP P PPPPPPPPPPP A Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPA 337 [190][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHN 455 P P+ PPPP PPPP Y PPPPPPPPPP P ++ Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYS 481 [191][TOP] >UniRef100_Q41188 Glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q41188_ARATH Length = 203 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSG 350 G GGGGG GGGGGYG GGGGYGGGGR G Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 [192][TOP] >UniRef100_Q339W6 Oxidoreductase, FAD-binding family protein, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q339W6_ORYSJ Length = 455 Score = 56.6 bits (135), Expect = 4e-06 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 5/74 (6%) Frame = -3 Query: 565 RPVNSSSVPGDPIR--GRGIDKLDIANRVSSSN---LLLRRELCLGANGGGGGGGGGGGY 401 RP ++ PG P R GRG D L + +S L R EL G +GGG GGGGGGG Sbjct: 363 RPCSAGVPPGAPRRRGGRGGDGLPLPPATASMTETPLKAREEL--GVDGGGAGGGGGGGE 420 Query: 400 GDGGGGYGGGGRSR 359 G GGGG G G +R Sbjct: 421 GGGGGGVGSGSGAR 434 [193][TOP] >UniRef100_C5XPK9 Putative uncharacterized protein Sb03g026730 n=1 Tax=Sorghum bicolor RepID=C5XPK9_SORBI Length = 613 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P PL PPPP PPPPSP PPPP PPPP P P Sbjct: 405 PSPPLPPPSPPPPSPPPPSPSPPPPSPPPPSPPPP 439 [194][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPPPPPP +P Sbjct: 55 PPPPLPPPPSPPPPPPPPPPPPSKSP 80 [195][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPPSP PPPP PPPPPP P Sbjct: 483 PPSPPPPSPPPPPSPPPPSPPPPPPSPPPPPPSPP 517 [196][TOP] >UniRef100_B7Q972 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q972_IXOSC Length = 117 Score = 56.6 bits (135), Expect = 4e-06 Identities = 32/86 (37%), Positives = 42/86 (48%) Frame = -3 Query: 598 RVFPVTDVVKRRPVNSSSVPGDPIRGRGIDKLDIANRVSSSNLLLRRELCLGANGGGGGG 419 RV P+ V +R N+ + L ++ ++ +LL+ G GGGGGG Sbjct: 12 RVRPIPPHVIQRETNTGA------------SLKTTQKIEANKILLKLATGGGGGGGGGGG 59 Query: 418 GGGGGYGDGGGGYGGGGRSRTSGSPG 341 GGGGG G GGGG GGGG G G Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGGGGGG 85 [197][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPP 26 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPP 79 [198][TOP] >UniRef100_B4QT65 GD21099 n=1 Tax=Drosophila simulans RepID=B4QT65_DROSI Length = 360 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 141 PPPPPPPPPPPPPPPPPPPPPPPGVP 166 [199][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/49 (53%), Positives = 29/49 (59%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDT 488 P PL PPPP PPPP P PPPPPPPP PP P ++ S + DT Sbjct: 312 PPPPLPSPPPPPPTPPPPPP-PPPPPPPPNPPFIPPAEPVIPSFADFDT 359 [200][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 841 PPPPPPPPPPPPPPPPPPPPPPPPPP 866 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 842 PPPPPPPPPPPPPPPPPPPPPPPPPP 867 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPP 437 L PPPP PPPP P PPPPPPPPPPP Sbjct: 840 LPPPPPPPPPPPPPPPPPPPPPPPPP 865 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLA 443 PPPP PPPP P PPPPPPPPPPP A Sbjct: 844 PPPPPPPPPPPPPPPPPPPPPPPPA 868 [201][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPP 437 L PPPP PPPP P PPPPPPPPPPP Sbjct: 918 LPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLA 443 PPPP PPPP P PPPPPPPPPPP A Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPA 946 [202][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPP P PPPPPPPPPPP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 360 LERPPPP*PPPPSPYPPPPPPPPPPP 437 L PPPP PPPP P PPPPPPPPPPP Sbjct: 918 LPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLA 443 PPPP PPPP P PPPPPPPPPPP A Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPA 946 [203][TOP] >UniRef100_C1H5C0 Decaprenyl-diphosphate synthase subunit 1 n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1H5C0_PARBA Length = 533 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 PPPP PPPP P PPPPPPPPPP L P + Sbjct: 117 PPPPPPPPPPPPPPPPPPPPPPSLQPSQTPI 147 Score = 55.5 bits (132), Expect = 8e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPP 437 PPPP PPPP P PPPPPPPPPPP Sbjct: 116 PPPPPPPPPPPPPPPPPPPPPPP 138 [204][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPP---SPYPPPPPPPPPPPLAP 446 SP PL PPPP PP P SP PPPPPPPPPPP P Sbjct: 111 SPSPPLSYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPP 149 [205][TOP] >UniRef100_UPI0000F2CB43 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2CB43 Length = 252 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGGGGGGGG G GGGG G GG S +SGS G Sbjct: 199 GGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSGG 233 [206][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 E+PPPP PPP P PPPPPPPPPPP P Sbjct: 471 EKPPPPVPPPTPPPPPPPPPPPPPPPPP 498 [207][TOP] >UniRef100_UPI0000DA3E0C PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3E0C Length = 542 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 E+PPPP PPP P PPPPPPPPPPP P Sbjct: 409 EKPPPPVPPPTPPPPPPPPPPPPPPPPP 436 [208][TOP] >UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3D7B Length = 211 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSG 350 G GGGGGGGGGGG GDGGGG GGGGR G Sbjct: 153 GGGGGGGGGGGGGGRGDGGGGGGGGGRGGGGG 184 [209][TOP] >UniRef100_UPI00005A3A5F PREDICTED: similar to zinc finger protein 312 isoform 4 n=1 Tax=Canis lupus familiaris RepID=UPI00005A3A5F Length = 470 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = -3 Query: 469 LLRRELCLGANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGL 338 L + L G GGGGGGGGGGG G GGGG GGGG + G+ GL Sbjct: 94 LWKSSLRAGGGGGGGGGGGGGGGGGGGGGGGGGGGAPVCGASGL 137 [210][TOP] >UniRef100_Q69ZN8 MKIAA1205 protein (Fragment) n=3 Tax=Mus musculus RepID=Q69ZN8_MOUSE Length = 1848 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPL 440 +P PL+ E+PPP PP P+P P PPPPPPPPP+ Sbjct: 1251 TPEPPLLEEKPPPTPPPAPTPQPAPPPPPPPPPV 1284 [211][TOP] >UniRef100_UPI0000DC0B77 similar to Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (LOC307738), mRNA n=1 Tax=Rattus norvegicus RepID=UPI0000DC0B77 Length = 430 Score = 56.2 bits (134), Expect = 5e-06 Identities = 36/78 (46%), Positives = 40/78 (51%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIP 518 SP P L PPP PPPPSP PP PPPPPP L P LL+S + SS S P Sbjct: 36 SPPSPQ-LPSPPPSSPPPPSPPPPLTPPPPPPSLPPSPPPLLSSPPSPPSPPRPSSPSPP 94 Query: 519 RPRIGSPGTELEFTGRRF 572 PR SP ++ RF Sbjct: 95 LPR-SSPHKIVKVNVNRF 111 [212][TOP] >UniRef100_UPI0000EE3DB8 zinc finger homeodomain 4 n=1 Tax=Homo sapiens RepID=UPI0000EE3DB8 Length = 3571 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +3 Query: 360 LERPPP-P*PPPPSPYPPPPPPPPPPPLAP 446 L+ PPP P PPPP P PPPPPPPPPPP AP Sbjct: 1990 LQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 [213][TOP] >UniRef100_UPI00004576BB Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Homo sapiens RepID=UPI00004576BB Length = 3567 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +3 Query: 360 LERPPP-P*PPPPSPYPPPPPPPPPPPLAP 446 L+ PPP P PPPP P PPPPPPPPPPP AP Sbjct: 1990 LQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 [214][TOP] >UniRef100_UPI000184A096 Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Canis lupus familiaris RepID=UPI000184A096 Length = 3623 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +3 Query: 372 PPP*PPPPSPYPPPPPPPPPPPLAP 446 PPP PPPP P PPPPPPPPPPP AP Sbjct: 2049 PPPTPPPPPPPPPPPPPPPPPPSAP 2073 [215][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/73 (41%), Positives = 35/73 (47%), Gaps = 12/73 (16%) Frame = +3 Query: 342 PGDPLVLERPPPP*------------PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEED 485 P P LERPPPP PPPP P PPPPPPPPPPPL + + Sbjct: 409 PTAPEPLERPPPPPAPPLPGPTTAPRPPPPPPPPPPPPPPPPPPLPGMRAAFPSPPPPPP 468 Query: 486 TLFAISSLSIPRP 524 S+++IP P Sbjct: 469 PPLPNSAITIPAP 481 [216][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPP PPPPPPP +P Sbjct: 139 PPPPSPPPPSPPPPPSPPPPPPPPSP 164 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PP PPPPPPPP P Sbjct: 244 PPPPSPPPPSPPPPSPPPPPPPPSPP 269 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPPP PPPP P Sbjct: 249 PPPPSPPPPSPPPPPPPPSPPPPSPP 274 [217][TOP] >UniRef100_B4UMN2 CHRD domain containing protein n=1 Tax=Anaeromyxobacter sp. K RepID=B4UMN2_ANASK Length = 411 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGG 368 G GGGGGGGGGGGYGDGGGG GGGG Sbjct: 26 GGYGGGGGGGGGGGYGDGGGGGGGGG 51 [218][TOP] >UniRef100_C1E983 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E983_9CHLO Length = 1724 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSL 461 E PPPP PPPPSP PPPPPPPP PP P N L Sbjct: 1140 EAPPPPSPPPPSPPPPPPPPPPAPP-PPNANPL 1171 [219][TOP] >UniRef100_C1E4Y1 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E4Y1_9CHLO Length = 1031 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPK 449 SP P RPPPP PPPP P PPPPPP PPPP PK Sbjct: 456 SPPPPPEPSRPPPPPPPPPPP-PPPPPPRPPPPNPPK 491 [220][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGG GGGGGGYG GGGGYGGGG G G Sbjct: 112 GGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 146 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Frame = -3 Query: 445 GANGGGGG-GGGGGGYGDGGGGYGGGGRSRTSGSPGLQVQIS-FCPERRS 302 G GGGGG GGGGGGYG GGGGYGGGG G G + + F P RR+ Sbjct: 118 GYGGGGGGYGGGGGGYGGGGGGYGGGGGGSGGGGGGRSLGPNPFGPSRRT 167 [221][TOP] >UniRef100_A7Z068 LMOD2 protein n=1 Tax=Bos taurus RepID=A7Z068_BOVIN Length = 553 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = +3 Query: 357 VLERPPPP*--PPPPSPYPPPPPPPPPPPLAPK 449 V RPP P PPPP P PPPPPPPPPPPLAP+ Sbjct: 410 VRSRPPSPAAPPPPPPPPPPPPPPPPPPPLAPQ 442 [222][TOP] >UniRef100_B7QIC5 E3 ubiquitin ligase, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QIC5_IXOSC Length = 86 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGLQVQISF 320 G GGGGGGGGGGG G GGGG GGGG G GL I+F Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGLVEDINF 85 [223][TOP] >UniRef100_B4ND74 GK24962 n=1 Tax=Drosophila willistoni RepID=B4ND74_DROWI Length = 282 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P + P PP PPPP+P PPPPPPPPPPP P Sbjct: 76 PETIAPPAPPPPPPPTPPPPPPPPPPPPPTPP 107 [224][TOP] >UniRef100_B4MSY7 GK20058 (Fragment) n=1 Tax=Drosophila willistoni RepID=B4MSY7_DROWI Length = 649 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/53 (56%), Positives = 33/53 (62%) Frame = -3 Query: 499 IANRVSSSNLLLRRELCLGANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 I+N SS NL LR G+ GGG GGGGGGG G GGGG GGGG + S G Sbjct: 301 ISNSYSSKNLHLRFT-SRGSGGGGNGGGGGGGGGGGGGGGGGGGAASDDDSEG 352 [225][TOP] >UniRef100_B3MET3 GF12424 n=1 Tax=Drosophila ananassae RepID=B3MET3_DROAN Length = 613 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGGGG GGGGGYG GGG GGGG R G PG Sbjct: 224 GGAGGGGGAGGGGGYGGGGGAGGGGGGGRGPGGPG 258 [226][TOP] >UniRef100_A9V3V4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V3V4_MONBE Length = 2296 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 4/38 (10%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPP----SPYPPPPPPPPPPPLA 443 P P PPPP PPPP SP PPPPPPPPPPP+A Sbjct: 2133 PPPPAAASPPPPPPPPPPLVAASPPPPPPPPPPPPPVA 2170 [227][TOP] >UniRef100_A5DRR5 Putative uncharacterized protein n=1 Tax=Lodderomyces elongisporus RepID=A5DRR5_LODEL Length = 996 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/58 (48%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPS--PY----PPPPPPPPPPPLAPKHNSLLNSKLEEDTLF 494 SP P PPPP PPPPS P+ PPPPPPPPPPP P H+ S F Sbjct: 934 SPPQPQPPSPPPPPPPPPPSLIPFGASPPPPPPPPPPPPPPPPHSPSSPSSTSSSATF 991 [228][TOP] >UniRef100_Q86UP3 Zinc finger homeobox protein 4 n=1 Tax=Homo sapiens RepID=ZFHX4_HUMAN Length = 3567 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = +3 Query: 360 LERPPP-P*PPPPSPYPPPPPPPPPPPLAP 446 L+ PPP P PPPP P PPPPPPPPPPP AP Sbjct: 1990 LQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 [229][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/72 (43%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +3 Query: 234 SGGGYRCSSAGYCFFHFRRWLSVLLRSGQNEI*TCSPGDPLVLERPPPP*PP-PPSPYPP 410 +G G CS+ G+C S ++ Q++ SP P PPPP PP PP P PP Sbjct: 119 TGTGQCCSNGGWCGTTSDYCAS---KNCQSQCKLPSPPPPPPPPSPPPPSPPSPPPPSPP 175 Query: 411 PPPPPPPPPLAP 446 PPPPP PPP +P Sbjct: 176 PPPPPSPPPPSP 187 [230][TOP] >UniRef100_Q05966 Glycine-rich RNA-binding protein 10 n=1 Tax=Brassica napus RepID=GRP10_BRANA Length = 169 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G G GGGG GGGGYG GGGGYGGGG R G G Sbjct: 120 GGYGSGGGGRGGGGYGSGGGGYGGGGGRRDGGGYG 154 [231][TOP] >UniRef100_UPI0001923DA0 PREDICTED: similar to predicted protein n=1 Tax=Hydra magnipapillata RepID=UPI0001923DA0 Length = 1853 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +3 Query: 342 PGDPLVLERPPP--P*PPPPSPYPPPPPPPPPPPLAP 446 P P PPP P PPPP P PPPPPPPPPPP +P Sbjct: 1384 PSQPTYFPPPPPHLPLPPPPPPPPPPPPPPPPPPPSP 1420 [232][TOP] >UniRef100_UPI000151AF18 hypothetical protein PGUG_03629 n=1 Tax=Pichia guilliermondii ATCC 6260 RepID=UPI000151AF18 Length = 1711 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/61 (45%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Frame = +3 Query: 369 PPPP*PPPPSPYPPP--------PPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRP 524 PPPP PPPP P PPP PPPPPPPP P +S + +E T A + PRP Sbjct: 1091 PPPPPPPPPPPPPPPFLGGSASAPPPPPPPPPLPVPSSRAHKMDKEPTPKADPFAAFPRP 1150 Query: 525 R 527 + Sbjct: 1151 K 1151 [233][TOP] >UniRef100_UPI0000F2DE1B PREDICTED: similar to RNA binding motif protein 15B n=1 Tax=Monodelphis domestica RepID=UPI0000F2DE1B Length = 903 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/60 (48%), Positives = 34/60 (56%), Gaps = 8/60 (13%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLE--------EDTLF 494 SPG +L PP P PP P+P PPPPP P PPP P++ +LL S L ED LF Sbjct: 120 SPGASPLLLLPPLPEPPAPAPAPPPPPAPAPPPPPPEYKTLLISSLSPALPAEHLEDRLF 179 [234][TOP] >UniRef100_UPI0000F2DD8B PREDICTED: similar to zinc finger protein 312, n=1 Tax=Monodelphis domestica RepID=UPI0000F2DD8B Length = 800 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPGLQV 332 G GGGGGGGGGGG G GGGG GGGG GS G Q+ Sbjct: 535 GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGSGGPQI 572 [235][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = +3 Query: 333 TCSPGDPLVLERPPPP*PPPPSPYPP--PPPPPPPPPLAP 446 +C+P P PPPP PPPPSP PP PPPP PPPPL P Sbjct: 1169 SCNPPSP-----PPPPSPPPPSPPPPPSPPPPSPPPPLPP 1203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAP 446 PPPP PPPPSP PPPPP PPPPP P Sbjct: 234 PPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 SP P PPPP PPPPSP PP PPPP PPP +P Sbjct: 2707 SPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2742 [236][TOP] >UniRef100_Q2NNS2 1629capsid n=1 Tax=Hyphantria cunea nucleopolyhedrovirus RepID=Q2NNS2_NPVHC Length = 539 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEE 482 PPPP PPP P PPPPPPPPP L P N LLN+ + E Sbjct: 253 PPPPPPPPNMPPPPPPPPPPPLSLPPIDNLLLNAIVSE 290 [237][TOP] >UniRef100_Q7V9D6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9313 RepID=Q7V9D6_PROMM Length = 199 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSRTSGSPG 341 G GGG GGGGGGGYG GGGGYGGGG G G Sbjct: 95 GGGGGGYGGGGGGGYGGGGGGYGGGGGGYGGGGYG 129 [238][TOP] >UniRef100_Q2RTE8 Putative uncharacterized protein n=1 Tax=Rhodospirillum rubrum ATCC 11170 RepID=Q2RTE8_RHORT Length = 208 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/46 (52%), Positives = 29/46 (63%) Frame = +3 Query: 348 DPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNSLLNSKLEED 485 +P+ P PP PPPP P PPPPPPPPPPP P S++E+D Sbjct: 84 EPIPEPEPEPPPPPPPPPPPPPPPPPPPPPEPPP----FVSEIEDD 125 [239][TOP] >UniRef100_Q212G2 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas palustris BisB18 RepID=Q212G2_RHOPB Length = 1026 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/38 (60%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPS---PYPPPPPPPPPPPLAP 446 P P+V + PPPP PPPP P PPPPPPPPPP + P Sbjct: 955 PPPPVVRQAPPPPPPPPPPVVRPAPPPPPPPPPPVMRP 992 [240][TOP] >UniRef100_B0BYE9 Arp2/3 complex activation protein n=1 Tax=Rickettsia rickettsii str. Iowa RepID=B0BYE9_RICRO Length = 481 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/73 (43%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +3 Query: 351 PLVLERPPPP*PPPPSPYP--PPPPPPPPPPLAPKHNSLLNSKLEEDTLFAISSLSIPRP 524 PL PPPP PPPP P PPPPPPPPPP+AP L+ +E T+ + + PRP Sbjct: 312 PLENNIPPPPPPPPPLPDNNIPPPPPPPPPPMAPV--KTLSKAVEATTVKKLENQ--PRP 367 Query: 525 RIGSPGTELEFTG 563 I + E G Sbjct: 368 SIDTSDLMREIAG 380 [241][TOP] >UniRef100_A5V8M1 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V8M1_SPHWW Length = 373 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPL 440 PPPP PPPP P PPPPPPPPPPP+ Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPV 259 [242][TOP] >UniRef100_A5V4K4 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V4K4_SPHWW Length = 373 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPL 440 PPPP PPPP P PPPPPPPPPPP+ Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPV 258 [243][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 E PPP PPPP P PPPPPPPPPPP P Sbjct: 41 EAAPPPPPPPPPPPPPPPPPPPPPPTPP 68 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPP PPPP PK Sbjct: 48 PPPPPPPPPPPPPPPPPPTPPPPPLPK 74 [244][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +3 Query: 363 ERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 E PPP PPPP P PPPPPPPPPPP P Sbjct: 41 EAAPPPPPPPPPPPPPPPPPPPPPPTPP 68 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 369 PPPP*PPPPSPYPPPPPPPPPPPLAPK 449 PPPP PPPP P PPPPPP PPPP PK Sbjct: 48 PPPPPPPPPPPPPPPPPPTPPPPPLPK 74 [245][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +3 Query: 342 PGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 P P PPPP PPPPSP PPPPPPPPP P P Sbjct: 95 PPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPP 129 [246][TOP] >UniRef100_C1ZIK1 RRM domain-containing RNA-binding protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZIK1_PLALI Length = 146 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGRSR 359 G GG GGGGGGGGYG GGGGYGGGG R Sbjct: 117 GGGGGYGGGGGGGGYGGGGGGYGGGGGGR 145 [247][TOP] >UniRef100_Q7XHB6 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa RepID=Q7XHB6_ORYSJ Length = 773 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = +3 Query: 339 SPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAPKHNS 458 +P P PPPP P PP+P PPPPPPPP PP PK S Sbjct: 436 APSPPAPPPPPPPPAPSPPAPPPPPPPPPPCPPAPPKTRS 475 [248][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 306 LRSGQNEI*TCSPGDPLVLERPPPP*PPPPSPYPPPP-PPPPPPPLAPKHNSLLN 467 L+ + EI +P P PPPP PPPP+P PPPP PPPPPPP P ++N Sbjct: 421 LQRSETEIFASTPPPPP--PPPPPPPPPPPTPPPPPPRPPPPPPPPPPVEKVIVN 473 [249][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/50 (52%), Positives = 29/50 (58%) Frame = +3 Query: 297 SVLLRSGQNEI*TCSPGDPLVLERPPPP*PPPPSPYPPPPPPPPPPPLAP 446 S L QN+ C P + PPPP PPPPSP PP PPPP PPP +P Sbjct: 171 SAALFDSQND---CCPISTPGIPSPPPPSPPPPSPPPPSPPPPSPPPPSP 217 [250][TOP] >UniRef100_C0Z2E8 AT4G38680 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2E8_ARATH Length = 204 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 445 GANGGGGGGGGGGGYGDGGGGYGGGGR 365 G GGGGG GGGGGYG GGGGYGGGGR Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGR 176