[UP]
[1][TOP] >UniRef100_A1BQW1 Glycine-rich RNA-binding protein (Fragment) n=1 Tax=Nicotiana attenuata RepID=A1BQW1_9SOLA Length = 152 Score = 87.0 bits (214), Expect = 3e-15 Identities = 42/56 (75%), Positives = 46/56 (82%), Gaps = 3/56 (5%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGG---GGYGGGG 211 ++G+ D+ DGRNITVNEAQSR GGGGGGGGY GGGGGGYGGGG GGYGGGG Sbjct: 64 IEGMKGQDL-DGRNITVNEAQSRGSGGGGGGGGYRGGGGGGYGGGGRREGGYGGGG 118 [2][TOP] >UniRef100_Q08I87 Putative glycine-rich RNA-binding protein n=1 Tax=Dianthus caryophyllus RepID=Q08I87_DIACA Length = 163 Score = 86.3 bits (212), Expect = 5e-15 Identities = 46/70 (65%), Positives = 51/70 (72%), Gaps = 9/70 (12%) Frame = +2 Query: 56 DGIDKLD--IVDGRNITVNEAQSRPRGGGGGGGGY--GGGGGGGYGGGGGGY-----GGG 208 D ID+++ +DGR+ITVNEAQSR GGGGGGGGY GGGGGGGYGGGGGGY GGG Sbjct: 62 DAIDEMNGKELDGRSITVNEAQSRGSGGGGGGGGYRSGGGGGGGYGGGGGGYGGRREGGG 121 Query: 209 GRSRTSGSPG 238 G GS G Sbjct: 122 GGGYGGGSGG 131 [3][TOP] >UniRef100_O48567 Glycine-rich RNA-binding protein n=1 Tax=Euphorbia esula RepID=O48567_EUPES Length = 164 Score = 86.3 bits (212), Expect = 5e-15 Identities = 45/60 (75%), Positives = 47/60 (78%), Gaps = 7/60 (11%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYG-GGGGGGYGGGG---GGYGGGG---RSRTSGSPG 238 +DGRNITVNEAQSR GGGGGGGGY GGGGGGYGGGG GGYGGGG SR+SG G Sbjct: 73 LDGRNITVNEAQSRGSGGGGGGGGYSRGGGGGGYGGGGRREGGYGGGGGGYNSRSSGGGG 132 [4][TOP] >UniRef100_P49310 Glycine-rich RNA-binding protein GRP1A n=1 Tax=Sinapis alba RepID=GRP1_SINAL Length = 166 Score = 85.9 bits (211), Expect = 6e-15 Identities = 43/69 (62%), Positives = 51/69 (73%), Gaps = 4/69 (5%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGGGGG----GGYGGGGGGGYGGG 187 T + + M ++G++ D+ DGR+ITVNEAQSR GGGGGG GGY GGGGGYGGG Sbjct: 55 TFKDEKSMKDAIEGMNGQDL-DGRSITVNEAQSRGSGGGGGGRGGGGGYRSGGGGGYGGG 113 Query: 188 GGGYGGGGR 214 GGGYGGGGR Sbjct: 114 GGGYGGGGR 122 [5][TOP] >UniRef100_Q40426 RNA-binding glycine-rich protein-1a n=1 Tax=Nicotiana sylvestris RepID=Q40426_NICSY Length = 156 Score = 85.5 bits (210), Expect = 8e-15 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 3/56 (5%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGG---GGYGGGG 211 ++G++ D+ DGRNITVNEAQSR GGGGGGGGY GG GGGYGGGG GGYGGGG Sbjct: 64 IEGMNGQDL-DGRNITVNEAQSRGSGGGGGGGGYRGGSGGGYGGGGRREGGYGGGG 118 [6][TOP] >UniRef100_A9P8Z7 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8Z7_POPTR Length = 165 Score = 85.5 bits (210), Expect = 8e-15 Identities = 44/73 (60%), Positives = 48/73 (65%), Gaps = 11/73 (15%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGG-----------GGGGY 199 +DG++ D+ DGRNITVNEAQSR GGGGGGGGY GGGGGYGG GGGGY Sbjct: 65 IDGMNGQDL-DGRNITVNEAQSRGSGGGGGGGGYSRGGGGGYGGRREGGGGGYSRGGGGY 123 Query: 200 GGGGRSRTSGSPG 238 GGGG G G Sbjct: 124 GGGGGGYGGGGGG 136 [7][TOP] >UniRef100_B6VA25 Putative glycine-rich RNA-binding protein n=1 Tax=Chorispora bungeana RepID=B6VA25_CHOBU Length = 175 Score = 85.1 bits (209), Expect = 1e-14 Identities = 44/78 (56%), Positives = 52/78 (66%), Gaps = 5/78 (6%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGG-----GGGGGGYGGGGGGGYGG 184 T + + M ++G++ D+ DGR+ITVNEAQSR GG GGGGGGY GGGGGYGG Sbjct: 55 TFKDEKSMKDAIEGMNGQDL-DGRSITVNEAQSRGSGGGGGGRGGGGGGYRSGGGGGYGG 113 Query: 185 GGGGYGGGGRSRTSGSPG 238 GGG YGGGG R G G Sbjct: 114 GGGSYGGGGGRREGGYSG 131 [8][TOP] >UniRef100_B2YKT9 Glycine-rich RNA-binding protein n=1 Tax=Nicotiana tabacum RepID=B2YKT9_TOBAC Length = 157 Score = 84.0 bits (206), Expect = 2e-14 Identities = 48/85 (56%), Positives = 53/85 (62%), Gaps = 12/85 (14%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGG----GGGGGGYGGGGG--------GGYGGGGGG 196 ++G++ D+ DGRNITVNEAQSR GG GGGGGGYGGGGG GGYGGGGGG Sbjct: 64 IEGMNGQDL-DGRNITVNEAQSRGSGGGGGRGGGGGGYGGGGGYGGGGRREGGYGGGGGG 122 Query: 197 YGGGGRSRTSGSPGLQEFGTRVEPY 271 YGGG R G G G R Y Sbjct: 123 YGGGRRDGGYGGGGGYGGGRREGGY 147 [9][TOP] >UniRef100_B8AP37 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AP37_ORYSI Length = 139 Score = 83.6 bits (205), Expect = 3e-14 Identities = 43/59 (72%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGGG-GYGGGGGGYGGGGRSRTSGSPGLQEFG 253 +DGRNITVNEAQSR GGGGGGGGYGGGGGG G G GGGGYGGGG G G +E G Sbjct: 74 LDGRNITVNEAQSRRSGGGGGGGGYGGGGGGYGGGRGGGGYGGGG----GGGYGRREGG 128 [10][TOP] >UniRef100_A7P909 Chromosome chr3 scaffold_8, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7P909_VITVI Length = 162 Score = 82.8 bits (203), Expect = 5e-14 Identities = 43/73 (58%), Positives = 44/73 (60%), Gaps = 20/73 (27%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG--------------------GGGGGYGGGGGGY 199 +DGRNITVNEAQSR GGGGGGGG GG GGGGGYGGGGGGY Sbjct: 74 LDGRNITVNEAQSRGSGGGGGGGGGGGGYRGGGGYGGGGRREGGYSRGGGGGYGGGGGGY 133 Query: 200 GGGGRSRTSGSPG 238 GGG R R G G Sbjct: 134 GGGSRDRGYGDGG 146 [11][TOP] >UniRef100_Q7UEZ2 RNA-binding protein n=1 Tax=Rhodopirellula baltica RepID=Q7UEZ2_RHOBA Length = 206 Score = 82.4 bits (202), Expect = 7e-14 Identities = 44/66 (66%), Positives = 51/66 (77%), Gaps = 5/66 (7%) Frame = +2 Query: 56 DGIDKLD--IVDGRNITVNEAQSR-PR-GGGGGGGGYGGGGGG-GYGGGGGGYGGGGRSR 220 D I+ L+ +DGR++TVNEA+ R PR GGGGGGGGYGGGGGG G GGGGGGYGGGG +R Sbjct: 122 DAIENLNGHEIDGRSVTVNEARPREPRSGGGGGGGGYGGGGGGRGRGGGGGGYGGGGGNR 181 Query: 221 TSGSPG 238 G G Sbjct: 182 GGGYGG 187 [12][TOP] >UniRef100_C5YSY6 Putative uncharacterized protein Sb08g022740 n=1 Tax=Sorghum bicolor RepID=C5YSY6_SORBI Length = 165 Score = 82.4 bits (202), Expect = 7e-14 Identities = 45/78 (57%), Positives = 51/78 (65%), Gaps = 5/78 (6%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGG--GGGGGYG---G 184 T M ++G++ ++ DGRNITVNEAQSR GGGGGGGYGG GGGGGYG G Sbjct: 55 TFSTEEAMRSAIEGMNGKEL-DGRNITVNEAQSRGGRGGGGGGGYGGGRGGGGGYGRRDG 113 Query: 185 GGGGYGGGGRSRTSGSPG 238 GGGGYGGGG G G Sbjct: 114 GGGGYGGGGGGYGGGRGG 131 [13][TOP] >UniRef100_A9PIZ6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa x Populus deltoides RepID=A9PIZ6_9ROSI Length = 171 Score = 82.4 bits (202), Expect = 7e-14 Identities = 45/75 (60%), Positives = 49/75 (65%), Gaps = 13/75 (17%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGY----GGG---------GGGGYGGGGG 193 +DG++ D+ DGRNITVNEAQSR GGGGGGGGY GGG GGGGY GGG Sbjct: 65 IDGMNGQDL-DGRNITVNEAQSRGSGGGGGGGGYNRNSGGGGYGGGGRREGGGGYSRGGG 123 Query: 194 GYGGGGRSRTSGSPG 238 GYGGGG SG G Sbjct: 124 GYGGGGSGYGSGGGG 138 [14][TOP] >UniRef100_Q99069 Glycine-rich RNA-binding protein 1 (Fragment) n=1 Tax=Sorghum bicolor RepID=GRP1_SORBI Length = 142 Score = 82.4 bits (202), Expect = 7e-14 Identities = 45/78 (57%), Positives = 51/78 (65%), Gaps = 5/78 (6%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGG--GGGGGYG---G 184 T M ++G++ ++ DGRNITVNEAQSR GGGGGGGYGG GGGGGYG G Sbjct: 34 TFSTEEAMRSAIEGMNGKEL-DGRNITVNEAQSRGGRGGGGGGGYGGGRGGGGGYGRRDG 92 Query: 185 GGGGYGGGGRSRTSGSPG 238 GGGGYGGGG G G Sbjct: 93 GGGGYGGGGGGYGGGRGG 110 [15][TOP] >UniRef100_Q05966 Glycine-rich RNA-binding protein 10 n=1 Tax=Brassica napus RepID=GRP10_BRANA Length = 169 Score = 82.4 bits (202), Expect = 7e-14 Identities = 45/75 (60%), Positives = 51/75 (68%), Gaps = 8/75 (10%) Frame = +2 Query: 56 DGIDKLD--IVDGRNITVNEAQSRPRGGGG--GGGGYGGGGGGGYGGGGGGY----GGGG 211 D ID+++ +DGR ITVNEAQSR GGGG GGGGYGG GGGGYGGGGGGY GGGG Sbjct: 62 DAIDEMNGKELDGRTITVNEAQSRGGGGGGGRGGGGYGGRGGGGYGGGGGGYGDRRGGGG 121 Query: 212 RSRTSGSPGLQEFGT 256 G G +G+ Sbjct: 122 YGSGGGGRGGGGYGS 136 [16][TOP] >UniRef100_A9P8S6 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9P8S6_POPTR Length = 170 Score = 82.0 bits (201), Expect = 9e-14 Identities = 45/76 (59%), Positives = 49/76 (64%), Gaps = 14/76 (18%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGG----------GGGGYGGG----GGGGYGGGG 190 +DG++ D+ DGRNITVNEAQSR GGGG GGGGYGGG GGGGY GG Sbjct: 65 IDGMNGQDL-DGRNITVNEAQSRGSGGGGGGGGGYNRNSGGGGYGGGGRREGGGGYSRGG 123 Query: 191 GGYGGGGRSRTSGSPG 238 GGYGGGG SG G Sbjct: 124 GGYGGGGSGYGSGGGG 139 [17][TOP] >UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G232_9DELT Length = 136 Score = 81.6 bits (200), Expect = 1e-13 Identities = 43/70 (61%), Positives = 47/70 (67%), Gaps = 5/70 (7%) Frame = +2 Query: 44 DFEVDGIDKLD--IVDGRNITVNEAQSRPRGGGGGGGGYGGG---GGGGYGGGGGGYGGG 208 D + I+K++ IVDGR I VNEA R GGGGG GG GGG GGGGYGGGGGGYGGG Sbjct: 22 DAAKEAIEKMNGAIVDGRAIRVNEANERGGGGGGGRGGGGGGRGGGGGGYGGGGGGYGGG 81 Query: 209 GRSRTSGSPG 238 G R G G Sbjct: 82 GGGRGGGGGG 91 [18][TOP] >UniRef100_A9GC81 RNA-binding protein n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9GC81_SORC5 Length = 138 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/56 (67%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +2 Query: 77 IVDGRNITVNEAQSRP-RG-GGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 ++DGR + VNEAQ RP RG GGGGGGG+GGGGGGG+GGGGGG+GGGG G G Sbjct: 68 VLDGRALKVNEAQERPARGFGGGGGGGFGGGGGGGFGGGGGGFGGGGFGGGGGGRG 123 [19][TOP] >UniRef100_Q41518 Single-stranded nucleic acid binding protein n=1 Tax=Triticum aestivum RepID=Q41518_WHEAT Length = 167 Score = 81.3 bits (199), Expect = 2e-13 Identities = 42/62 (67%), Positives = 43/62 (69%), Gaps = 9/62 (14%) Frame = +2 Query: 80 VDGRNITVNEAQS-RPRGGGGGGGGYGG--------GGGGGYGGGGGGYGGGGRSRTSGS 232 +DGRNITVNEAQS R GGGGGGGGYGG GGGGGYGGGGGGYGG G G Sbjct: 72 LDGRNITVNEAQSRRSGGGGGGGGGYGGQRGGGGGYGGGGGYGGGGGGYGGQGGGGYGGQ 131 Query: 233 PG 238 G Sbjct: 132 RG 133 [20][TOP] >UniRef100_O24106 RNA-binding protein n=1 Tax=Nicotiana glutinosa RepID=O24106_NICGU Length = 156 Score = 81.3 bits (199), Expect = 2e-13 Identities = 47/84 (55%), Positives = 52/84 (61%), Gaps = 11/84 (13%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGG---------GGGGGGYGGGG--GGGYGGGGGGY 199 ++G++ D+ DGRNITVNEAQSR GG GGGGGGYGGGG GGYGGGGGGY Sbjct: 64 IEGMNGQDL-DGRNITVNEAQSRGSGGGGGGYRGGRGGGGGGYGGGGRREGGYGGGGGGY 122 Query: 200 GGGGRSRTSGSPGLQEFGTRVEPY 271 GGG R G G G R Y Sbjct: 123 GGGRREGGYGGGGGYGGGRREGGY 146 [21][TOP] >UniRef100_Q03250 Glycine-rich RNA-binding protein 7 n=1 Tax=Arabidopsis thaliana RepID=GRP7_ARATH Length = 176 Score = 81.3 bits (199), Expect = 2e-13 Identities = 42/75 (56%), Positives = 50/75 (66%), Gaps = 5/75 (6%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGGGG-----GGGYGGGGGGGYGG 184 T + + M ++G++ D+ DGR+ITVNEAQSR GGGGG GGGY GGGGGY G Sbjct: 55 TFKDEKAMKDAIEGMNGQDL-DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSG 113 Query: 185 GGGGYGGGGRSRTSG 229 GGG YGGGG R G Sbjct: 114 GGGSYGGGGGRREGG 128 [22][TOP] >UniRef100_A9EYW0 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9EYW0_SORC5 Length = 139 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = +2 Query: 77 IVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 ++DGR + VNEA+ R + GGGGGGGYGGGGGGGYGGGGGG G GGR G G Sbjct: 68 MMDGRPLRVNEAEERVQRGGGGGGGYGGGGGGGYGGGGGGGGRGGRGGGGGGYG 121 [23][TOP] >UniRef100_Q8RW11 Putative glycine rich protein n=1 Tax=Rumex obtusifolius RepID=Q8RW11_RUMOB Length = 168 Score = 80.9 bits (198), Expect = 2e-13 Identities = 43/71 (60%), Positives = 48/71 (67%), Gaps = 9/71 (12%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYG---------GGGGGYGG 205 ++G++ D+ DGRNITVNEAQSR G GGGGGGY GGGGGGYG GGGGGYGG Sbjct: 65 IEGMNGQDL-DGRNITVNEAQSR--GSGGGGGGYRGGGGGGYGGRREGGYNRGGGGGYGG 121 Query: 206 GGRSRTSGSPG 238 GG G G Sbjct: 122 GGGGYGGGGGG 132 [24][TOP] >UniRef100_C0Z304 AT2G21660 protein n=2 Tax=Arabidopsis thaliana RepID=C0Z304_ARATH Length = 115 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/64 (62%), Positives = 46/64 (71%), Gaps = 5/64 (7%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGG-----GGGYGGGGGGGYGGGGGGYGGGGRS 217 ++G++ D+ DGR+ITVNEAQSR GGGGG GGGY GGGGGY GGGG YGGGG Sbjct: 5 IEGMNGQDL-DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGR 63 Query: 218 RTSG 229 R G Sbjct: 64 REGG 67 [25][TOP] >UniRef100_Q9XEL4 Glycine-rich RNA-binding protein n=1 Tax=Picea glauca RepID=Q9XEL4_PICGL Length = 155 Score = 80.5 bits (197), Expect = 3e-13 Identities = 45/82 (54%), Positives = 50/82 (60%), Gaps = 24/82 (29%) Frame = +2 Query: 56 DGIDKLD--IVDGRNITVNEAQSRPRGGG------------GGGGGYG----------GG 163 D ID ++ ++DGR+ITVN AQSR GGG GGGGGYG GG Sbjct: 64 DAIDAMNGKMLDGRSITVNPAQSRGNGGGGGGGGSRGYRGGGGGGGYGGSRDRGDRGYGG 123 Query: 164 GGGGYGGGGGGYGGGGRSRTSG 229 GGGGYGGGGGGYGGGG SR G Sbjct: 124 GGGGYGGGGGGYGGGGGSRYGG 145 [26][TOP] >UniRef100_Q6YNS1 Putative glycine-rich RNA-binding protein n=1 Tax=Prunus avium RepID=Q6YNS1_PRUAV Length = 178 Score = 80.5 bits (197), Expect = 3e-13 Identities = 42/60 (70%), Positives = 43/60 (71%), Gaps = 2/60 (3%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGG--GGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 +DGRNITVNEAQSR GGGGG GGGY GGGGG GGGGGYGGGGR R G G G Sbjct: 74 LDGRNITVNEAQSRGSGGGGGGNGGGYSRGGGGGGYGGGGGYGGGGR-REGGGGGYSRGG 132 [27][TOP] >UniRef100_Q43472 Low temperature-responsive RNA-binding protein n=1 Tax=Hordeum vulgare RepID=Q43472_HORVU Length = 161 Score = 80.5 bits (197), Expect = 3e-13 Identities = 44/66 (66%), Positives = 47/66 (71%), Gaps = 8/66 (12%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGG----GGGGGGYGG----GGGGGYGGGGGGYGGGGRSRTSGSP 235 +DGRNITVNEAQSR G GGGGGGYGG GGGGGYGGGGGGY GGGRS G Sbjct: 72 LDGRNITVNEAQSRRSDGGGGFGGGGGGYGGQRREGGGGGYGGGGGGY-GGGRSGGGGGY 130 Query: 236 GLQEFG 253 G ++ G Sbjct: 131 GSRDGG 136 [28][TOP] >UniRef100_Q40427 RNA-binding glycine-rich protein-1b n=1 Tax=Nicotiana sylvestris RepID=Q40427_NICSY Length = 148 Score = 80.5 bits (197), Expect = 3e-13 Identities = 40/57 (70%), Positives = 43/57 (75%), Gaps = 4/57 (7%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG----GGGGGYGGGGGGYGGGGRSRTSGSPG 238 +DGR+ITVNEAQ+ RG GGGGGGYGG GGGGGYGGGGGGYGGG R G G Sbjct: 72 LDGRSITVNEAQA--RGSGGGGGGYGGGRREGGGGGYGGGGGGYGGGRREGGGGGYG 126 [29][TOP] >UniRef100_P49311 Glycine-rich RNA-binding protein GRP2A n=1 Tax=Sinapis alba RepID=GRP2_SINAL Length = 169 Score = 80.5 bits (197), Expect = 3e-13 Identities = 44/82 (53%), Positives = 54/82 (65%), Gaps = 2/82 (2%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGGGG 193 T + + M ++G++ D+ DGR+ITVNEAQSR G GGGG G GGG GGGGYGGGGG Sbjct: 55 TFKDEKSMKDAIEGMNGQDL-DGRSITVNEAQSRGSGAGGGGRGGGGGYRGGGGYGGGGG 113 Query: 194 GYGGGGRSRTSGSPGLQEFGTR 259 GYGGG R S G + +R Sbjct: 114 GYGGGRREGGGYSGGGGGYSSR 135 [30][TOP] >UniRef100_C0Z2N6 AT2G21660 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2N6_ARATH Length = 153 Score = 80.1 bits (196), Expect = 4e-13 Identities = 42/75 (56%), Positives = 50/75 (66%), Gaps = 5/75 (6%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGG-----GGGGGGYGGGGGGGYGG 184 T + + M ++G++ D+ DGR+ITVNEAQSR GG GGGGGGY GGGGGY G Sbjct: 55 TFKDEKAMKDAIEGMNGQDL-DGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSG 113 Query: 185 GGGGYGGGGRSRTSG 229 GGG YGGGG S G Sbjct: 114 GGGSYGGGGGSYGGG 128 [31][TOP] >UniRef100_B6SP74 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6SP74_MAIZE Length = 156 Score = 80.1 bits (196), Expect = 4e-13 Identities = 47/77 (61%), Positives = 54/77 (70%), Gaps = 12/77 (15%) Frame = +2 Query: 17 STLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRP-RGGGGGG-------GGYGGGG-- 166 ST E R+ ++G++ ++ DGRNITVNEAQSR RGGGGGG GGYGGGG Sbjct: 57 STEEAMRNA---IEGMNGKEL-DGRNITVNEAQSRGGRGGGGGGYGGGRGGGGYGGGGRR 112 Query: 167 --GGGYGGGGGGYGGGG 211 GGGYGGGGGGYGGGG Sbjct: 113 DGGGGYGGGGGGYGGGG 129 [32][TOP] >UniRef100_Q10FE5 Retrotransposon protein, putative, Ty1-copia subclass, expressed n=1 Tax=Oryza sativa Japonica Group RepID=Q10FE5_ORYSJ Length = 153 Score = 79.7 bits (195), Expect = 5e-13 Identities = 40/54 (74%), Positives = 41/54 (75%), Gaps = 11/54 (20%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGG-----GGGGGGYGGGGGGGYG------GGGGGYGGG 208 +DGRNITVNEAQSR GG GGGGGGYGGGGGGGYG GGGGGYGGG Sbjct: 74 LDGRNITVNEAQSRRSGGGGGGYGGGGGGYGGGGGGGYGRREGGYGGGGGYGGG 127 [33][TOP] >UniRef100_B8A3G8 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B8A3G8_MAIZE Length = 144 Score = 79.7 bits (195), Expect = 5e-13 Identities = 48/85 (56%), Positives = 56/85 (65%), Gaps = 13/85 (15%) Frame = +2 Query: 17 STLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRP-RGGGG--------GGGGYGGGGG 169 ST E R+ ++G++ ++ DGRNITVNEAQSR RGGGG GGGGYGGGGG Sbjct: 57 STEEAMRNA---IEGMNGKEL-DGRNITVNEAQSRGGRGGGGYGGGGRRDGGGGYGGGGG 112 Query: 170 ----GGYGGGGGGYGGGGRSRTSGS 232 GGYGGGGGGYGGG R G+ Sbjct: 113 YGGGGGYGGGGGGYGGGNRGGGYGN 137 [34][TOP] >UniRef100_Q6RY61 Glycine-rich RNA-binding protein RGP-1c (Fragment) n=1 Tax=Nicotiana sylvestris RepID=Q6RY61_NICSY Length = 136 Score = 79.3 bits (194), Expect = 6e-13 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 11/75 (14%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGG---GGGGGYGGG---GGGGYG 181 T + + M ++G++ D+ DGRNITVNEAQSR GGG GGGGGYGGG GGGGYG Sbjct: 17 TFKDEQSMKDAIEGMNGQDL-DGRNITVNEAQSRGGGGGGGRGGGGGYGGGRREGGGGYG 75 Query: 182 -----GGGGGYGGGG 211 GGGGGYGGGG Sbjct: 76 GGRREGGGGGYGGGG 90 [35][TOP] >UniRef100_O24601 Glycine-rich RNA binding protein 1 n=1 Tax=Pelargonium x hortorum RepID=O24601_PELHO Length = 166 Score = 79.3 bits (194), Expect = 6e-13 Identities = 44/89 (49%), Positives = 54/89 (60%), Gaps = 16/89 (17%) Frame = +2 Query: 35 RHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGG------GGGGGGYG----------GGG 166 + M+ ++G++ ++ DGRNITVNEAQSR GG GGGGGGYG GGG Sbjct: 60 KSMNDAIEGMNGQNL-DGRNITVNEAQSRGSGGGGGRREGGGGGGYGRREGGGGYSRGGG 118 Query: 167 GGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGYGGGGGGYGGG G + +G Sbjct: 119 GGGYGGGGGGYGGGNGGGYGGGREQRGYG 147 [36][TOP] >UniRef100_Q0KIW2 Glycine-rich RNA-binding protein n=1 Tax=Triticum aestivum RepID=Q0KIW2_WHEAT Length = 163 Score = 79.0 bits (193), Expect = 8e-13 Identities = 44/69 (63%), Positives = 47/69 (68%), Gaps = 11/69 (15%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGG------GGGGGGYG-----GGGGGGYGGGGGGYGGGGRSRTS 226 +DGRNITVNEAQSR GG GGGGGGYG GGGGGGYGGGGGGY GGRS Sbjct: 72 LDGRNITVNEAQSRRSGGGGGGGFGGGGGGYGGQRREGGGGGGYGGGGGGY-RGGRSGGG 130 Query: 227 GSPGLQEFG 253 G G ++ G Sbjct: 131 GGYGSRDGG 139 [37][TOP] >UniRef100_UPI00016C3DAE RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C3DAE Length = 144 Score = 78.6 bits (192), Expect = 1e-12 Identities = 40/58 (68%), Positives = 42/58 (72%), Gaps = 7/58 (12%) Frame = +2 Query: 86 GRNITVNEA---QSRPRGGGGG----GGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GR +TVNEA + RPRGGGGG GGGYGGGGGGGY GGGGGYGGGG R G G Sbjct: 70 GRRLTVNEAKPREERPRGGGGGYGGGGGGYGGGGGGGY-GGGGGYGGGGGGRRGGGGG 126 [38][TOP] >UniRef100_Q8S2Y6 Glycine-rich RNA binding protein (Fragment) n=3 Tax=Zea mays RepID=Q8S2Y6_MAIZE Length = 156 Score = 78.6 bits (192), Expect = 1e-12 Identities = 43/66 (65%), Positives = 45/66 (68%), Gaps = 15/66 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSR-PRGGGGG--------GGGYGGGGG------GGYGGGGGGYGGGGR 214 +DGRNITVNEAQSR RGGGGG GGGYGGGGG GGYGGGGGGYGGG R Sbjct: 84 LDGRNITVNEAQSRGGRGGGGGGYGGGRRDGGGYGGGGGGYGGGRGGYGGGGGGYGGGNR 143 Query: 215 SRTSGS 232 G+ Sbjct: 144 GGGYGN 149 [39][TOP] >UniRef100_Q8S2Y3 Glycine-rich RNA binding protein (Fragment) n=2 Tax=Zea mays RepID=Q8S2Y3_MAIZE Length = 155 Score = 78.6 bits (192), Expect = 1e-12 Identities = 43/66 (65%), Positives = 45/66 (68%), Gaps = 15/66 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSR-PRGGGGG--------GGGYGGGGG------GGYGGGGGGYGGGGR 214 +DGRNITVNEAQSR RGGGGG GGGYGGGGG GGYGGGGGGYGGG R Sbjct: 83 LDGRNITVNEAQSRGGRGGGGGGYGGGRRDGGGYGGGGGGYGGGRGGYGGGGGGYGGGNR 142 Query: 215 SRTSGS 232 G+ Sbjct: 143 GGGYGN 148 [40][TOP] >UniRef100_Q8S2Y0 Glycine-rich RNA binding protein (Fragment) n=1 Tax=Zea mays RepID=Q8S2Y0_MAIZE Length = 153 Score = 78.6 bits (192), Expect = 1e-12 Identities = 43/66 (65%), Positives = 45/66 (68%), Gaps = 15/66 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSR-PRGGGGG--------GGGYGGGGG------GGYGGGGGGYGGGGR 214 +DGRNITVNEAQSR RGGGGG GGGYGGGGG GGYGGGGGGYGGG R Sbjct: 81 LDGRNITVNEAQSRGGRGGGGGGYGGGRRDGGGYGGGGGGYGGGRGGYGGGGGGYGGGNR 140 Query: 215 SRTSGS 232 G+ Sbjct: 141 GGGYGN 146 [41][TOP] >UniRef100_Q8S2X5 Glycine-rich RNA binding protein (Fragment) n=1 Tax=Zea mays RepID=Q8S2X5_MAIZE Length = 155 Score = 78.6 bits (192), Expect = 1e-12 Identities = 43/66 (65%), Positives = 45/66 (68%), Gaps = 15/66 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSR-PRGGGGG--------GGGYGGGGG------GGYGGGGGGYGGGGR 214 +DGRNITVNEAQSR RGGGGG GGGYGGGGG GGYGGGGGGYGGG R Sbjct: 83 LDGRNITVNEAQSRGGRGGGGGGYGGGRRDGGGYGGGGGGYGGGRGGYGGGGGGYGGGNR 142 Query: 215 SRTSGS 232 G+ Sbjct: 143 GGGYGN 148 [42][TOP] >UniRef100_Q8RUC2 Glycine-rich RNA binding protein (Fragment) n=1 Tax=Zea mays RepID=Q8RUC2_MAIZE Length = 155 Score = 78.6 bits (192), Expect = 1e-12 Identities = 43/66 (65%), Positives = 45/66 (68%), Gaps = 15/66 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSR-PRGGGGG--------GGGYGGGGG------GGYGGGGGGYGGGGR 214 +DGRNITVNEAQSR RGGGGG GGGYGGGGG GGYGGGGGGYGGG R Sbjct: 83 LDGRNITVNEAQSRGGRGGGGGGYGGGRRDGGGYGGGGGGYGGGRGGYGGGGGGYGGGNR 142 Query: 215 SRTSGS 232 G+ Sbjct: 143 GGGYGN 148 [43][TOP] >UniRef100_B6TDT8 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6TDT8_MAIZE Length = 203 Score = 78.6 bits (192), Expect = 1e-12 Identities = 43/66 (65%), Positives = 45/66 (68%), Gaps = 15/66 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSR-PRGGGGG--------GGGYGGGGG------GGYGGGGGGYGGGGR 214 +DGRNITVNEAQSR RGGGGG GGGYGGGGG GGYGGGGGGYGGG R Sbjct: 131 LDGRNITVNEAQSRGGRGGGGGGYGGGRRDGGGYGGGGGGYGGGRGGYGGGGGGYGGGNR 190 Query: 215 SRTSGS 232 G+ Sbjct: 191 GGGYGN 196 [44][TOP] >UniRef100_Q99070 Glycine-rich RNA-binding protein 2 n=1 Tax=Sorghum bicolor RepID=GRP2_SORBI Length = 168 Score = 78.6 bits (192), Expect = 1e-12 Identities = 42/63 (66%), Positives = 44/63 (69%), Gaps = 10/63 (15%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGG-------GGGYGGGGGGYGG---GGRSRTSG 229 +DGRNITVN+AQS RGGGGGGGGYGGGG GGGYGGGGGGYGG GG G Sbjct: 74 LDGRNITVNQAQS--RGGGGGGGGYGGGGGGYGGREGGGYGGGGGGYGGRREGGGGYGGG 131 Query: 230 SPG 238 G Sbjct: 132 GYG 134 [45][TOP] >UniRef100_Q9FUD5 Glycine-rich RNA-binding protein n=1 Tax=Sorghum bicolor RepID=Q9FUD5_SORBI Length = 170 Score = 78.2 bits (191), Expect = 1e-12 Identities = 42/64 (65%), Positives = 44/64 (68%), Gaps = 11/64 (17%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGG--------GGGYGGGGGGYGG---GGRSRTS 226 +DGRNITVN+AQS RGGGGGGGGYGGGG GGGYGGGGGGYGG GG Sbjct: 74 LDGRNITVNQAQS--RGGGGGGGGYGGGGGGYGGRREGGGYGGGGGGYGGRREGGGGYGG 131 Query: 227 GSPG 238 G G Sbjct: 132 GGYG 135 [46][TOP] >UniRef100_Q41810 Glycine-rich protein n=1 Tax=Zea mays RepID=Q41810_MAIZE Length = 155 Score = 78.2 bits (191), Expect = 1e-12 Identities = 45/79 (56%), Positives = 51/79 (64%), Gaps = 6/79 (7%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGG-GGGGYGG---- 184 T M ++G++ ++ DGRNITVNEAQSR G GGGGGGYGGG GGGGYGG Sbjct: 55 TFSTEERMRNRIEGMNGKEL-DGRNITVNEAQSRG-GRGGGGGGYGGGRGGGGYGGGGRR 112 Query: 185 -GGGGYGGGGRSRTSGSPG 238 GGGGYGGGG G G Sbjct: 113 DGGGGYGGGGGYGGGGGYG 131 [47][TOP] >UniRef100_Q40425 RNA-binding gricine-rich protein-1c n=1 Tax=Nicotiana sylvestris RepID=Q40425_NICSY Length = 165 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/66 (62%), Positives = 47/66 (71%), Gaps = 13/66 (19%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGG---GGGGYG----------GGGG 193 ++G++ D+ DGRNITVNEAQSR GGGGGGGG+ GG GGGGYG GGGG Sbjct: 64 IEGMNGQDL-DGRNITVNEAQSRGSGGGGGGGGFRGGRREGGGGYGGGGYGGGRREGGGG 122 Query: 194 GYGGGG 211 GYGGGG Sbjct: 123 GYGGGG 128 [48][TOP] >UniRef100_Q8VX74 Glycine-rich RNA-binding protein n=1 Tax=Ricinus communis RepID=Q8VX74_RICCO Length = 165 Score = 77.8 bits (190), Expect = 2e-12 Identities = 41/56 (73%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGG---GGGYGGGGRSRTSGSPG 238 +DGRNITVNEAQSR GGGGGGGGY GGGGGYGGG GG GGGG SR G G Sbjct: 74 LDGRNITVNEAQSR-GGGGGGGGGYRNGGGGGYGGGRREGGYGGGGGYSRGGGGYG 128 [49][TOP] >UniRef100_C4J6D2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J6D2_MAIZE Length = 149 Score = 77.8 bits (190), Expect = 2e-12 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 18/90 (20%) Frame = +2 Query: 17 STLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRP-RGGGGGG-------GGYGGGG-- 166 ST E R+ ++G++ ++ DGRNITVNEAQSR RGGGGGG GGYGGGG Sbjct: 57 STEEAMRNA---IEGMNGKEL-DGRNITVNEAQSRGGRGGGGGGYGGGRGGGGYGGGGRR 112 Query: 167 --------GGGYGGGGGGYGGGGRSRTSGS 232 GGGYGGGGGGYGGG R G+ Sbjct: 113 DGGGGYGGGGGYGGGGGGYGGGNRGGGYGN 142 [50][TOP] >UniRef100_B9SLQ3 Glycine-rich RNA-binding protein, putative n=1 Tax=Ricinus communis RepID=B9SLQ3_RICCO Length = 166 Score = 77.8 bits (190), Expect = 2e-12 Identities = 41/56 (73%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGG---GGGYGGGGRSRTSGSPG 238 +DGRNITVNEAQSR GGGGGGGGY GGGGGYGGG GG GGGG SR G G Sbjct: 74 LDGRNITVNEAQSR-GGGGGGGGGYRNGGGGGYGGGRREGGYGGGGGYSRGGGGYG 128 [51][TOP] >UniRef100_Q9SWA8 Glycine-rich RNA-binding protein n=1 Tax=Glycine max RepID=Q9SWA8_SOYBN Length = 160 Score = 77.4 bits (189), Expect = 2e-12 Identities = 43/58 (74%), Positives = 44/58 (75%), Gaps = 5/58 (8%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG---GGGGYGG--GGGGYGGGGRSRTSGSPG 238 +DGRNITVNEAQS RGGGGGGGG GGG GGGGYGG GGGG GGG RSR G G Sbjct: 74 LDGRNITVNEAQS--RGGGGGGGGGGGGYNRGGGGYGGRSGGGGGGGGYRSRDGGYGG 129 [52][TOP] >UniRef100_Q8S2Y8 Glycine-rich RNA binding protein (Fragment) n=7 Tax=Zea mays RepID=Q8S2Y8_MAIZE Length = 155 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGGGGGYGGG 208 +DGRNITVNEAQSR G GGGGGGYGGG GGGYGGGGGGYGGG Sbjct: 84 LDGRNITVNEAQSR-GGRGGGGGGYGGGRRDGGGYGGGGGGYGGG 127 [53][TOP] >UniRef100_Q8S2Y7 Glycine-rich RNA binding protein (Fragment) n=1 Tax=Zea mays RepID=Q8S2Y7_MAIZE Length = 139 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGGGGGYGGG 208 +DGRNITVNEAQSR G GGGGGGYGGG GGGYGGGGGGYGGG Sbjct: 68 LDGRNITVNEAQSR-GGRGGGGGGYGGGRRDGGGYGGGGGGYGGG 111 [54][TOP] >UniRef100_Q8S2Y4 Glycine-rich RNA binding protein (Fragment) n=1 Tax=Zea mays RepID=Q8S2Y4_MAIZE Length = 148 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGGGGGYGGG 208 +DGRNITVNEAQSR G GGGGGGYGGG GGGYGGGGGGYGGG Sbjct: 77 LDGRNITVNEAQSR-GGRGGGGGGYGGGRRDGGGYGGGGGGYGGG 120 [55][TOP] >UniRef100_Q8S2X7 Glycine-rich RNA binding protein (Fragment) n=2 Tax=Zea mays RepID=Q8S2X7_MAIZE Length = 154 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGGGGGYGGG 208 +DGRNITVNEAQSR G GGGGGGYGGG GGGYGGGGGGYGGG Sbjct: 83 LDGRNITVNEAQSR-GGRGGGGGGYGGGRRDGGGYGGGGGGYGGG 126 [56][TOP] >UniRef100_Q8S2X6 Glycine-rich RNA binding protein (Fragment) n=1 Tax=Zea mays RepID=Q8S2X6_MAIZE Length = 154 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGGGGGYGGG 208 +DGRNITVNEAQSR G GGGGGGYGGG GGGYGGGGGGYGGG Sbjct: 83 LDGRNITVNEAQSR-GGRGGGGGGYGGGRRDGGGYGGGGGGYGGG 126 [57][TOP] >UniRef100_Q2VCI6 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum tuberosum RepID=Q2VCI6_SOLTU Length = 178 Score = 77.4 bits (189), Expect = 2e-12 Identities = 42/65 (64%), Positives = 47/65 (72%), Gaps = 6/65 (9%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGG---GGYGGG---GGGGYGGGGGGYGGGGR 214 ++G++ D+ DGRNITVNEAQSR GGGGGG GGYGGG GGGG GGGGGYGGG R Sbjct: 64 IEGMNGQDL-DGRNITVNEAQSRGGGGGGGGRGGGGYGGGRREGGGGGYGGGGGYGGGRR 122 Query: 215 SRTSG 229 G Sbjct: 123 EGGGG 127 [58][TOP] >UniRef100_B9HRM9 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9HRM9_POPTR Length = 128 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/64 (64%), Positives = 45/64 (70%), Gaps = 2/64 (3%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGG--YGGGGGGGYGGGGGGYGGGGRSRTS 226 +DG++ D+ DGRNITVNEAQSR GGGGGGGG GGGGYGGGG GGGG SR Sbjct: 64 IDGMNGQDL-DGRNITVNEAQSRGSGGGGGGGGGYNRNSGGGGYGGGGRREGGGGYSRGG 122 Query: 227 GSPG 238 G G Sbjct: 123 GGYG 126 [59][TOP] >UniRef100_B6STA5 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6STA5_MAIZE Length = 155 Score = 77.4 bits (189), Expect = 2e-12 Identities = 47/80 (58%), Positives = 54/80 (67%), Gaps = 6/80 (7%) Frame = +2 Query: 17 STLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGG-GGGGYGG--- 184 ST E R+ ++G++ ++ DGRNITVNEAQSR G GGGGGGYGGG GGGGYGG Sbjct: 57 STEEAMRNA---IEGMNGKEL-DGRNITVNEAQSRG-GRGGGGGGYGGGRGGGGYGGGGR 111 Query: 185 --GGGGYGGGGRSRTSGSPG 238 GGGGYGGGG G G Sbjct: 112 RDGGGGYGGGGGYGGGGGYG 131 [60][TOP] >UniRef100_B4FFS8 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FFS8_MAIZE Length = 133 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGGGGGYGGG 208 +DGRNITVNEAQSR G GGGGGGYGGG GGGYGGGGGGYGGG Sbjct: 74 LDGRNITVNEAQSR-GGRGGGGGGYGGGRRDGGGYGGGGGGYGGG 117 [61][TOP] >UniRef100_P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein n=2 Tax=Zea mays RepID=GRPA_MAIZE Length = 157 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/47 (82%), Positives = 41/47 (87%), Gaps = 3/47 (6%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG-GGGGYGGG--GGGYGGGG 211 +DGRNITVN+AQS RGGGGGGGGYGGG GGGGYGGG GGYGGGG Sbjct: 74 LDGRNITVNQAQS--RGGGGGGGGYGGGRGGGGYGGGRRDGGYGGGG 118 [62][TOP] >UniRef100_C1ZIK1 RRM domain-containing RNA-binding protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZIK1_PLALI Length = 146 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/60 (61%), Positives = 39/60 (65%), Gaps = 9/60 (15%) Frame = +2 Query: 86 GRNITVNEAQSRPRGGGGGGGGYGGGGGGGYG---------GGGGGYGGGGRSRTSGSPG 238 GR +TVNEA+ R GGGGGGGYGGGGGGGYG GGGGGYGGGG G G Sbjct: 69 GRTLTVNEARPREERGGGGGGGYGGGGGGGYGGGGGGRPRSGGGGGYGGGGGGYGGGGGG 128 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSR 220 GGGGGG G GGGGGGGYGGGGGGYGGGG R Sbjct: 116 GGGGGGYG-GGGGGGGYGGGGGGYGGGGGGR 145 [63][TOP] >UniRef100_A3ZRX9 RNA-binding protein n=1 Tax=Blastopirellula marina DSM 3645 RepID=A3ZRX9_9PLAN Length = 149 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/51 (72%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +2 Query: 80 VDGRNITVNEAQSRPR-GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSG 229 VDGR + VNEA+ R R GGGGGGGGYGGGGGGG GGGG YGGGG R+ G Sbjct: 69 VDGRKLVVNEARERERSGGGGGGGGYGGGGGGGRSGGGG-YGGGGGGRSGG 118 [64][TOP] >UniRef100_C0PNT1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PNT1_MAIZE Length = 94 Score = 77.0 bits (188), Expect = 3e-12 Identities = 42/59 (71%), Positives = 43/59 (72%), Gaps = 6/59 (10%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG-GGGGYGG-----GGGGYGGGGRSRTSGSPG 238 +DGRNITVNEAQSR G GGGGGGYGGG GGGGYGG GGGGYGGGG G G Sbjct: 13 LDGRNITVNEAQSRG-GRGGGGGGYGGGRGGGGYGGGGRRDGGGGYGGGGGYGGGGGYG 70 [65][TOP] >UniRef100_C0PEX7 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PEX7_MAIZE Length = 98 Score = 77.0 bits (188), Expect = 3e-12 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 4/48 (8%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGG--GGGYGGGG 211 +DGRNITVN+AQSR GGGGGGGGYGGG GGGGYGGG GGYGGGG Sbjct: 13 LDGRNITVNQAQSR--GGGGGGGGYGGGRGGGGGYGGGRRDGGYGGGG 58 [66][TOP] >UniRef100_B4FFJ9 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FFJ9_MAIZE Length = 234 Score = 77.0 bits (188), Expect = 3e-12 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 4/48 (8%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG--GGGGYGGG--GGGYGGGG 211 +DGRNITVN+AQSR GGGGGGGGYGGG GGGGYGGG GGYGGGG Sbjct: 149 LDGRNITVNQAQSR--GGGGGGGGYGGGRGGGGGYGGGRRDGGYGGGG 194 [67][TOP] >UniRef100_Q6ASX7 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ASX7_ORYSJ Length = 162 Score = 76.6 bits (187), Expect = 4e-12 Identities = 41/58 (70%), Positives = 42/58 (72%), Gaps = 14/58 (24%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGG-----GGGGGGYGGG-GGGGYGGGG--------GGYGGGG 211 +DGRNITVNEAQSR GG GGGGGGYGGG GGGGYGGGG GGYGGGG Sbjct: 74 LDGRNITVNEAQSRRSGGGGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGG 131 [68][TOP] >UniRef100_Q41453 Putative glycine rich RNA binding protein n=1 Tax=Solanum tuberosum RepID=Q41453_SOLTU Length = 175 Score = 76.6 bits (187), Expect = 4e-12 Identities = 45/85 (52%), Positives = 51/85 (60%), Gaps = 23/85 (27%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSR-------PRGGG--------GGGGGYG--------GG 163 ++G+++ D+ DGRNITVNEAQSR RGGG GGGGGYG GG Sbjct: 64 IEGMNRQDL-DGRNITVNEAQSRGGVEAGGGRGGGGYGGGRREGGGGGYGGYGGGRREGG 122 Query: 164 GGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGY GGGGGYGGG R G G Sbjct: 123 GGGGYSGGGGGYGGGRREGGYGGGG 147 [69][TOP] >UniRef100_O24187 OsGRP1 n=1 Tax=Oryza sativa RepID=O24187_ORYSA Length = 160 Score = 76.6 bits (187), Expect = 4e-12 Identities = 40/54 (74%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG-GGGGGYGGGGGGYGGGGRSRTSGSPG 238 +DGRNITVNEAQSR R GGGGGGGYG GGGGGYGGGGG GGGG S G Sbjct: 74 LDGRNITVNEAQSR-RSGGGGGGGYGQRGGGGGYGGGGGYGGGGGGGYASREGG 126 [70][TOP] >UniRef100_O22384 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22384_ORYSA Length = 162 Score = 76.6 bits (187), Expect = 4e-12 Identities = 41/58 (70%), Positives = 42/58 (72%), Gaps = 14/58 (24%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGG-----GGGGGGYGGG-GGGGYGGGG--------GGYGGGG 211 +DGRNITVNEAQSR GG GGGGGGYGGG GGGGYGGGG GGYGGGG Sbjct: 74 LDGRNITVNEAQSRRSGGGGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGG 131 [71][TOP] >UniRef100_A9NML8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NML8_PICSI Length = 172 Score = 76.6 bits (187), Expect = 4e-12 Identities = 42/74 (56%), Positives = 47/74 (63%), Gaps = 13/74 (17%) Frame = +2 Query: 56 DGIDKLD--IVDGRNITVNEAQSRPRGGGGGGG---GYGGGGGGGYGGG--------GGG 196 D ID ++ ++DGRNITVN AQSR GGGGGGG G+ GGGGGGYGGG GGG Sbjct: 65 DAIDAMNGKVLDGRNITVNPAQSRGNGGGGGGGGGRGFRGGGGGGYGGGRDRPDRGYGGG 124 Query: 197 YGGGGRSRTSGSPG 238 GGGG G G Sbjct: 125 RGGGGSGGYGGRGG 138 [72][TOP] >UniRef100_Q2QLR2 Os12g0632000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QLR2_ORYSJ Length = 162 Score = 76.3 bits (186), Expect = 5e-12 Identities = 39/45 (86%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG-GGGGGYGGGGGGYGGGG 211 +DGRNITVNEAQSR R GGGGGGGYG GGGGGY GGGGGYGGGG Sbjct: 74 LDGRNITVNEAQSR-RSGGGGGGGYGQRGGGGGY-GGGGGYGGGG 116 [73][TOP] >UniRef100_C6TEW4 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TEW4_SOYBN Length = 109 Score = 76.3 bits (186), Expect = 5e-12 Identities = 39/55 (70%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGG-----GGYGGGGGGYGGGGRSRTSG 229 +DGRNITVNEAQ+R GGGGGGG+G GGG GGYGGGGGG G GGR R SG Sbjct: 13 LDGRNITVNEAQTRASRGGGGGGGFGSGGGYNRGSGGYGGGGGGGGYGGR-RESG 66 [74][TOP] >UniRef100_Q7V9D6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9313 RepID=Q7V9D6_PROMM Length = 199 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/66 (57%), Positives = 43/66 (65%), Gaps = 10/66 (15%) Frame = +2 Query: 86 GRNITVNEAQSR---PR-------GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSP 235 GR + +N+A+ R PR GGGGGGGGYGGGGGGGYGGGGGGYGGGG G Sbjct: 69 GRPLRINKAEPRGSAPRRGGGYGGGGGGGGGGYGGGGGGGYGGGGGGYGGGGGGYGGGGY 128 Query: 236 GLQEFG 253 G +G Sbjct: 129 GGGGYG 134 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Frame = +2 Query: 128 GGGGGGGGYGGGG--GGGYGGGGGGYGGGGRSRTSGSPGLQE 247 G GGGGGGYGGGG GGGYGGGG G GGGG R SG+ G ++ Sbjct: 115 GYGGGGGGYGGGGYGGGGYGGGGYGGGGGGGDRGSGARGWED 156 [75][TOP] >UniRef100_Q8VXC4 Glycine rich RNA binding protein n=1 Tax=Oryza sativa RepID=Q8VXC4_ORYSA Length = 194 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG-GGGGGYGGGGGGYGGGG 211 +DGRNITVNEAQSR R GGGGGGGYG GGGGGYGGGG G GGGG Sbjct: 74 LDGRNITVNEAQSR-RSGGGGGGGYGQRGGGGGYGGGGYGGGGGG 117 [76][TOP] >UniRef100_O22385 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22385_ORYSA Length = 161 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG-GGGGGYGGGGGGYGGGG 211 +DGRNITVNEAQSR R GGGGGGGYG GGGGGYGGGG G GGGG Sbjct: 74 LDGRNITVNEAQSR-RSGGGGGGGYGQRGGGGGYGGGGYGGGGGG 117 [77][TOP] >UniRef100_B7SDF0 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=B7SDF0_ORYSJ Length = 161 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG-GGGGGYGGGGGGYGGGG 211 +DGRNITVNEAQSR R GGGGGGGYG GGGGGYGGGG G GGGG Sbjct: 74 LDGRNITVNEAQSR-RSGGGGGGGYGQRGGGGGYGGGGYGGGGGG 117 [78][TOP] >UniRef100_B6T5N8 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6T5N8_MAIZE Length = 146 Score = 75.9 bits (185), Expect = 7e-12 Identities = 40/62 (64%), Positives = 42/62 (67%), Gaps = 9/62 (14%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYG---------GGGGGGYGGGGGGYGGGGRSRTSGS 232 +DGRNITVNEAQSR G GGGGGGYG GG GGGYGGG GGYGGGG G+ Sbjct: 74 LDGRNITVNEAQSR-GGRGGGGGGYGGGRRDGGGYGGDGGGYGGGRGGYGGGGGEYGGGN 132 Query: 233 PG 238 G Sbjct: 133 RG 134 [79][TOP] >UniRef100_A2ZN20 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2ZN20_ORYSI Length = 161 Score = 75.9 bits (185), Expect = 7e-12 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG-GGGGGYGGGGGGYGGGG 211 +DGRNITVNEAQSR R GGGGGGGYG GGGGGYGGGG G GGGG Sbjct: 74 LDGRNITVNEAQSR-RSGGGGGGGYGQRGGGGGYGGGGYGGGGGG 117 [80][TOP] >UniRef100_UPI00016C4952 RNA-binding protein n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C4952 Length = 117 Score = 75.5 bits (184), Expect = 9e-12 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 3/50 (6%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGG--GGY-GGGGGGYGGGGRSR 220 V GR++TVNEA+ R GGGGG GGYGGGGG GGY GGGGGGYGGGG R Sbjct: 65 VGGRSLTVNEAKPREGGGGGGRGGYGGGGGGRGGYGGGGGGGYGGGGGGR 114 [81][TOP] >UniRef100_B6U1V8 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6U1V8_MAIZE Length = 156 Score = 75.5 bits (184), Expect = 9e-12 Identities = 37/46 (80%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGG--GGGYGGGG 211 +DGRNITVN+AQS RGGGGGGGG GG GGGGYGGG GGYGGGG Sbjct: 74 LDGRNITVNQAQS--RGGGGGGGGRGGRGGGGYGGGRRDGGYGGGG 117 [82][TOP] >UniRef100_Q03251-2 Isoform 2 of Glycine-rich RNA-binding protein 8 n=1 Tax=Arabidopsis thaliana RepID=Q03251-2 Length = 110 Score = 75.5 bits (184), Expect = 9e-12 Identities = 42/62 (67%), Positives = 43/62 (69%), Gaps = 9/62 (14%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGG-----GGGYGGGGGGGY-GGGGGGY---GGGGRSRTSGS 232 +DGR ITVNEAQSR GGGGG GGGY GGGGGY GGGGGGY GGGG R SG Sbjct: 13 LDGRVITVNEAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG 72 Query: 233 PG 238 G Sbjct: 73 YG 74 [83][TOP] >UniRef100_Q03251 Glycine-rich RNA-binding protein 8 n=2 Tax=Arabidopsis thaliana RepID=GRP8_ARATH Length = 169 Score = 75.5 bits (184), Expect = 9e-12 Identities = 42/62 (67%), Positives = 43/62 (69%), Gaps = 9/62 (14%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGG-----GGGYGGGGGGGY-GGGGGGY---GGGGRSRTSGS 232 +DGR ITVNEAQSR GGGGG GGGY GGGGGY GGGGGGY GGGG R SG Sbjct: 72 LDGRVITVNEAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG 131 Query: 233 PG 238 G Sbjct: 132 YG 133 [84][TOP] >UniRef100_UPI00016C5334 RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C5334 Length = 137 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 6/60 (10%) Frame = +2 Query: 77 IVDGRNITVNEAQSRPRGGGGGGGGYG------GGGGGGYGGGGGGYGGGGRSRTSGSPG 238 +++GR +TVNEA+ + GGGGGGG G GGGGGGYGGGGGGYGGGG G G Sbjct: 68 VIEGRPLTVNEARPKEGGGGGGGGRRGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 127 [85][TOP] >UniRef100_Q9M6A1 Putative glycine-rich RNA binding protein 1 n=1 Tax=Catharanthus roseus RepID=Q9M6A1_CATRO Length = 137 Score = 75.1 bits (183), Expect = 1e-11 Identities = 38/58 (65%), Positives = 40/58 (68%), Gaps = 13/58 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGG-----------YGGGG--GGGYGGGGGGYGGGGR 214 +DGRN+TVNEAQSR GGGGGGGG YGGGG GGYGG GGGYGGG R Sbjct: 74 LDGRNVTVNEAQSRGSGGGGGGGGFRGPRREGGGCYGGGGRRNGGYGGNGGGYGGGRR 131 [86][TOP] >UniRef100_Q9M699 Putative glycine-rich RNA-binding protein 2 n=1 Tax=Catharanthus roseus RepID=Q9M699_CATRO Length = 160 Score = 75.1 bits (183), Expect = 1e-11 Identities = 39/58 (67%), Positives = 40/58 (68%), Gaps = 13/58 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGG-----------GGGGYGGGG--GGGYGGGGGGYGGGGR 214 +DGRNITVNEAQSR GGGG GGGGYGGGG GGYGG GGGYGGG R Sbjct: 74 LDGRNITVNEAQSRGSGGGGGGGGFRGPRREGGGGYGGGGRRDGGYGGNGGGYGGGRR 131 [87][TOP] >UniRef100_Q8S2Y5 Glycine-rich RNA binding protein (Fragment) n=1 Tax=Zea mays RepID=Q8S2Y5_MAIZE Length = 154 Score = 75.1 bits (183), Expect = 1e-11 Identities = 39/52 (75%), Positives = 40/52 (76%), Gaps = 8/52 (15%) Frame = +2 Query: 80 VDGRNITVNEAQSR-PRGGGGGG-------GGYGGGGGGGYGGGGGGYGGGG 211 +DGRNITVNEAQSR RGGGGGG GG GGGGGGYGGG GGYGGGG Sbjct: 83 LDGRNITVNEAQSRGGRGGGGGGYRGGRRDGGGYGGGGGGYGGGRGGYGGGG 134 [88][TOP] >UniRef100_Q38M49 Putative glycine-rich RNA binding protein-like n=1 Tax=Solanum tuberosum RepID=Q38M49_SOLTU Length = 176 Score = 75.1 bits (183), Expect = 1e-11 Identities = 40/67 (59%), Positives = 45/67 (67%), Gaps = 8/67 (11%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGG--------GGGGYGGGGGGYGGG 208 ++G++ D+ DGR ITVNEAQSR GGGGGGGG GGG GGGG GGGGGYGGG Sbjct: 60 IEGMNGQDL-DGRKITVNEAQSRGGGGGGGGGGRGGGGYVRWRREGGGGGYGGGGGYGGG 118 Query: 209 GRSRTSG 229 R G Sbjct: 119 RREGGGG 125 [89][TOP] >UniRef100_O24184 Glycine-rich RNA-binding protein n=1 Tax=Oryza sativa RepID=O24184_ORYSA Length = 165 Score = 75.1 bits (183), Expect = 1e-11 Identities = 42/63 (66%), Positives = 45/63 (71%), Gaps = 5/63 (7%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYG-GGGGGGYG----GGGGGYGGGGRSRTSGSPGLQ 244 +DGRNITVNEAQSR R GGGGGGGYG GGGGGYG GGGGG GG G+ R G G Sbjct: 74 LDGRNITVNEAQSR-RSGGGGGGGYGQRGGGGGYGGRGYGGGGGGGGYGQRREGGYGGGG 132 Query: 245 EFG 253 +G Sbjct: 133 GYG 135 [90][TOP] >UniRef100_B4FQ70 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FQ70_MAIZE Length = 140 Score = 75.1 bits (183), Expect = 1e-11 Identities = 37/46 (80%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGGGG--YGGGGGGYGGGG 211 +DGRNITVN+AQSR GGGGGGGGYGGG GGG GGGGGYGGGG Sbjct: 74 LDGRNITVNQAQSR--GGGGGGGGYGGGRGGGGRREGGGGGYGGGG 117 [91][TOP] >UniRef100_Q9U5Y7 Glycine rich RNA binding protein n=1 Tax=Ciona intestinalis RepID=Q9U5Y7_CIOIN Length = 162 Score = 75.1 bits (183), Expect = 1e-11 Identities = 44/76 (57%), Positives = 50/76 (65%), Gaps = 8/76 (10%) Frame = +2 Query: 56 DGIDKLDIVD--GRNITVNEAQSRPRGGGG--GGGGYGG---GGGGGYGGGGG-GYGGGG 211 D I+ L+ D GRN++V +AQS+ GGGG GGGGYGG GGGGGYGGGGG G GGGG Sbjct: 60 DAIENLNESDVRGRNVSVRQAQSKRDGGGGGRGGGGYGGGGYGGGGGYGGGGGYGGGGGG 119 Query: 212 RSRTSGSPGLQEFGTR 259 R GS G G R Sbjct: 120 GGRYGGSSGYGGGGRR 135 [92][TOP] >UniRef100_Q03878 Glycine-rich RNA-binding protein n=1 Tax=Daucus carota RepID=GRP1_DAUCA Length = 157 Score = 75.1 bits (183), Expect = 1e-11 Identities = 44/83 (53%), Positives = 52/83 (62%), Gaps = 19/83 (22%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGG-----GGGGGYG--------- 157 T + + M ++G++ ++ DGRNITVNEAQSR GGG GGGGGYG Sbjct: 53 TFKDEKSMRDAIEGMNGQEL-DGRNITVNEAQSRGSGGGGGRREGGGGGYGGGGGYGGRR 111 Query: 158 -GGGGGGYG----GGGGGYGGGG 211 GGGGGGYG GGGGGYGGGG Sbjct: 112 EGGGGGGYGGRREGGGGGYGGGG 134 [93][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/60 (63%), Positives = 42/60 (70%), Gaps = 9/60 (15%) Frame = +2 Query: 86 GRNITVNEAQSR----PRGGGGG----GGGYGGGGGGGY-GGGGGGYGGGGRSRTSGSPG 238 GR++ VNEA+ PR GGGG GGGYGGGGGGGY GGGGGGYGGGG R+ G G Sbjct: 71 GRSVVVNEARPMEARPPRSGGGGYGGGGGGYGGGGGGGYGGGGGGGYGGGGGGRSGGGGG 130 Score = 62.4 bits (150), Expect = 8e-08 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFGTRVEPY 271 GGGGGGGY GGGGGG GGGGGYGGGG R+ G G + G R PY Sbjct: 110 GGGGGGGY-GGGGGGRSGGGGGYGGGGGGRSGGGGGGGDGGFR-SPY 154 [94][TOP] >UniRef100_Q9MBF3 Glycine-rich RNA-binding protein n=1 Tax=Citrus unshiu RepID=Q9MBF3_CITUN Length = 167 Score = 74.7 bits (182), Expect = 1e-11 Identities = 40/57 (70%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGG----GGYGGGGRSRTSGSPG 238 +DGRNITVNEAQSR GGGGGGGYG GGGGYGGGG GG GG G SR G G Sbjct: 74 LDGRNITVNEAQSR-GSGGGGGGGYGSRGGGGYGGGGRRESGGGGGYGGSRGYGGGG 129 [95][TOP] >UniRef100_Q3EBX0 Putative uncharacterized protein At2g21660.2 n=1 Tax=Arabidopsis thaliana RepID=Q3EBX0_ARATH Length = 159 Score = 74.7 bits (182), Expect = 1e-11 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 11/81 (13%) Frame = +2 Query: 20 TLEVYRHMDFEVDGIDKLDIVDGRNITVNEAQSRPRGGGG---GGGGYGGG-----GGGG 175 T + + M ++G++ D+ DGR+ITVNEAQSR GGGG GGG YGGG GGGG Sbjct: 55 TFKDEKAMKDAIEGMNGQDL-DGRSITVNEAQSRGSGGGGGHRGGGSYGGGGGRREGGGG 113 Query: 176 YGGGGGGY---GGGGRSRTSG 229 Y GGGGGY GGGG S G Sbjct: 114 YSGGGGGYSSRGGGGGSYGGG 134 [96][TOP] >UniRef100_Q1XG61 Putative glycine-rich RNA binding protein n=1 Tax=Cryptomeria japonica RepID=Q1XG61_CRYJA Length = 181 Score = 74.7 bits (182), Expect = 1e-11 Identities = 41/82 (50%), Positives = 48/82 (58%), Gaps = 20/82 (24%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRP------------RGGGGGGGGYGGGGGGGY------ 178 ++G++ D+ DGRNITVN AQ+R RGGGGG GGYGGGG GGY Sbjct: 66 IEGMNGRDL-DGRNITVNRAQARGGGGGGGGGGGGYRGGGGGSGGYGGGGSGGYESRRSG 124 Query: 179 --GGGGGGYGGGGRSRTSGSPG 238 G GGGGY GGGR R+ G Sbjct: 125 GGGSGGGGYSGGGRERSERGYG 146 [97][TOP] >UniRef100_Q10FE7 Os03g0670700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10FE7_ORYSJ Length = 196 Score = 74.7 bits (182), Expect = 1e-11 Identities = 42/62 (67%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGGG-GYGGGGGGYGGGGRSRTSGSPGLQEFGT 256 +DGRNITVNEAQS R GGGGGGYGGGGGG G G GGGGYGGGG G G +E G Sbjct: 74 LDGRNITVNEAQS--RRSGGGGGGYGGGGGGYGGGRGGGGYGGGG----GGGYGRREGGY 127 Query: 257 RV 262 V Sbjct: 128 AV 129 [98][TOP] >UniRef100_O22653 Glycine-rich RNA-binding protein n=1 Tax=Euphorbia esula RepID=O22653_EUPES Length = 165 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/58 (67%), Positives = 40/58 (68%), Gaps = 5/58 (8%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYG-GGGGGGYGGGGG----GYGGGGRSRTSGSPG 238 +DGRN TVNEAQSR G GGGGGY GGGGGGYG GGG GYGGGG S S G Sbjct: 73 LDGRNTTVNEAQSRGNGRSGGGGGYSRGGGGGGYGSGGGRRERGYGGGGGGYNSISTG 130 [99][TOP] >UniRef100_O04070 SGRP-1 protein n=1 Tax=Solanum commersonii RepID=O04070_SOLCO Length = 162 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 6/50 (12%) Frame = +2 Query: 80 VDGRNITVNEAQSR-PRGGGGGGGGYGG-----GGGGGYGGGGGGYGGGG 211 +DGRNITVNEAQ+R GGGGGGGG+GG GGGGGYGGGGG GGGG Sbjct: 73 LDGRNITVNEAQARGSGGGGGGGGGFGGGRRREGGGGGYGGGGGYRGGGG 122 [100][TOP] >UniRef100_B0D8X8 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D8X8_LACBS Length = 154 Score = 74.3 bits (181), Expect = 2e-11 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 2/72 (2%) Frame = +2 Query: 44 DFEVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGG-GGGY-GGGGRS 217 D + G+++ ++ DGR I VN A +R GGGGGGGGY GGGGGGYGGG GGGY GGGG Sbjct: 58 DAAIGGLNEQEL-DGRRIKVNLANARG-GGGGGGGGYSGGGGGGYGGGSGGGYSGGGGYG 115 Query: 218 RTSGSPGLQEFG 253 SG G Q G Sbjct: 116 GQSGGYGQQGGG 127 [101][TOP] >UniRef100_UPI0001BAFCB9 RNP-1 like RNA-binding protein n=1 Tax=Haliangium ochraceum DSM 14365 RepID=UPI0001BAFCB9 Length = 125 Score = 73.9 bits (180), Expect = 3e-11 Identities = 38/63 (60%), Positives = 42/63 (66%) Frame = +2 Query: 50 EVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSG 229 E+DG++ +DGRNI VNEAQ R RGGGGGGGG G GGGG GGGGG GG R G Sbjct: 63 EMDGVE----LDGRNIRVNEAQERSRGGGGGGGGGGYRGGGGGGGGGGRDGGRRRGGRDG 118 Query: 230 SPG 238 G Sbjct: 119 GGG 121 [102][TOP] >UniRef100_UPI000180C465 PREDICTED: similar to cold-inducible RNA-binding protein n=1 Tax=Ciona intestinalis RepID=UPI000180C465 Length = 167 Score = 73.9 bits (180), Expect = 3e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 6/57 (10%) Frame = +2 Query: 86 GRNITVNEAQSRPRGGGGGG------GGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GR++TV EAQS+ GGGGGG GG GGGGGGYGGGGGGYGGGG G G Sbjct: 73 GRSVTVREAQSKRGGGGGGGYGGRGGGGRYGGGGGGYGGGGGGYGGGGGGYGGGGGG 129 [103][TOP] >UniRef100_C1V3H1 RRM domain-containing RNA-binding protein n=1 Tax=Haliangium ochraceum DSM 14365 RepID=C1V3H1_9DELT Length = 92 Score = 73.9 bits (180), Expect = 3e-11 Identities = 38/63 (60%), Positives = 42/63 (66%) Frame = +2 Query: 50 EVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSG 229 E+DG++ +DGRNI VNEAQ R RGGGGGGGG G GGGG GGGGG GG R G Sbjct: 30 EMDGVE----LDGRNIRVNEAQERSRGGGGGGGGGGYRGGGGGGGGGGRDGGRRRGGRDG 85 Query: 230 SPG 238 G Sbjct: 86 GGG 88 [104][TOP] >UniRef100_Q40052 Glycine rich protein, RNA binding protein n=1 Tax=Hordeum vulgare RepID=Q40052_HORVU Length = 173 Score = 73.9 bits (180), Expect = 3e-11 Identities = 38/61 (62%), Positives = 40/61 (65%), Gaps = 8/61 (13%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGG--------GGGGGYGGGGGGYGGGGRSRTSGSP 235 +DGR +TVNEAQSR R GGGGGGYGG GGGGGYGG GGGYGG G G Sbjct: 72 LDGRQVTVNEAQSR-RSAGGGGGGYGGQRGGGGGYGGGGGYGGQGGGYGGQGGGGYGGQG 130 Query: 236 G 238 G Sbjct: 131 G 131 [105][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 73.9 bits (180), Expect = 3e-11 Identities = 37/68 (54%), Positives = 40/68 (58%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTVILRPST 79 LV + SP P PPPP PPPPPP PPPPPPP PPPPPPPP PST Sbjct: 481 LVFSHLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP---------PST 531 Query: 78 ISSLSIPS 55 S+SIP+ Sbjct: 532 HKSMSIPT 539 [106][TOP] >UniRef100_B9MIH3 RNP-1 like RNA-binding protein n=1 Tax=Diaphorobacter sp. TPSY RepID=B9MIH3_DIAST Length = 155 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/57 (66%), Positives = 41/57 (71%), Gaps = 9/57 (15%) Frame = +2 Query: 86 GRNITVNEAQSR----PRGGGG---GGGGYGGG--GGGGYGGGGGGYGGGGRSRTSG 229 GR+I VNEA+ PR GGG GGGGYGGG GGGGYGGGGGGYGGGG R+ G Sbjct: 71 GRSIVVNEARPMEARPPRSGGGFGGGGGGYGGGRSGGGGYGGGGGGYGGGGGGRSEG 127 [107][TOP] >UniRef100_A2SMG9 RNA-binding region RNP-1 n=1 Tax=Methylibium petroleiphilum PM1 RepID=A2SMG9_METPP Length = 162 Score = 73.6 bits (179), Expect = 3e-11 Identities = 42/77 (54%), Positives = 45/77 (58%), Gaps = 17/77 (22%) Frame = +2 Query: 80 VDGRNITVNEAQSR---------PRGGGG--GGGGYGGGGGG------GYGGGGGGYGGG 208 + GR I VNEA+ R P GGGG GGGGYGGGGGG GYGGGGGGYGGG Sbjct: 69 LSGRAIVVNEARPREERPGGFRGPYGGGGAGGGGGYGGGGGGRSGGGGGYGGGGGGYGGG 128 Query: 209 GRSRTSGSPGLQEFGTR 259 G R+ G G G R Sbjct: 129 GGGRSGGGGGYGGGGGR 145 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 G GGGGGGYGGGGGG GGGGG GGGGRS G G Sbjct: 117 GYGGGGGGYGGGGGGRSGGGGGYGGGGGRSGGGGGYG 153 [108][TOP] >UniRef100_A3YVC6 RNA-binding protein RbpD n=1 Tax=Synechococcus sp. WH 5701 RepID=A3YVC6_9SYNE Length = 113 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/58 (62%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 50 EVDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGY-GGGGRSR 220 E ID L V+ N + ++ PRGGGGGGGG GGGGGYGGGGGGY GGGGRSR Sbjct: 55 EQKAIDDLQNVEWMNRMIRVNKAEPRGGGGGGGGGNRGGGGGYGGGGGGYGGGGGRSR 112 [109][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 P SP P PPPP PPPPPP PPPPPPP PPPPPPPP+ R+ Sbjct: 161 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRN 206 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/42 (69%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 155 PPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP PPPPPP PPPPPP PPPPPPPP Sbjct: 147 PPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 188 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 148 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 189 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P P PP PPPPPP PPPPPPP PPPPPPPP Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 66.6 bits (161), Expect = 4e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 7/49 (14%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYP-------PPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP P PPPPP PPPPPPP PPPPPPPP Sbjct: 133 PPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPP 181 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PPPPP PPPPPPP PPPPP PP Sbjct: 126 PEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPP 167 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -1 Query: 243 CSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 C P P PPPP PPPPP P PPPPP PPPPPPP Sbjct: 121 CPPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPP 158 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P E PPPP P PPPP PP PPPP PPPPPPP Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPP 158 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P +P PPP PPPPPP PPPPP P PPPPP PP Sbjct: 125 PPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPP 161 [110][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP PL PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 72.4 bits (176), Expect = 7e-11 Identities = 29/44 (65%), Positives = 30/44 (68%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 L P+ P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 220 LPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPL 675 Score = 69.3 bits (168), Expect = 6e-10 Identities = 29/42 (69%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 69.3 bits (168), Expect = 6e-10 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 69.3 bits (168), Expect = 6e-10 Identities = 29/44 (65%), Positives = 29/44 (65%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 L P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 240 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 68.9 bits (167), Expect = 8e-10 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P ++ PPPP PPPPPP PP PPPP PPPPPP P Sbjct: 195 PCQCCPVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSP 236 Score = 68.9 bits (167), Expect = 8e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 68.9 bits (167), Expect = 8e-10 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP+PPPP PPPL Sbjct: 684 PPPPPPPPPPPPPPPPPPPHPPPPSPPPL 712 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P PL PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P + PPPP PPPPPP PPPP PP PPPPPPPP Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPP 251 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PPPP P PPPPPPP PPPPPPPP Sbjct: 217 PPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258 Score = 66.6 bits (161), Expect = 4e-09 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P + PPPP PPPPPP PPPPPPP PPPP PPP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 66.2 bits (160), Expect = 5e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PP PPPPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 66.2 bits (160), Expect = 5e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PP PPPP PPPPPPPP Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPP PP PPPPPPPP Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPP PP PPPPPPP PPPPPPPP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPP PP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P L PPP PPPPPP PPPPPPP PPPPP PP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 62.8 bits (151), Expect = 6e-08 Identities = 25/32 (78%), Positives = 25/32 (78%), Gaps = 4/32 (12%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPP----PPPPPP 127 PPPP PPPPPP PPPPPPP PP PPPPPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 62.8 bits (151), Expect = 6e-08 Identities = 25/32 (78%), Positives = 25/32 (78%), Gaps = 4/32 (12%) Frame = -1 Query: 210 PPPPYPPPPPPYPP----PPPPPYPPPPPPPP 127 PPPP PPPPPP PP PPPPP PPPPPPPP Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 [111][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/42 (69%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 69.7 bits (169), Expect = 5e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 69.3 bits (168), Expect = 6e-10 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -1 Query: 231 DPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 DP PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [112][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/42 (69%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 71.2 bits (173), Expect = 2e-10 Identities = 28/37 (75%), Positives = 28/37 (75%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P L PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 71.2 bits (173), Expect = 2e-10 Identities = 28/37 (75%), Positives = 28/37 (75%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P PL PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 69.7 bits (169), Expect = 5e-10 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P + PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 69.3 bits (168), Expect = 6e-10 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 68.9 bits (167), Expect = 8e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 65.5 bits (158), Expect = 9e-09 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -1 Query: 231 DPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 DP PPPP PPPP P PPPPPPP PPPPPPPP Sbjct: 15 DPPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -1 Query: 255 VPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPP 139 +P P P PPPP PPPPPP PPPPPPP PPPP Sbjct: 31 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPP 142 L P P P PPPP PPPPPP PPPPPPP PPP Sbjct: 31 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [113][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/42 (69%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 69.7 bits (169), Expect = 5e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 69.3 bits (168), Expect = 6e-10 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -1 Query: 231 DPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 DP PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [114][TOP] >UniRef100_Q3E9N7 Putative uncharacterized protein At4g39260.2 n=1 Tax=Arabidopsis thaliana RepID=Q3E9N7_ARATH Length = 126 Score = 72.8 bits (177), Expect = 6e-11 Identities = 37/50 (74%), Positives = 38/50 (76%), Gaps = 6/50 (12%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGG-----GGGYGGGGGGGY-GGGGGGYGGGG 211 +DGR ITVNEAQSR GGGGG GGGY GGGGGY GGGGGGY GGG Sbjct: 72 LDGRVITVNEAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGG 121 [115][TOP] >UniRef100_B6TY06 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6TY06_MAIZE Length = 142 Score = 72.8 bits (177), Expect = 6e-11 Identities = 40/64 (62%), Positives = 42/64 (65%), Gaps = 20/64 (31%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGG-------GGGGGYGG---GGGGGYG----------GGGGGY 199 +DGRNITVN+AQSR GGG GGGGGYGG GGGGGYG GGGGGY Sbjct: 74 LDGRNITVNQAQSRGGGGGGRRDGGYGGGGGYGGRREGGGGGYGGGGGYGGRREGGGGGY 133 Query: 200 GGGG 211 GGGG Sbjct: 134 GGGG 137 [116][TOP] >UniRef100_A9S278 Predicted protein n=2 Tax=Physcomitrella patens RepID=A9S278_PHYPA Length = 162 Score = 72.8 bits (177), Expect = 6e-11 Identities = 38/57 (66%), Positives = 40/57 (70%), Gaps = 4/57 (7%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGG----GGGGYGGGGGGYGGGGRSRTSGSPG 238 +DGRNITVN+AQSR GGGGGGGG G G GGGGYGGG GG GGG SG G Sbjct: 73 LDGRNITVNQAQSRGGGGGGGGGGGGYGRREQGGGGYGGGYGGSRGGGDREGSGYGG 129 [117][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 72.8 bits (177), Expect = 6e-11 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = -1 Query: 264 STLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 ST +P + P V PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 216 STTLPTAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 71.6 bits (174), Expect = 1e-10 Identities = 38/77 (49%), Positives = 46/77 (59%), Gaps = 6/77 (7%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPP------YPPPPPPPPLGRD*ASFTV 97 +VP P P PPPP PPPPPP PPPPPPP PPPPPPPPL S + Sbjct: 232 VVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPL 291 Query: 96 ILRPSTISSLSIPSTSK 46 L P+T ++++ PSTS+ Sbjct: 292 PL-PTTSATVAPPSTSQ 307 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/57 (54%), Positives = 36/57 (63%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTVILRPSTISSLSIPSTSKSI 40 PPPP PPPPPP PPPPPPP PPPPPPPPL + P L +P+TS ++ Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATV 300 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/58 (55%), Positives = 36/58 (62%) Frame = -1 Query: 300 NTF*KFNCST*GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 NT N +T +TL P + + PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 205 NTVNATNNTTTSTTLPTAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 262 [118][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 72.8 bits (177), Expect = 6e-11 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLGR 118 P P+ PPPP PPPPPP PPPPPPP PPPPPPPP R Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPR 150 Score = 67.4 bits (163), Expect = 2e-09 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P + P PP PPPPPP PPPPPPP PPPPPPPP Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -1 Query: 246 SCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 S +P DP P P PPPPPP PPPPPPP PPPPPPPP Sbjct: 105 SHAPPDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPP 144 [119][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 72.8 bits (177), Expect = 6e-11 Identities = 31/45 (68%), Positives = 31/45 (68%) Frame = -1 Query: 255 VPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 VPN SP PPPP PPPPPP PPPPPPP PPPPPPPP G Sbjct: 979 VPNGLSP--------PPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 1015 Score = 66.6 bits (161), Expect = 4e-09 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P + + PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 970 PGLLPPAEEVPNGLSPPPPPPPPPPPPPPPPPPPPPPPPPPP 1011 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 SPG E P PPPPP PPPPPPP PPPPPPPP Sbjct: 969 SPGLLPPAEEVPNGLSPPPPPPPPPPPPPPPPPPPPPP 1006 [120][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 72.4 bits (176), Expect = 7e-11 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 P C P P+ PPPP PPPPPP PPPPPPP PPPPPPPP+ Sbjct: 126 PPVCPPPPPMCA--PPPPPPPPPPPPPPPPPPPPPPPPPPPPV 166 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPP---YPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 116 PAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPP 160 Score = 65.5 bits (158), Expect = 9e-09 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPY---PPPPPPPP 127 P C+P P PPPP PPPPPP PPPPPPP PPPPP PP Sbjct: 133 PPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPP 177 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPP---YPPPPPPPP 127 P P+V PPPP PPPP P PPPPPPP PPPPPPPP Sbjct: 162 PPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPP 201 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Frame = -1 Query: 252 PNSCSPGD-PLVLERPPPPYPPPPPPY---PPPPPPPYPPPPPPPP 127 P C P P PPPP PPPPP PPPPPPP PPPPPPPP Sbjct: 109 PPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPP 154 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 9/51 (17%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPY---------PPPPPPPYPPPPPPPP 127 P C P P P P PPPPPP PPPPPPP PPPPPPPP Sbjct: 103 PPGCGPPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPP 153 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 7/43 (16%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPP-PYPPPPPP------PYPPPPPPP 130 P P+ L PPPP PPPPP P PPPPPP P PPPPPPP Sbjct: 187 PPPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPPP 229 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPP---PPPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP PP PPPP PPPPPPP P PPPPPP Sbjct: 172 PPPCPP--PPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPP 214 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/41 (58%), Positives = 25/41 (60%), Gaps = 12/41 (29%) Frame = -1 Query: 210 PPPPYPPPPPPYP------------PPPPPPYPPPPPPPPL 124 PPPP PPPPPP P PPPP P PPPPPPPP+ Sbjct: 151 PPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPM 191 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPP-PYPPPPPPYPPPPPPPYPPPPPP 133 P C P P PPP P PPPPPP PPPP P PPPPPP Sbjct: 189 PPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPPP 229 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P L PPPP PPPP P PPPPPPP P P P P Sbjct: 202 PPPPCPLPPPPPPCPPPPAPCPPPPPPPACPAPMPMP 238 [121][TOP] >UniRef100_A9NTP0 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NTP0_PICSI Length = 182 Score = 72.4 bits (176), Expect = 7e-11 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTLCAAIKLLER G V +CACVIELPE KG KL GK+L+ILVE Sbjct: 135 GGTLCAAIKLLERAGAEVVECACVIELPELKGRGKLDGKALYILVE 180 [122][TOP] >UniRef100_Q8LPB1 Glycine-rich RNA-binding protein n=1 Tax=Physcomitrella patens RepID=Q8LPB1_PHYPA Length = 178 Score = 72.0 bits (175), Expect = 1e-10 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 3/63 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRG-GGGGGGGYGG--GGGGGYGGGGGGYGGGGRSRTSGSPGLQEF 250 +DGRNITVN+AQSR G GGGGGGGY GGGGGYGGGG G GGGG G+ G + Sbjct: 71 LDGRNITVNQAQSRGGGSGGGGGGGYNNRQGGGGGYGGGGYGGGGGG---GYGAGGGGAY 127 Query: 251 GTR 259 G+R Sbjct: 128 GSR 130 [123][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 72.0 bits (175), Expect = 1e-10 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -1 Query: 243 CSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 C P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 357 CPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 70.5 bits (171), Expect = 3e-10 Identities = 28/41 (68%), Positives = 28/41 (68%) Frame = -1 Query: 249 NSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 N C P P PPPP PPPPPP PP PPPP PPPPPPPP Sbjct: 352 NPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 70.1 bits (170), Expect = 4e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S +P P PPPP PPPPPP PPPPP P PPPPPPPP Sbjct: 348 PPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 389 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PN+C P P P P PPPPPP PPPPPPP PPPP PPP Sbjct: 341 PNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPP 382 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/60 (46%), Positives = 31/60 (51%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTVILRPSTISSLSIP 58 P P PPPP PPPPPP PPPPPPP PPPP P F R + +L+ P Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSCGFGCHYRDRLLPTLTYP 436 [124][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/38 (76%), Positives = 29/38 (76%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTV 97 PPPP PPPPPP PPPPPPP PPPPPPPP D SF V Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPACDDVSFPV 254 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 243 [125][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/42 (69%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 64 PRPCPPPPP-----PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 70.5 bits (171), Expect = 3e-10 Identities = 28/44 (63%), Positives = 29/44 (65%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 + P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 IAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 69.7 bits (169), Expect = 5e-10 Identities = 29/42 (69%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = -1 Query: 237 PGDPLVLER-----PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P+ ER PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 69.7 bits (169), Expect = 5e-10 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 ++P P P PPPP PPPPPP PPPPPPP PPPPPPP Sbjct: 22 IIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P RP PP PPPPPP PPPPPPP PPPPPPPP Sbjct: 57 PPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPP P PPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPRPCPPPPPPPP 75 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PPPPPPP PPPPPPPP Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPPPP 83 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP P PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP P PPPPP PPPPPPPP Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/31 (80%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPP---PPPP 127 PPPP PPPPPP PPPPPPP PPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/31 (80%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPP---PPPYPPPPPPPP 127 PPPP PPPPPP PPPP PPP PPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPRPCPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 8e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPP 130 PPPP PPPPPP PPPPPPP P PPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPRPCPPPPP 110 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGR 118 PPPP PPPPPP PPPPPPP P P PPPP R Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPAR 112 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PP P PPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPRPCPPP 108 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P + P P P PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPTGYPKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 4/32 (12%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPP----PPP 127 PPPP PPPPPP PPPPP P PPPPP PPP Sbjct: 86 PPPPPPPPPPPPPPPPPRPCPPPPPARPCPPP 117 [126][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/43 (69%), Positives = 31/43 (72%) Frame = -1 Query: 255 VPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +P S SP P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 81 LPPSPSPPPP-----PPPPVPPPPPPPPPPPPPPSPPPPPPPP 118 Score = 69.3 bits (168), Expect = 6e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P V PPPP PPPPPP PPPPPPP PPPPP PP Sbjct: 85 PSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/42 (69%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPP-PPPPPPPNPPPPPPPP 146 Score = 66.6 bits (161), Expect = 4e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPP-PPPPPPPSPPPPPPPP 132 Score = 65.9 bits (159), Expect = 7e-09 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPPPP PP Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140 Score = 65.5 bits (158), Expect = 9e-09 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 10/52 (19%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPP----------YPPPPPPPYPPPPPPPP 127 P P P E PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 52 PPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPP 103 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 L P+ P P PPPP PPPPPP P PPPPP PPPPPPP Sbjct: 81 LPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPP 123 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 SP P P PP PPPPPP PPPP PP PPPPPPPP Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPP 121 Score = 63.2 bits (152), Expect = 5e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PP PP P PPPPPPPP+ Sbjct: 67 PPPPPPPPPPPQPPLPPSPSPPPPPPPPV 95 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 P P PPPP PPPPPP P PPPPP PPPPPPP Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PP P PPP Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPP 154 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPP PPPPPP PPPPP P PPPPPPPP Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPP 148 Score = 62.4 bits (150), Expect = 8e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPP PPPPPP P Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P PL PPP PPPP P PPPPPPP PPPP PPP Sbjct: 77 PQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPP 113 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 213 RPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 RPPPP PPPP P PP PPPP PPPP PPP Sbjct: 245 RPPPPAPPPPRPPPPSPPPPLPPPPSPPP 273 Score = 61.6 bits (148), Expect = 1e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 213 RPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 RPPPP PPPP P PP PPPP PPPP PPP Sbjct: 255 RPPPPSPPPPLPPPPSPPPPLPPPPSPPP 283 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P + P PP PPPPP PPPPPPP PPPPP PP Sbjct: 76 PPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPP 112 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PN+ P P PPPP PPPP P PP PPPP PPPP PPP Sbjct: 304 PNNPFPRPPP--PNPPPPRPPPPSPNPPRPPPPSPPPPRPPP 343 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P P PP PPPPPP PPP PPP PPPPPP P Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSP 150 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P + P PP P PPPP PPP PPP PPPPPPPP Sbjct: 71 PPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPP 107 Score = 59.7 bits (143), Expect = 5e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PP PPPP PPPP PPP Sbjct: 261 PPPPLPPPPSPPPPLPPPPSPPPPSPPP 288 Score = 59.3 bits (142), Expect = 7e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP P PPPPP PPPP P P Sbjct: 116 PPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152 Score = 59.3 bits (142), Expect = 7e-07 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPP PPP P PP Sbjct: 117 PPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPP 153 Score = 59.3 bits (142), Expect = 7e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPP PP PPPPPPP P PPP PP Sbjct: 130 PPPPPPPPNPPPPPPPPPPSPSPPPSPP 157 Score = 58.9 bits (141), Expect = 9e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PP PPPP PPPP PPP Sbjct: 241 PPPPRPPPPAPPPPRPPPPSPPPPLPPP 268 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP PPPPPP PPP P P P PPP PP Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPP 161 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ SP P PPP PPPP P PP PPPP PPPP PPP Sbjct: 222 PSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPP 263 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PP PPPP PPPP PPP Sbjct: 251 PPPPRPPPPSPPPPLPPPPSPPPPLPPP 278 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPP--PPPYPPPPPPPP 127 P S SP P RPPP PP PPP PPPP PPP PPPP PPP Sbjct: 219 PPSPSPPSP----RPPPRRPPFPPPSPPPPRPPPPAPPPPRPPP 258 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PN P P PPPP PPPP P PP PPPP P PP PPP Sbjct: 326 PNPPRPPPP----SPPPPRPPPPSPNPPRPPPPSPSPPKPPP 363 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 P P PPPP PPPP P PPP PPP PPP PPP Sbjct: 131 PPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPP 166 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP PL PPPP PPPP P PP PPPP PPPP P P Sbjct: 256 PPPPSPPPPL----PPPPSPPPPLPPPPSPPPPSPPPPSPLP 293 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/50 (56%), Positives = 28/50 (56%), Gaps = 8/50 (16%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPY-----PPPPPPYPPPPPPPYPP---PPPPPP 127 P S PG P PP P PPPPPP PPPP PP PP PPPPPP Sbjct: 43 PGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPP 92 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLGR 118 P S P P RPPP PP PPP PPP PPP PPP P PP R Sbjct: 177 PPSPPPSPP---PRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPR 218 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP-PPPYPPPPPPPYPPPPPPP 130 PN P P PPP PPP PPP PPP PPP PPP PPP Sbjct: 137 PNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 178 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 8/50 (16%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPP--------PPYPPPPPPPYPPPPPPPP 127 P P +P RPPPP PPPP PP PPPP PP P PPPP P Sbjct: 299 PKPSPPNNPF--PRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSP 346 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP-PPPYPPPPPPPYPPPPPPP 130 P SP P PPP PPP PPP PPP PPP PPP PPP Sbjct: 145 PPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 186 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP-PPPYPPPPPPPYPPPPPPP 130 P S P P PPP PPP PPP PPP PPP PPP PPP Sbjct: 153 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPP 194 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP-PPPYPPPPPPPYPPPPPPP 130 P S P P PPP PPP PPP PPP PPP PPP PPP Sbjct: 161 PPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPP 202 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP-PPPYPPPPPPPYPPPPPPP 130 P S P P PPP PPP PPP PPP PPP PPP PPP Sbjct: 165 PPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPP 206 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP-PPPYPPPPPPPYPPPPPPP 130 P S P P PPP PPP PPP PPP PPP PPP PPP Sbjct: 157 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPP 198 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP-PPPYPPPPPPPYPPPPPPP 130 P S P P PPP PPP PPP PPP PPP PPP PPP Sbjct: 169 PPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPP 210 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPP-PPYPPP-PPPPYPPPPPPPP 127 PN SP P PP P PPP PP+PPP PPPP PPPP PPP Sbjct: 212 PNPPSPRPPS--PSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPP 253 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P RPPPP P PP P PP P PP PPPPP PP Sbjct: 331 PPPPSPPPP----RPPPPSPNPPRPPPPSPSPPKPPPPPSPP 368 [127][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 72.0 bits (175), Expect = 1e-10 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -1 Query: 243 CSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 CSP P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 374 CSPPSP-----PPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = -1 Query: 285 FNCST*GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 F CS P+ P P PPPP PPPPPP PPPPP YP PPPPPP Sbjct: 372 FGCSP------PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 58.9 bits (141), Expect = 9e-07 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 10/46 (21%) Frame = -1 Query: 237 PGDPLVLERPPPP--------YPPPPPP--YPPPPPPPYPPPPPPP 130 P P V PPPP YPPPPPP YPPPP PPY PPPPP Sbjct: 404 PPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 8/36 (22%) Frame = -1 Query: 210 PPPPYPPPPPPYP-----PPPPPPYPPP---PPPPP 127 PPPP PPPPPP P PPPPPP PPP PPPPP Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 [128][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -1 Query: 243 CSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 C+ P V + PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 311 CNGFTPDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 69.3 bits (168), Expect = 6e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPP PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPP PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 Score = 63.2 bits (152), Expect = 5e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPP P PP+ Sbjct: 345 PPPPPPPPPPPPPPPPPPPEPPPQPDPPV 373 Score = 62.4 bits (150), Expect = 8e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PP PPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPEPPPQP 369 Score = 59.3 bits (142), Expect = 7e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPP P P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPEPPPQPDP 371 [129][TOP] >UniRef100_C5YQV9 Putative uncharacterized protein Sb08g019790 n=1 Tax=Sorghum bicolor RepID=C5YQV9_SORBI Length = 227 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVEGD 402 GGTLCAA+KLLERVG V +CACVIELPE KG KL + +F+LVE D Sbjct: 179 GGTLCAAVKLLERVGAKVVECACVIELPELKGRDKLGDRPVFVLVEAD 226 [130][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 71.6 bits (174), Expect = 1e-10 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -1 Query: 249 NSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 N+ SP P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 41 NAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 68.9 bits (167), Expect = 8e-10 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = -1 Query: 249 NSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +S P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 43 HSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -1 Query: 225 LVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 L L++ + PPPPP PPPPPPP PPPPPPPP Sbjct: 34 LFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPQWEP 102 [131][TOP] >UniRef100_UPI000023F4FE hypothetical protein FG11064.1 n=1 Tax=Gibberella zeae PH-1 RepID=UPI000023F4FE Length = 127 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/59 (59%), Positives = 42/59 (71%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSG 229 VD +++ ++ DGR I VN A +RP GG GGG+GGG GGGYGGG GGYGGG RS G Sbjct: 60 VDALNEQEL-DGRRIRVNVANARP--AGGNGGGFGGGRGGGYGGGRGGYGGGDRSYGGG 115 [132][TOP] >UniRef100_C5CY78 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CY78_VARPS Length = 137 Score = 71.2 bits (173), Expect = 2e-10 Identities = 37/58 (63%), Positives = 42/58 (72%), Gaps = 5/58 (8%) Frame = +2 Query: 80 VDGRNITVNEA---QSRPRGGGGGGGGYGGGGGGGYGGGGGG--YGGGGRSRTSGSPG 238 + GR +TVNEA ++RP GGGGG YGGGGGGGYGGGGGG YGGGG R+ G G Sbjct: 69 LQGRALTVNEARPMEARPPRTGGGGG-YGGGGGGGYGGGGGGGGYGGGGGGRSGGGGG 125 [133][TOP] >UniRef100_C5YNX7 Putative uncharacterized protein Sb08g015580 n=1 Tax=Sorghum bicolor RepID=C5YNX7_SORBI Length = 250 Score = 71.2 bits (173), Expect = 2e-10 Identities = 38/63 (60%), Positives = 41/63 (65%), Gaps = 3/63 (4%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRG-GGGGGGGYGGGG--GGGYGGGGGGYGGGGRSRTSGSPGLQEF 250 +DGR+I VN A R G G GGGGYGGGG GGGYGGGGGGYGGGG G G + Sbjct: 96 LDGRSIRVNHANERTGGFRGSGGGGYGGGGFGGGGYGGGGGGYGGGGGGYGGGYGG--NY 153 Query: 251 GTR 259 G R Sbjct: 154 GNR 156 [134][TOP] >UniRef100_B6TR84 Glycine-rich RNA-binding protein 7 n=1 Tax=Zea mays RepID=B6TR84_MAIZE Length = 253 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/54 (62%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGG-GGGYGGGGGGYGGGGRSRTSGSPG 238 +DGRNI VN A R G GGGYGGGG GGGYGGG GGYGGGG G G Sbjct: 100 LDGRNIRVNHANERTGGFRSSGGGYGGGGYGGGYGGGSGGYGGGGSGDYGGGSG 153 [135][TOP] >UniRef100_Q9XY11 Cold-inducible RNA-binding protein n=1 Tax=Ciona intestinalis RepID=Q9XY11_CIOIN Length = 158 Score = 71.2 bits (173), Expect = 2e-10 Identities = 40/72 (55%), Positives = 46/72 (63%), Gaps = 4/72 (5%) Frame = +2 Query: 56 DGIDKLDIVD--GRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGY--GGGGRSRT 223 D I+ L+ D GRN++V +AQS+ GGGGG GG G GGGG GGGGGGY GGGG R Sbjct: 60 DAIENLNESDVAGRNVSVRQAQSKRDGGGGGRGGGGYGGGGYGGGGGGGYGGGGGGGGRY 119 Query: 224 SGSPGLQEFGTR 259 GS G G R Sbjct: 120 GGSSGYGGGGRR 131 [136][TOP] >UniRef100_Q95UX5 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX5_DROVI Length = 162 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = +2 Query: 119 RPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 R RGGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 64 RARGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 103 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 113 [137][TOP] >UniRef100_Q95NP2 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NP2_DROVI Length = 164 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = +2 Query: 119 RPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 R RGGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 66 RARGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 105 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 74 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 115 [138][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 71.2 bits (173), Expect = 2e-10 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGR 118 PPPP PPPPPP PPPPPPP PPPPPPPPL R Sbjct: 1476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPR 1506 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 1502 Score = 66.2 bits (160), Expect = 5e-09 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 216 ERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 E PP P PPPPPP PPPPPPP PPPPPPPP Sbjct: 1470 ETPPLPPPPPPPPPPPPPPPPPPPPPPPPP 1499 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 219 LERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 + R PP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1467 MARETPPLPPPPPPPPPPPPPPPPPPPPPPP 1497 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 PL PPPP PPPPPP PPPPPPP PPPPP P Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 1505 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 PPPP PPPPPP PPPPPPP PPP P P G Sbjct: 1481 PPPPPPPPPPPPPPPPPPPPPPPLPRTPRG 1510 [139][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/40 (72%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = -1 Query: 237 PGDP---LVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PGDP + PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 258 PGDPFQEITGPGPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 69.7 bits (169), Expect = 5e-10 Identities = 28/37 (75%), Positives = 28/37 (75%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PG P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 268 PGPP-----PPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 6/34 (17%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPP---PPP---PPP 127 PPPP PPPPPP PPPPPPP PP PPP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPFILPPPFILPPP 311 [140][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 71.2 bits (173), Expect = 2e-10 Identities = 31/50 (62%), Positives = 32/50 (64%) Frame = -1 Query: 264 STLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 +T VP P P PPPP PPPPPP PPPP PP PPPPPPPP RD Sbjct: 55 NTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRD 104 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 L+P + G+ + P PP PPPPPP PPPPPPP PPPPPPPP Sbjct: 45 LIPLTIFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 88 [141][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 243 CSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 C P + +V +PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 194 CCPQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPP 232 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/52 (53%), Positives = 30/52 (57%) Frame = -1 Query: 282 NCST*GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +C + P P P PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 193 DCCPQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 66.2 bits (160), Expect = 5e-09 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PP PPP PPPPPPP PPPPPPPP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 66.2 bits (160), Expect = 5e-09 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PP PPP PPPPPPP PPPPPPPP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP P PPPPP Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPP PPPPPPP P PPPPPP Sbjct: 233 PPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPP PPPPPP PPPPPP PPPP PPP Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYP-PPPPPPYPPPPPPPP 127 P SP P PP P PPPPPP P PPPPPP P PPPPPP Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPP 278 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPP-PYPPPPPPPP 127 P S P P PPP PPPP P PPPPPP P PPPPPPPP Sbjct: 238 PPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PP P PPPPPP P PPPPP PP PPP P Sbjct: 250 PPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAP 286 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP P PPPP P P PPP PPPP PPP Sbjct: 248 PPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 P SP P P PP PPP P PPPPPPP PPP PPP Sbjct: 248 PPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPP 288 [142][TOP] >UniRef100_B4FS03 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FS03_MAIZE Length = 180 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVEGD 402 GGTLCAA+KL+ERVG V +CACVIELPE KG KL + +F+LVE D Sbjct: 132 GGTLCAAVKLIERVGAKVVECACVIELPELKGRDKLGDRPVFVLVEAD 179 [143][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/56 (55%), Positives = 34/56 (60%) Frame = -1 Query: 294 F*KFNCST*GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 F K+N + +P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 41 FLKYNFNEKMVIELPPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/45 (66%), Positives = 30/45 (66%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 L P P P PPPP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 102 Score = 65.5 bits (158), Expect = 9e-09 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTVIL 91 PPPP PPPPPP PPPPPPP PP PPPPP ++ +IL Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLHLELIL 119 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPP PPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 [144][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/52 (59%), Positives = 31/52 (59%), Gaps = 5/52 (9%) Frame = -1 Query: 267 GSTLVPNSCSPGDPLVLERPPPPYPPPPP-----PYPPPPPPPYPPPPPPPP 127 G VP G P L PPPP PPPPP P PPPPPPP PPPPPPPP Sbjct: 1191 GDVCVPAPVPAGPPPPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPP 1242 Score = 64.7 bits (156), Expect = 2e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 PPPP PPPPPP PPP PPP PPPPPPPP+G Sbjct: 1220 PPPPLPPPPPP-PPPLPPPPPPPPPPPPVG 1248 Score = 58.9 bits (141), Expect = 9e-07 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = -1 Query: 243 CSPGDPLVLERPPPPYPPPPP--PYPPPPPPPYPPPPPPPPL 124 C P P+ PPP PPPPP P PPPPPP PPPPPPPPL Sbjct: 1194 CVPA-PVPAGPPPPLTPPPPPLPPPPPPPPPLPPPPPPPPPL 1234 [145][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 PPPP PPPPPP PPPPPPP PPPPPPPP RD Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRD 49 Score = 70.1 bits (170), Expect = 4e-10 Identities = 29/43 (67%), Positives = 29/43 (67%) Frame = -1 Query: 255 VPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 VP P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 67.0 bits (162), Expect = 3e-09 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -1 Query: 213 RPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 R PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 RVPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 [146][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 70.9 bits (172), Expect = 2e-10 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 225 LVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 L+ RPPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 LLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 70.5 bits (171), Expect = 3e-10 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = -1 Query: 255 VPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +P+ P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 LPHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 70.5 bits (171), Expect = 3e-10 Identities = 29/44 (65%), Positives = 30/44 (68%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 L+P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 LLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 70.1 bits (170), Expect = 4e-10 Identities = 29/44 (65%), Positives = 29/44 (65%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 L P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 23 LPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPL 98 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 PPPP PPPPPP PPPPPPP PPPPP PP R+ Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRN 104 Score = 64.7 bits (156), Expect = 2e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 [147][TOP] >UniRef100_A9FA50 Putative RNA-binding protein n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9FA50_SORC5 Length = 123 Score = 70.5 bits (171), Expect = 3e-10 Identities = 36/54 (66%), Positives = 39/54 (72%), Gaps = 7/54 (12%) Frame = +2 Query: 80 VDGRNITVNEAQSR---PRGGGGGGGGYGGGGGGGYGGGGGG----YGGGGRSR 220 +DGR +TVNEA+ R P GGGGGGG GGGGGGG GGGGGG GGGGR R Sbjct: 69 LDGRTLTVNEARERTGGPGGGGGGGGFRGGGGGGGRGGGGGGRGGGRGGGGRDR 122 [148][TOP] >UniRef100_C4J159 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J159_MAIZE Length = 261 Score = 70.5 bits (171), Expect = 3e-10 Identities = 37/65 (56%), Positives = 38/65 (58%), Gaps = 12/65 (18%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGG-----------GGGGGGYGGGG-GGGYGGGGGGYGGGGRSRT 223 +DGRNI VN A R G GGGGGGYGGGG GGGYGGG GGYGGGG Sbjct: 97 LDGRNIRVNHANERTGGFRSSGGYGGGGYGGGGGGYGGGGYGGGYGGGSGGYGGGGSGDY 156 Query: 224 SGSPG 238 G G Sbjct: 157 GGGSG 161 [149][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 70.5 bits (171), Expect = 3e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 22 PPPPRPPPPPPPPPPPPPPPPPPPPPPPL 50 Score = 66.2 bits (160), Expect = 5e-09 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P L PPPP PPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPP 48 Score = 62.8 bits (151), Expect = 6e-08 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PP P PPPPPP PPPPPPP PPPPPP PL Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPLPL 52 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 225 LVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 + L P PP PPPP P PPPPPPP PPPPPPPP Sbjct: 12 IYLPPPLPPPPPPPRPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 1e-06 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -1 Query: 213 RPPPPYPPPPPPYPPPPPPPYPPPPP 136 RPPPP PPPPPP PPPPPPP PPP P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPLP 51 [150][TOP] >UniRef100_C6SWN0 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SWN0_SOYBN Length = 236 Score = 70.5 bits (171), Expect = 3e-10 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVEG 399 GGTL AAIKLLERVGV+V +CACVIELPE KG +L KSLF+L+ G Sbjct: 188 GGTLGAAIKLLERVGVHVVECACVIELPELKGRERLGDKSLFVLING 234 [151][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 70.5 bits (171), Expect = 3e-10 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 219 LERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +E PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 MEPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPQP 46 [152][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 70.5 bits (171), Expect = 3e-10 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 225 LVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +V+ PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 74 IVIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 63.2 bits (152), Expect = 5e-08 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 ++P P P PPPP PPPPPP PPPPPPP PPPPP P Sbjct: 75 VIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCP 118 [153][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 70.5 bits (171), Expect = 3e-10 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 225 LVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 ++L PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 68 VILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 70.1 bits (170), Expect = 4e-10 Identities = 29/44 (65%), Positives = 29/44 (65%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 L P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 70 LTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 68.9 bits (167), Expect = 8e-10 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPP+ Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPPPV 116 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 66.2 bits (160), Expect = 5e-09 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 PPPP PPPPPP PPPPPPP PPPPPPP G Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 [154][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 70.5 bits (171), Expect = 3e-10 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 234 GDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 GD + +PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 92 GDGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPPPPP 127 Score = 55.5 bits (132), Expect = 9e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 PPPP PPPPPP PPPPPPP PPP L D Sbjct: 105 PPPPPPPPPPPPPPPPPPPPPPPGSAEALQTD 136 [155][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 70.5 bits (171), Expect = 3e-10 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -1 Query: 249 NSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +S +P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 HSLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 70.5 bits (171), Expect = 3e-10 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = -1 Query: 261 TLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +L P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 66.6 bits (161), Expect = 4e-09 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTVILR 88 PPPP PPPPPP PPPPPPP PPPPPPP R + + LR Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIPLFLR 72 [156][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 70.5 bits (171), Expect = 3e-10 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S SP P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 255 PPSPSPPPP---PPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 68.9 bits (167), Expect = 8e-10 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP PPPPPP PPP PPP PPPPPPPP Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPP P PPPPPPPP Sbjct: 246 PSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPPP PPPPPP P PPPPP PPPPPPPP Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP PPPPP PPPPPPP PPPPPPPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPP-PPPPPPPSPPPPPPPP 285 Score = 62.8 bits (151), Expect = 6e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPP P PP Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -1 Query: 246 SCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 S P P RPP P PP P P PPPPPPP PPPPPPP Sbjct: 238 SSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPP 276 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPP---PPPYPPPPPPPP 127 P RPP P P P PP PPPP PPP PPPPPPPP Sbjct: 235 PTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPP 271 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPP P PP PP P Sbjct: 270 PPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP P PP PP Sbjct: 269 PPPPPPPPSPPPPPPPPPPP-PPPPPPPSPSPPRKPP 304 [157][TOP] >UniRef100_Q9M6A0 Putative glycine-rich RNA binding protein 3 n=1 Tax=Catharanthus roseus RepID=Q9M6A0_CATRO Length = 164 Score = 70.1 bits (170), Expect = 4e-10 Identities = 41/74 (55%), Positives = 42/74 (56%), Gaps = 21/74 (28%) Frame = +2 Query: 80 VDGRNITVNEAQSR------------PRGGGGGGGGYGG-------GGGGGYGGG--GGG 196 +DGRNITVNEAQSR PR GGGGGGYGG GG GGYGGG GG Sbjct: 74 LDGRNITVNEAQSRGSGGNGGGGFRGPRRDGGGGGGYGGGRRDGGYGGNGGYGGGRREGG 133 Query: 197 YGGGGRSRTSGSPG 238 YGGG R G G Sbjct: 134 YGGGDRGYGGGGGG 147 [158][TOP] >UniRef100_B1X5L4 RNA-binding protein RbpD n=1 Tax=Paulinella chromatophora RepID=B1X5L4_PAUCH Length = 132 Score = 70.1 bits (170), Expect = 4e-10 Identities = 39/75 (52%), Positives = 42/75 (56%), Gaps = 21/75 (28%) Frame = +2 Query: 50 EVDGIDKLDIVD--GRNITVNEAQSRPRGGG-------------------GGGGGYGGGG 166 E ID L V+ GR I VN+A+ R GGG GGGGGYGGGG Sbjct: 55 EQKAIDDLQDVEWMGRMIRVNKAEPRTGGGGNRGGGGGGGGGGGGYGGGRGGGGGYGGGG 114 Query: 167 GGGYGGGGGGYGGGG 211 GGGYG GGGGYGGGG Sbjct: 115 GGGYGSGGGGYGGGG 129 [159][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 70.1 bits (170), Expect = 4e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P + P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 69.7 bits (169), Expect = 5e-10 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 PPPP PPPPPP PPPPPPP PPPPPPPP G Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 69.3 bits (168), Expect = 6e-10 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -1 Query: 231 DPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 850 EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 69.3 bits (168), Expect = 6e-10 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -1 Query: 261 TLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 T P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 852 TTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 68.9 bits (167), Expect = 8e-10 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+V E P P PPPPPP PPPPPPP PPPPPPPP Sbjct: 845 PMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPP 878 Score = 68.9 bits (167), Expect = 8e-10 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = -1 Query: 264 STLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +T P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 852 TTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 63.9 bits (154), Expect = 3e-08 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPP L Sbjct: 944 PPPPPPPPPPPPPPPPPPPGAPPPPPPAL 972 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPP--PPP 127 PPPP PPPPPP PPPPPPP PPPPP PPP Sbjct: 938 PPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 2/30 (6%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPP--PPPPPP 127 PPPP PPPPPP PPPPPPP PP PPPPPP Sbjct: 941 PPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 7/54 (12%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPP--PPPPPPL-----GRD*ASFTVILRPSTISS 70 PPPP PPPPP PPPPPP PP PPPPP L G++ T+I S SS Sbjct: 953 PPPPPPPPPPGAPPPPPPALPPGAPPPPPALPCFHEGQEYPPNTIIEEASCTSS 1006 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 2/30 (6%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPP--PPPPP 127 PPPP PPPPPP PPPPPP PP PPPPP Sbjct: 952 PPPPPPPPPPPGAPPPPPPALPPGAPPPPP 981 [160][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 70.1 bits (170), Expect = 4e-10 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL----GRD*ASFTVILRPSTISS 70 P P PPPP P PPPP PPPPPPP PPPPPPPPL GR + F+ + P T + Sbjct: 223 PPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTGR--SCFSYAIGPYTRGN 280 Query: 69 LSIPS 55 PS Sbjct: 281 SGTPS 285 Score = 65.9 bits (159), Expect = 7e-09 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P PL PPPP P PPPP PPPPPPP PPPP PPP Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPP 246 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -1 Query: 246 SCSPGDPLVLERPPPPYPPPPP-PYPPPPPPPYPPPPPPPP 127 SC+P P PPPP PPPPP P PP PPPP PPPP PPP Sbjct: 1169 SCNPPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPP 1209 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP PPPP P PP PPPP PPPP PPP Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2744 Score = 62.0 bits (149), Expect = 1e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPP PP PPPPPPP PPPP PPP Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPP 233 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -1 Query: 225 LVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 +V + P PP PPPPPP PPPPPPP PP PPPP Sbjct: 198 VVSDFPSPPPPPPPPPLPPPPPPPPPPSPPPP 229 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPP-PPPPYPPPPPPPP 127 P SP P PPP PPPPPP PPP PPPP PPPP PPP Sbjct: 2267 PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPP 2309 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -1 Query: 243 CSPGDPLVLERPPPPYPPPPPPYPPP--PPPPYPPPPPPPP 127 CSP P PP P P PPPP PPP PPPP PPPP PPP Sbjct: 2527 CSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPP 2567 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPPP PPPP P PP PPPP PPP PPPP Sbjct: 2534 PPSPPPSPP---PSPPPPLPPPPSPPPPSPPPPSPPPSPPPP 2572 Score = 60.8 bits (146), Expect = 2e-07 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -1 Query: 216 ERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 E PPP PPPP P+PP PPPP PPPP PPP Sbjct: 2250 ENSPPPSPPPPSPHPPSPPPPSPPPPSPPP 2279 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPPP PPPP P PP PPPP PPP PPPP Sbjct: 2682 PPSPPPSPP---PSPPPPSPPPPSPPPPSPPPPSPPPSPPPP 2720 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 SP P PPP PPPPPP PPPP PP PPPP PPP Sbjct: 204 SPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPP 241 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = -1 Query: 267 GSTLVPNSCSPGDPLVLERPPPPYPPP-PPPYPPP--PPPPYPPPPPPPP 127 G T + P P PPPP PPP PPP PPP PPPP PPPP PPP Sbjct: 2661 GQTCIKPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPP 2710 Score = 60.1 bits (144), Expect = 4e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PP PPPP PPPP PPP Sbjct: 2722 PPPPSPPPPSPPPPSPPPPSPPPPSPPP 2749 Score = 60.1 bits (144), Expect = 4e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PP PPPP PPPP PPP Sbjct: 2727 PPPPSPPPPSPPPPSPPPPSPPPPSPPP 2754 Score = 60.1 bits (144), Expect = 4e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PP PPPP PPPP PPP Sbjct: 2732 PPPPSPPPPSPPPPSPPPPSPPPPSPPP 2759 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYP-PPPPPPYPPPPPPPP 127 P+ SP P PPPP PPPP P P PPPPPP PPP PPPP Sbjct: 2262 PHPPSPPPP----SPPPPSPPPPTPPPSPPPPPPTPPPSPPPP 2300 Score = 59.3 bits (142), Expect = 7e-07 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPP-PPPPYPPP-PPPPYPPPPPPPP 127 P S P P L PP P PP PPPP PPP PPPP PPP PPPP Sbjct: 2538 PPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPP PPPP P PP PPPP PPPP PPP Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2739 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPPP PPP PP PP PPPP PPPP PPP Sbjct: 2274 PPSPPPPTPPPSPPPPPPTPPPSPP-PPSPPPPSPPPPSPPP 2314 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -1 Query: 231 DPLVLERPPPPYPPP-PPPYPPP--PPPPYPPPPPPPP 127 DP PPPP PPP PPP PPP PPPP PPPP PPP Sbjct: 2525 DPCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPP 2562 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -1 Query: 249 NSCSPGDPLVLERPPPPYPP-PPPPYPPPP-PPPYPPPPPPPP 127 NS P P PP P PP PPPP PPPP PPP PPPPPP P Sbjct: 2251 NSPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTP 2293 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPP--PPPPYPPPPPPPP 127 P+ P P PP P PP PPP PPP PPPP PPPP PPP Sbjct: 2691 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPP 2734 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 P S P P PPP PPP PP P PPPP PPP PPPPL Sbjct: 2719 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPL 2761 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PP PPPP PP P PPP Sbjct: 2742 PPPPSPPPPSPPPPSPPPPLPPAPSPPP 2769 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPP-PPPPYPPP-PPPPYPPPPPPPP 127 P S P P PP P PP PPPP PPP PPPP PPPP PPP Sbjct: 2686 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Score = 56.6 bits (135), Expect = 4e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPP 130 PPPP PPPP P PP PPPP PPPP PP Sbjct: 2737 PPPPSPPPPSPPPPSPPPPSPPPPLPP 2763 Score = 56.2 bits (134), Expect = 6e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PP PP P PPP PPPP Sbjct: 2747 PPPPSPPPPSPPPPLPPAPSPPPSPPPP 2774 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPP-PPPPYPPPP-PPPYPPPPPPPP 127 P P P PP P PP PPPP PPPP PPP PPPP PPP Sbjct: 2681 PPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPP 2724 [161][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 70.1 bits (170), Expect = 4e-10 Identities = 29/47 (61%), Positives = 30/47 (63%) Frame = -1 Query: 267 GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 G TL P +P P PPPP PPPPPP PPPPPPP PP PPP P Sbjct: 1399 GLTLTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 63.2 bits (152), Expect = 5e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP P PPP P PPPPPPPP+ Sbjct: 1427 PPPPPPPPPPPPPTPPPAPPPPPPPPPPI 1455 Score = 59.3 bits (142), Expect = 7e-07 Identities = 24/44 (54%), Positives = 28/44 (63%) Frame = -1 Query: 258 LVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +V + G+ + L P PPPPP PPPPPPP PPPPPPPP Sbjct: 1387 MVSYTAGDGNDVGLTLTPTGTAPPPPPPPPPPPPPPPPPPPPPP 1430 [162][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 216 ERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 E PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 222 EAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 251 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 252 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 253 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 227 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 Score = 59.3 bits (142), Expect = 7e-07 Identities = 27/49 (55%), Positives = 28/49 (57%) Frame = -1 Query: 285 FNCST*GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPP 139 FN + TL N P PPPP PPPPPP PPPPPPP PPPP Sbjct: 206 FNTHSILGTLTYNFGGEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 [163][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 70.1 bits (170), Expect = 4e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 68.9 bits (167), Expect = 8e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 68.6 bits (166), Expect = 1e-09 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTVI--LRPSTI 76 P PP PPPPPP PPPPPPP PPPPPPPP+ D S ++ L+P I Sbjct: 275 PSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCSVCIVAKLQPPAI 321 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPPP PPPPPP PPPP PP PPPPPPPP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P S P P PPPP PPPPPP PPPPPP PPPPPPPP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PPP PP PPPPPPP PPPPPPPP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 66.6 bits (161), Expect = 4e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 66.6 bits (161), Expect = 4e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PPPPPP PPPPP P PPPPPPPP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 66.2 bits (160), Expect = 5e-09 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -1 Query: 264 STLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 S L P+ P P PPPP PPPPP PP PPPP PPPPPPPP Sbjct: 220 SPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 66.2 bits (160), Expect = 5e-09 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 66.2 bits (160), Expect = 5e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PPPPPP P PPPPP PPPPPPPP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 65.9 bits (159), Expect = 7e-09 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPP PPPPPP PPP PPP PPPPPPPP Sbjct: 219 PSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPP 260 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPP PPPPPPP PPPPPPPP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPP P PPPPPPP PPPPPPPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPP PP PPPPPPP PPPPPPPP Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PP PPP PPPPPPP PPPPPPPP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP P PPPP PPPPPPP PPPPPPPP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 273 PPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PP P PPPPPP PPPPPPP PPPPPPPP Sbjct: 274 PPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PP P PPPPPP PPPPPPP PPPPPP P Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 62.8 bits (151), Expect = 6e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PP PPPPPP PPPPPPP PPPPP PP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/50 (48%), Positives = 27/50 (54%) Frame = -1 Query: 279 CST*GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 C ++ +P P L PPP PPP PP PPPPPP PPP PPP Sbjct: 202 CPISQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPP 251 Score = 55.5 bits (132), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -1 Query: 210 PPPPYPP-PPPPYPPPPPPPYPPPPPPPP 127 PP P PP PPPP PP PPP PPPPPPPP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPP 246 [164][TOP] >UniRef100_B6T920 Adenine phosphoribosyltransferase 1 n=1 Tax=Zea mays RepID=B6T920_MAIZE Length = 180 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVEGD 402 GGTLCAA+KL+ERVG V +CACVIELPE KG KL + +F+LVE D Sbjct: 132 GGTLCAAVKLIERVGAKVFECACVIELPELKGRDKLGDRPVFVLVEAD 179 [165][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPL 51 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.6 bits (166), Expect = 1e-09 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 PPPP PPPPPP PPPPPPP PPPPPPP LG Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPLLG 53 [166][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 216 ERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 E PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 ETPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 66.2 bits (160), Expect = 5e-09 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ R PP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [167][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPL 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGR 118 PPPP PPPPPP PPPPPPP PPPP P GR Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPLRAPKGR 45 [168][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 70.1 bits (170), Expect = 4e-10 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPL 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [169][TOP] >UniRef100_UPI00016C4C95 RNA-binding protein n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C4C95 Length = 129 Score = 69.7 bits (169), Expect = 5e-10 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +2 Query: 80 VDGRNITVNEAQSRP-RGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 + GR +TVNEA+ R R GGGGGYGGGGGG YGGGGGGYGGGG R+ G G Sbjct: 67 LSGRTLTVNEAKPREERPRSGGGGGYGGGGGG-YGGGGGGYGGGG-GRSGGGYG 118 [170][TOP] >UniRef100_Q7VEJ9 RNA-binding protein, RRM domain n=1 Tax=Prochlorococcus marinus RepID=Q7VEJ9_PROMA Length = 252 Score = 69.7 bits (169), Expect = 5e-10 Identities = 33/56 (58%), Positives = 37/56 (66%), Gaps = 5/56 (8%) Frame = +2 Query: 86 GRNITVNEAQSRPRGGGGGGGGYGGGGGGGYG-----GGGGGYGGGGRSRTSGSPG 238 GR + +N+A+ R GGGG GGGYGGGG GGYG GGGGGYGGGG G G Sbjct: 69 GRPLRINKAEPRGGGGGGRGGGYGGGGRGGYGGGGGYGGGGGYGGGGYGGGGGQGG 124 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGG-GGYGGGGRSRTSG 229 GGGGG GGYGGGG GGYGGGG GGYGGGG+ G Sbjct: 117 GGGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGG 151 Score = 58.9 bits (141), Expect = 8e-07 Identities = 28/36 (77%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = +2 Query: 128 GGGGGGGGYGGGGG-GGYGGGG-GGYGGGGRSRTSG 229 GGG GGGGYGGGGG GGYGGGG GGYGGGG+ G Sbjct: 108 GGGYGGGGYGGGGGQGGYGGGGQGGYGGGGQGGYGG 143 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/40 (65%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGG-GGYGGGGRSRTSGSPGLQE 247 GGGG GGYGGGG GGYGGGG GGYGGGG+ G ++ Sbjct: 166 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGGGQDTEQ 205 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGG-GGYGGGGRSRTSG 229 GGGG GGYGGGG GGYGGGG GGYGGGG+ G Sbjct: 126 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGG 159 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGG-GGYGGGGRSRTSG 229 GGGG GGYGGGG GGYGGGG GGYGGGG+ G Sbjct: 134 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGG 167 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGG-GGYGGGGRSRTSG 229 GGGG GGYGGGG GGYGGGG GGYGGGG+ G Sbjct: 142 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGG 175 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGG-GGYGGGGRSRTSG 229 GGGG GGYGGGG GGYGGGG GGYGGGG+ G Sbjct: 150 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGG 183 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGG-GGYGGGGRSRTSG 229 GGGG GGYGGGG GGYGGGG GGYGGGG+ G Sbjct: 158 GGGGQGGYGGGGQGGYGGGGQGGYGGGGQGGYGG 191 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 3/42 (7%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGG-GGYGGG--GRSRTSGSPGLQE 247 GGGG GGYGGGG GGYGGGG GGYGGG R SG+ G ++ Sbjct: 174 GGGGQGGYGGGGQGGYGGGGQGGYGGGQDTEQRASGAQGWED 215 [171][TOP] >UniRef100_Q3ANN6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. CC9605 RepID=Q3ANN6_SYNSC Length = 173 Score = 69.7 bits (169), Expect = 5e-10 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGY-GGGGRSRTSG 229 ++G+ +++ GR + +N+A+ R GGGGYGGGGGGGYGGGGGGY GGGG G Sbjct: 59 IEGLQGAELM-GRPLRINKAEPRGSAPRRGGGGYGGGGGGGYGGGGGGYRGGGGGGYGGG 117 Query: 230 SPGLQEFGTR 259 G + G R Sbjct: 118 GAGDRPSGAR 127 [172][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 69.7 bits (169), Expect = 5e-10 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 10/72 (13%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSR---PRGGGGGGG------GYGGGGGGGY-GGGGGGYG 202 ++G+ +++ GR + +N+A+ R PR GGGGGG GYGGGGGGGY GGGGGGYG Sbjct: 89 IEGLQGAELM-GRPLRINKAEPRGSAPRRGGGGGGYGGGGGGYGGGGGGGYGGGGGGGYG 147 Query: 203 GGGRSRTSGSPG 238 GGG G G Sbjct: 148 GGGGGGYGGGGG 159 Score = 66.2 bits (160), Expect = 5e-09 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 6/49 (12%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGG----GGYGGGGRSRTSGSPGLQE--FGTR 259 GGGGGGGYGGGGGGGYGGGG GG GGGG R SG+ G ++ +G R Sbjct: 139 GGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGGDRPSGARGWEDRSYGAR 187 [173][TOP] >UniRef100_Q2QQ97 Os12g0502200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QQ97_ORYSJ Length = 258 Score = 69.7 bits (169), Expect = 5e-10 Identities = 40/70 (57%), Positives = 42/70 (60%), Gaps = 8/70 (11%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYG----GGGGGGYGG----GGGGYGGG 208 +DG D +DGRNI VN A R G GGGGYG GGGGGGYGG GGGGYGGG Sbjct: 92 LDGKD----LDGRNIRVNTANERTGGFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGGG 147 Query: 209 GRSRTSGSPG 238 G S G G Sbjct: 148 GYSGGGGGGG 157 [174][TOP] >UniRef100_A7SMB0 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SMB0_NEMVE Length = 139 Score = 69.7 bits (169), Expect = 5e-10 Identities = 37/67 (55%), Positives = 44/67 (65%), Gaps = 9/67 (13%) Frame = +2 Query: 56 DGIDKLD--IVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGG-------GGGYGGG 208 D I++LD DGR++ VN+A+SR + GGG GGGY GGGGGYGGG GGG GGG Sbjct: 60 DAINELDGQEFDGRSMKVNQARSREQRGGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGG 119 Query: 209 GRSRTSG 229 GR G Sbjct: 120 GRRDYGG 126 [175][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 69.7 bits (169), Expect = 5e-10 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 250 PPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPP 291 Score = 69.3 bits (168), Expect = 6e-10 Identities = 29/43 (67%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYP-PPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP P PPPPP PPPPPPP PPPPPPPP Sbjct: 284 PPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPP 326 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 3/50 (6%) Frame = -1 Query: 267 GSTLVPNS--CSPGDPLVLERPPPPYPPP-PPPYPPPPPPPYPPPPPPPP 127 G + P++ C P P PPPP PPP PPP PPPPPPP PPPPPPPP Sbjct: 228 GDSCCPSAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPP 277 Score = 68.6 bits (166), Expect = 1e-09 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYP---PPPPPPYPPPPPPPP 127 P C P P PPPP PPPPPP P PPPPPP PPPPPPPP Sbjct: 258 PPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPP 302 Score = 66.2 bits (160), Expect = 5e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPP PPPPPP PPPPPPP PPPPPP P Sbjct: 243 PPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCP 284 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPPP PPPPPPP P PPP PP Sbjct: 298 PPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPP 334 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP P PPPP PPPP PP PPPPPPPP Sbjct: 279 PPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPP 315 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPP PPPPP PPPPPPP PPPP PPP Sbjct: 280 PPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPP 321 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPP PPPPPP PPPP PP P PPPPPP Sbjct: 325 PPPCPPPCPPPC---PPPCPPPPPPCPPPPCPPPPCPPPPPP 363 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PP PPP PPP PPP PPPPPP P Sbjct: 312 PPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCP 348 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPP-PYPPPPPPPYPPPPPPP 130 P P PPPP PPPPP P PPPPPPP PPP PPP Sbjct: 299 PPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPP 335 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP-----PPPYPPPPPPPYPPPPPPPP 127 P C P P PPPP PPP PPP PPPPPP PPP PPPP Sbjct: 315 PPPCPPPPP-----PPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPP 356 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYP--PPPPPYPPPPPPPYPPPPPPPP 127 P C P P PPP P PPPPP PPP PPP PPP PPPP Sbjct: 301 PPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPP 344 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/47 (57%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPP--PPPYPPPPPPPYPP--PPPPPPL 124 P C P P PPPP PPP PPP PPPPPP PP P PPPP+ Sbjct: 329 PPPCPPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCPPACPIPPPPM 375 [176][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 69.7 bits (169), Expect = 5e-10 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = -1 Query: 261 TLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +L P P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [177][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 69.7 bits (169), Expect = 5e-10 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPG-DPLV-LERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P C+P P+ + PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PAVCAPACQPICCVPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 66.2 bits (160), Expect = 5e-09 Identities = 28/43 (65%), Positives = 28/43 (65%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 P C P P PPPP PPPPPP PPPPPPP PPPPP PL Sbjct: 46 PICCVPAPP----PPPPPPPPPPPPPPPPPPPPPPPPPPQQPL 84 [178][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 69.7 bits (169), Expect = 5e-10 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 PPPP PPPPPP PPPPPPP PPPPPPPP G Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 80 Score = 69.3 bits (168), Expect = 6e-10 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 PPPP PPPPPP PPPPPPP PPPPPPPP G Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPGG 81 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 PPPP PPPPPP PPPPPPP PPPPPP G D Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 [179][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 69.7 bits (169), Expect = 5e-10 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 PPPP PPPPPP PPPPPPP PPPPPPPP D Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTQED 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 [180][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 69.7 bits (169), Expect = 5e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 225 LVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +++ PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 71 MMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +P P PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 75 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 68.9 bits (167), Expect = 8e-10 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGR 118 PPPP PPPPPP PPPPPPP PPPPPPPP R Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRRR 116 Score = 67.8 bits (164), Expect = 2e-09 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P ++ PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPP P Sbjct: 90 PPPPPPPPPPPPPPPPPPPPPPPPRRRP 117 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -1 Query: 261 TLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 T P P P PPPP PPPPPP PPPPPPP PPP P Sbjct: 74 TTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRP 117 [181][TOP] >UniRef100_UPI0001745B20 RNA-binding region RNP-1 n=1 Tax=Verrucomicrobium spinosum DSM 4136 RepID=UPI0001745B20 Length = 150 Score = 69.3 bits (168), Expect = 6e-10 Identities = 37/69 (53%), Positives = 44/69 (63%), Gaps = 3/69 (4%) Frame = +2 Query: 41 MDFEVDGIDKLDIVDGRNITVNEA---QSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGG 211 MD + G++ L+ + GR +TVNEA + RP GGGGG GGGGGGG GGGGGYGGGG Sbjct: 57 MDAAIKGLNGLEWM-GRALTVNEARPREERPSYSGGGGGYSGGGGGGGRKGGGGGYGGGG 115 Query: 212 RSRTSGSPG 238 G G Sbjct: 116 GGGYGGGGG 124 [182][TOP] >UniRef100_B1Q4T1 Glycine-rich protein n=1 Tax=Bruguiera gymnorhiza RepID=B1Q4T1_9ROSI Length = 163 Score = 69.3 bits (168), Expect = 6e-10 Identities = 41/70 (58%), Positives = 43/70 (61%), Gaps = 17/70 (24%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGG-----GGGGYGG----GG--------GGGYGGGGGGYGGG 208 +DGRNITVNEAQSR GGGG GGGG+GG GG GGGYGGG GG GG Sbjct: 77 LDGRNITVNEAQSRGSGGGGFSRGAGGGGFGGNRRDGGGRGGYNRNGGGYGGGYGGGYGG 136 Query: 209 GRSRTSGSPG 238 GR R G G Sbjct: 137 GRDRGYGDGG 146 [183][TOP] >UniRef100_UPI0001983FDF PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983FDF Length = 192 Score = 69.3 bits (168), Expect = 6e-10 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTLCAAIKLLERVG V +CACVI LPE KG +L GK L+ILVE Sbjct: 144 GGTLCAAIKLLERVGAEVVECACVIGLPEAKGQCRLNGKPLYILVE 189 [184][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 69.3 bits (168), Expect = 6e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 P P PPPP P PPPP PPPPPPP PPPPPPPP G Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 Score = 66.6 bits (161), Expect = 4e-09 Identities = 28/47 (59%), Positives = 28/47 (59%) Frame = -1 Query: 267 GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 G P P P PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 65.9 bits (159), Expect = 7e-09 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PP PPP PPPPPPP PPPPPPPP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 4/46 (8%) Frame = -1 Query: 210 PPPPYPPPPPPY----PPPPPPPYPPPPPPPPLGRD*ASFTVILRP 85 PPPP PPPPPP PPPPPPP PPPPPPPP + T +RP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRP 545 Score = 62.4 bits (150), Expect = 8e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPP PPPPPP PPPPPPP PPPPPP P Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 60.1 bits (144), Expect = 4e-07 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 P P P PP PPPPPP PPPPPPP PPPP P P+ Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPI 539 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/42 (59%), Positives = 25/42 (59%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PPPP PPPPPP PPPPPPP P P P P Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 [185][TOP] >UniRef100_B3TLV7 Adenine phosphoribosyltransferase 1 n=1 Tax=Elaeis guineensis RepID=B3TLV7_ELAGV Length = 181 Score = 69.3 bits (168), Expect = 6e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVEG 399 GGTLCAA++LLERVG +V +CACVIELPE KG KL + +F+LV+G Sbjct: 135 GGTLCAAVRLLERVGADVVECACVIELPELKGREKLGHRPVFVLVKG 181 [186][TOP] >UniRef100_A5BI88 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BI88_VITVI Length = 246 Score = 69.3 bits (168), Expect = 6e-10 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTLCAAIKLLERVG V +CACVI LPE KG +L GK L+ILVE Sbjct: 159 GGTLCAAIKLLERVGAEVVECACVIGLPEAKGQCRLNGKPLYILVE 204 [187][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 69.3 bits (168), Expect = 6e-10 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPP+ Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPI 75 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 66.2 bits (160), Expect = 5e-09 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P V PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PEVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.5 bits (132), Expect = 9e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PG P +P PPPP PPPPPPP PPPPPPPP Sbjct: 27 PGIPKKDWKPEVTAVNPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.5 bits (132), Expect = 9e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPP 142 +P P PPPP PPPPPP PPPPPPP PPP Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [188][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 69.3 bits (168), Expect = 6e-10 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTVIL 91 PPPP PPPPPP PPPPPPP PPPPPPPP SF +L Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRFVL 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [189][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 69.3 bits (168), Expect = 6e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 PPPP PPPPPP PPPPPPP PPPPPPPP R+ Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQRE 109 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 [190][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 69.3 bits (168), Expect = 6e-10 Identities = 29/42 (69%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = -1 Query: 243 CSPGDPLVLER---PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 C P P V + PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 24 CVPFLPFVCQCLCCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPAP 68 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -1 Query: 243 CSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPLG 121 C P P PPPP PPPPPP PPPPPPP P P P+G Sbjct: 37 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAPYVYPRRPIG 77 [191][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 69.3 bits (168), Expect = 6e-10 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 P P + PPPP PPPPPP PPPPPPP PPPPPPP Sbjct: 343 PPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 66.2 bits (160), Expect = 5e-09 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPP 133 P+ P P PPPP PPPPPP PPPPPPP PPPPPP Sbjct: 339 PHPRPPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 4/33 (12%) Frame = -1 Query: 213 RPPPP----YPPPPPPYPPPPPPPYPPPPPPPP 127 RPP P PPPPPP PPPPPPP PPPPPPPP Sbjct: 342 RPPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 56.2 bits (134), Expect = 6e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPASTKP 383 Score = 56.2 bits (134), Expect = 6e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PP PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPASTKPP 384 [192][TOP] >UniRef100_Q7UA83 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 8102 RepID=Q7UA83_SYNPX Length = 214 Score = 68.9 bits (167), Expect = 8e-10 Identities = 39/87 (44%), Positives = 51/87 (58%), Gaps = 17/87 (19%) Frame = +2 Query: 44 DFEVDGIDKLDIVDGRNITVNEAQSR---PRGGGGG----------GGGYGGGGG----G 172 D ++G+ +++ GR + +N+A+ R PRGGGGG GGGYGGGGG G Sbjct: 56 DAAIEGLQGAELM-GRPLRINKAEPRGSAPRGGGGGYRGGGGGYGGGGGYGGGGGRDGGG 114 Query: 173 GYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GYGGGGGGY GGG G G ++ G Sbjct: 115 GYGGGGGGYRGGGGGYGGGGGGGRDGG 141 Score = 59.7 bits (143), Expect = 5e-07 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 7/52 (13%) Frame = +2 Query: 125 RGGGGGGGGYGGG---GGGGYGGGGGGYGGGGRS--RTSGSPGLQE--FGTR 259 RGGGGG GG GGG GGGGYGGGGGGY GGG + R SG+ G ++ +G R Sbjct: 124 RGGGGGYGGGGGGGRDGGGGYGGGGGGYRGGGDAGDRPSGARGWEDRSYGAR 175 [193][TOP] >UniRef100_B6UB95 Glycine-rich RNA-binding protein 7 n=1 Tax=Zea mays RepID=B6UB95_MAIZE Length = 252 Score = 68.9 bits (167), Expect = 8e-10 Identities = 34/55 (61%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRG--GGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 +DGR+I VN A + G GGGG GG G GGGGGYGGGGGGYGGGG G G Sbjct: 96 LDGRSIRVNHANEKTGGFRGGGGYGGGGYGGGGGYGGGGGGYGGGGGYGGGGGGG 150 [194][TOP] >UniRef100_Q9GP44 NONA protein (Fragment) n=1 Tax=Drosophila virilis RepID=Q9GP44_DROVI Length = 165 Score = 68.9 bits (167), Expect = 8e-10 Identities = 32/45 (71%), Positives = 33/45 (73%) Frame = +2 Query: 104 NEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 N+A GGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 62 NQAFRARGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 116 [195][TOP] >UniRef100_Q95UX4 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX4_DROVI Length = 163 Score = 68.9 bits (167), Expect = 8e-10 Identities = 32/45 (71%), Positives = 33/45 (73%) Frame = +2 Query: 104 NEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 N+A GGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 60 NQAFRARGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 104 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 114 [196][TOP] >UniRef100_Q95UX1 No on or off transient A (Fragment) n=1 Tax=Drosophila americana americana RepID=Q95UX1_DROAE Length = 165 Score = 68.9 bits (167), Expect = 8e-10 Identities = 31/40 (77%), Positives = 31/40 (77%) Frame = +2 Query: 119 RPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 R RGGGGGGGG GGGGGGG GGGG G GGGGR R GS G Sbjct: 68 RARGGGGGGGGGGGGGGGGGGGGGAGGGGGGRDRNRGSRG 107 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 7/41 (17%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGG-------YGGGGRSRTSG 229 GGGGGGGG GGGGGGG GGGGGG GGGG + SG Sbjct: 76 GGGGGGGGGGGGGGGGAGGGGGGRDRNRGSRGGGGGGQNSG 116 [197][TOP] >UniRef100_Q95NR6 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NR6_DROVI Length = 165 Score = 68.9 bits (167), Expect = 8e-10 Identities = 32/45 (71%), Positives = 33/45 (73%) Frame = +2 Query: 104 NEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 N+A GGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 62 NQAFRARGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 116 [198][TOP] >UniRef100_B7PWI8 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PWI8_IXOSC Length = 117 Score = 68.9 bits (167), Expect = 8e-10 Identities = 33/50 (66%), Positives = 33/50 (66%) Frame = +2 Query: 89 RNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 R NEA SR GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 41 RQYVANEAGSRRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 74 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 76 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 77 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 78 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 79 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 80 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGG G G Sbjct: 81 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 [199][TOP] >UniRef100_C3PP34 Actin polymerization protein RickA n=1 Tax=Rickettsia africae ESF-5 RepID=C3PP34_RICAE Length = 500 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -1 Query: 249 NSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 N+ +P PL PP PPPPPP PPPPPPP PPPPPPPP Sbjct: 318 NNITPPSPLSENNIPPSPPPPPPPPPPPPPPPSPPPPPPPP 358 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 264 STLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPP 133 S L N+ P P PPPP PPPPPP P PPPPP PPP P Sbjct: 324 SPLSENNIPPSPP-----PPPPPPPPPPPPPSPPPPPPPPPMAP 362 [200][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 68.9 bits (167), Expect = 8e-10 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPP+ Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPV 499 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.8 bits (133), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPVETSP 503 Score = 55.5 bits (132), Expect = 9e-06 Identities = 23/42 (54%), Positives = 25/42 (59%) Frame = -1 Query: 249 NSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 + SP P PPPP PPPPPP PPPPPPP PP P + Sbjct: 464 HDASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVETSPKI 505 [201][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTV 97 PPPP PPPPPP PPPPPPP PPPPPPPP + F V Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAYEAREFIV 297 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 [202][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 68.9 bits (167), Expect = 8e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 SP P PPPP PPPPP PPPPPPP PPPPPPPP Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 67.0 bits (162), Expect = 3e-09 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ PPPP PPPPPP PPPPP P PPPPPPPP Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 252 Score = 65.9 bits (159), Expect = 7e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 65.5 bits (158), Expect = 9e-09 Identities = 30/52 (57%), Positives = 31/52 (59%), Gaps = 5/52 (9%) Frame = -1 Query: 267 GSTLVPNSCSPGDPLVLERP-----PPPYPPPPPPYPPPPPPPYPPPPPPPP 127 G P S P +RP PPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 200 GGPTFPTPVSAPPPPFRDRPVASPSPPPPPPPPPP-PPPPPPPSPPPPPPPP 250 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -1 Query: 246 SCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 S SP P PPPP PPP PP PPPPPPP PPPPPPP Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/42 (61%), Positives = 27/42 (64%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPP PPPPPPP PPPP PPP Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPP---PPPPLG 121 P P PPPP PPPPPP PPPPPPP PPPP PPPP G Sbjct: 234 PPPPPPPPSPPPPPPPPPPP-PPPPPPPSPPPPSPNPPPPKG 274 [203][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 68.9 bits (167), Expect = 8e-10 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPPP+ Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPV 75 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 65.5 bits (158), Expect = 9e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P PP PPPPPP PPPPPPP PPPPPPPP Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPP L Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPVKL 77 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P V P P PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PEVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 56.2 bits (134), Expect = 6e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPP 142 +P P PPPP PPPPPP PPPPPPP PPP Sbjct: 42 NPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [204][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 68.9 bits (167), Expect = 8e-10 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 P P + P PP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPL 146 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -1 Query: 246 SCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 S +P DP P P PPPPPP PPPPPPP PPPPPPPP Sbjct: 105 SHAPPDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPP 144 [205][TOP] >UniRef100_UPI00016C4475 putative RNA-binding protein n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C4475 Length = 113 Score = 68.6 bits (166), Expect = 1e-09 Identities = 40/73 (54%), Positives = 47/73 (64%), Gaps = 7/73 (9%) Frame = +2 Query: 62 IDKLD--IVDGRNITVNEAQSRPRGGGG----GGGGYGGGGGGGYGGGGGG-YGGGGRSR 220 ID L+ +++GR +TVN A+ R GGGG GGGGYGGGGGG GGGGGG YGGGG Sbjct: 40 IDALNNQLMNGRPLTVNIAKPREGGGGGRGGGGGGGYGGGGGGRRGGGGGGGYGGGGGGY 99 Query: 221 TSGSPGLQEFGTR 259 G G + G R Sbjct: 100 GGGYGGGGDRGDR 112 [206][TOP] >UniRef100_Q0IBB2 Putative RNA-binding protein n=1 Tax=Synechococcus sp. CC9311 RepID=Q0IBB2_SYNS3 Length = 126 Score = 68.6 bits (166), Expect = 1e-09 Identities = 38/63 (60%), Positives = 40/63 (63%), Gaps = 3/63 (4%) Frame = +2 Query: 50 EVDGIDKLDIVD--GRNITVNEAQSRPR-GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSR 220 E ID L V+ GR I VN+A R R GGGGGGGG GG GGGG GGGGGYGGGG Sbjct: 55 EQKAIDDLQNVEWMGRMIRVNKATPRERTGGGGGGGGRGGYGGGGGNGGGGGYGGGGGGN 114 Query: 221 TSG 229 G Sbjct: 115 GGG 117 [207][TOP] >UniRef100_A4CWS8 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 7805 RepID=A4CWS8_SYNPV Length = 197 Score = 68.6 bits (166), Expect = 1e-09 Identities = 35/56 (62%), Positives = 39/56 (69%), Gaps = 5/56 (8%) Frame = +2 Query: 86 GRNITVNEAQSRPRGG----GGGGGGYGGGGGGGYGGGGGG-YGGGGRSRTSGSPG 238 GR + +N+A+ PRG GGGGGGYGGGGGGGYGGGGGG YGGGG G G Sbjct: 69 GRPLRINKAE--PRGSAPRRGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGYRGGGG 122 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 6/45 (13%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGGGGYG------GGGRSRTSGSPGLQE 247 GGGGGGGYGGGGGGGY GGGGGY GGG R SG+ G ++ Sbjct: 102 GGGGGGGYGGGGGGGYRGGGGGYNDGGGGYGGGGERRSGARGWED 146 [208][TOP] >UniRef100_B6SIF0 Glycine-rich RNA-binding protein 2 n=1 Tax=Zea mays RepID=B6SIF0_MAIZE Length = 156 Score = 68.6 bits (166), Expect = 1e-09 Identities = 39/69 (56%), Positives = 44/69 (63%), Gaps = 7/69 (10%) Frame = +2 Query: 32 YRHMDFEVDGIDKLD--IVDGRNITVNEAQSRP---RGGGG-GGGGYGGGGGGGYGG-GG 190 Y D + I +D +DGR + VN A RP RGGGG GGGGYGGGG GG GG GG Sbjct: 85 YSDSDAAKEAISAMDGKEIDGRQVRVNMANERPAGNRGGGGYGGGGYGGGGYGGGGGYGG 144 Query: 191 GGYGGGGRS 217 GGYGGG +S Sbjct: 145 GGYGGGSQS 153 [209][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 68.6 bits (166), Expect = 1e-09 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GG GGGGGYGGGGGGGYGGGGGGYGGGG G G Sbjct: 103 GGYGGGGGYGGGGGGGYGGGGGGYGGGGGGYGGGGGG 139 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +2 Query: 56 DGIDKLDIVDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSP 235 DGI+ G+ + V + R G GGGGGG+GGGGGG +GGGGGGYGGGG G Sbjct: 63 DGIE----FQGQRLRVEVSHGRRGGAGGGGGGFGGGGGG-FGGGGGGYGGGGGYGGGGGG 117 Query: 236 G 238 G Sbjct: 118 G 118 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/42 (69%), Positives = 29/42 (69%), Gaps = 6/42 (14%) Frame = +2 Query: 131 GGGGGGGYGGGGGG------GYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGYGGGGGG GYGGGGGGYGGGG G G Sbjct: 112 GGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGSGGGGGG 153 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/38 (73%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +2 Query: 128 GGGGGGGGYG-GGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GG GGGGG G GGGGGGYGGGGGGYGGGG G G Sbjct: 109 GGYGGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 146 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/40 (70%), Positives = 29/40 (72%), Gaps = 6/40 (15%) Frame = +2 Query: 128 GGGGGGGGYGGGGGG------GYGGGGGGYGGGGRSRTSG 229 G GGGGGGYGGGGGG GYGGGGGG GGGG R+ G Sbjct: 118 GYGGGGGGYGGGGGGYGGGGGGYGGGGGGSGGGGGGRSLG 157 [210][TOP] >UniRef100_Q9VX67 CG5172, isoform D n=1 Tax=Drosophila melanogaster RepID=Q9VX67_DROME Length = 172 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/40 (75%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGG---GYGGGGRSRTSGSPG 238 GGGGGGGGYGGGGGGGYGGGGG GYGGGG+ G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHG 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 7/40 (17%) Frame = +2 Query: 131 GGGGGGGYGGGGGG--GYGG-----GGGGYGGGGRSRTSG 229 GGGGGGGYGGGGGG GYGG GGGG+GGGG+ G Sbjct: 33 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 [211][TOP] >UniRef100_Q8MYW0 RH06401p n=1 Tax=Drosophila melanogaster RepID=Q8MYW0_DROME Length = 93 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/40 (75%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGG---GYGGGGRSRTSGSPG 238 GGGGGGGGYGGGGGGGYGGGGG GYGGGG+ G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHG 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 7/40 (17%) Frame = +2 Query: 131 GGGGGGGYGGGGGG--GYGG-----GGGGYGGGGRSRTSG 229 GGGGGGGYGGGGGG GYGG GGGG+GGGG+ G Sbjct: 33 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 [212][TOP] >UniRef100_Q7KUW8 CG5172, isoform C n=1 Tax=Drosophila melanogaster RepID=Q7KUW8_DROME Length = 106 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/40 (75%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGG---GYGGGGRSRTSGSPG 238 GGGGGGGGYGGGGGGGYGGGGG GYGGGG+ G G Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHG 63 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 7/40 (17%) Frame = +2 Query: 131 GGGGGGGYGGGGGG--GYGG-----GGGGYGGGGRSRTSG 229 GGGGGGGYGGGGGG GYGG GGGG+GGGG+ G Sbjct: 33 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 72 [213][TOP] >UniRef100_A9YI01 CG5172-PA (Fragment) n=1 Tax=Drosophila melanogaster RepID=A9YI01_DROME Length = 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/40 (75%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGG---GYGGGGRSRTSGSPG 238 GGGGGGGGYGGGGGGGYGGGGG GYGGGG+ G G Sbjct: 5 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHG 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 7/40 (17%) Frame = +2 Query: 131 GGGGGGGYGGGGGG--GYGG-----GGGGYGGGGRSRTSG 229 GGGGGGGYGGGGGG GYGG GGGG+GGGG+ G Sbjct: 14 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 53 [214][TOP] >UniRef100_A9YHZ8 CG5172-PA (Fragment) n=2 Tax=Drosophila melanogaster RepID=A9YHZ8_DROME Length = 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/40 (75%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGG---GYGGGGRSRTSGSPG 238 GGGGGGGGYGGGGGGGYGGGGG GYGGGG+ G G Sbjct: 5 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHG 44 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 7/40 (17%) Frame = +2 Query: 131 GGGGGGGYGGGGGG--GYGG-----GGGGYGGGGRSRTSG 229 GGGGGGGYGGGGGG GYGG GGGG+GGGG+ G Sbjct: 14 GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGG 53 [215][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPFQP 264 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPP PP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPFQPP 265 Score = 57.0 bits (136), Expect = 3e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -1 Query: 198 YPPPPPPYPPPPPPPYPPPPPPPP 127 + PPPPP PPPPPPP PPPPPPPP Sbjct: 230 FAPPPPPPPPPPPPPPPPPPPPPP 253 [216][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 679 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 680 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 681 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 657 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 Score = 66.6 bits (161), Expect = 4e-09 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 240 SPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPP 130 S G P PPPP PPPPPP PPPPPPP PPPPPPP Sbjct: 648 SVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 Score = 65.5 bits (158), Expect = 9e-09 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD 115 PPPP PPPPPP PPPPPPP PPPPPP L D Sbjct: 659 PPPPPPPPPPPPPPPPPPPPPPPPPPDVLAAD 690 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -1 Query: 231 DPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 D + + P PPPPPP PPPPPPP PPPPPPPP Sbjct: 642 DDVAVRSVGAPPPPPPPPPPPPPPPPPPPPPPPPP 676 [217][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [218][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 68.6 bits (166), Expect = 1e-09 Identities = 27/42 (64%), Positives = 29/42 (69%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P+ PPPP PPPPPP PP PPPP PPPPPPPP Sbjct: 237 PSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/40 (67%), Positives = 27/40 (67%) Frame = -1 Query: 246 SCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 S P P RPPPP PPPPP PPPPPPP PPPP PPP Sbjct: 229 SSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPP 268 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/40 (70%), Positives = 28/40 (70%) Frame = -1 Query: 246 SCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 S SP P PPPP PPPPPP PPPPP P PPPPPPPP Sbjct: 236 SPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 67.0 bits (162), Expect = 3e-09 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP P PPPPP PPPPPPPPL Sbjct: 252 PPPPPPPPPPPPPSPPPPPPPPPPPPPPL 280 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/47 (59%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = -1 Query: 252 PNSCSPGDPLVLERP----PPPYPPPPP-PYPPPPPPPYPPPPPPPP 127 P S P P P P P PPPPP P PPPPPPP PPPPPPPP Sbjct: 218 PPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPP 264 Score = 59.3 bits (142), Expect = 7e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPP P PPPPPPP PPPP PPL Sbjct: 256 PPPPPPPPPSPPPPPPPPPPPPPPLLPPL 284 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -1 Query: 255 VPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +P P P PPPP PPPPPP PPPPPPP PP PP P Sbjct: 246 MPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFP 288 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPP--PPPPP 127 P P P PPPP PPP PP PPPPPPP PPP PP PP Sbjct: 243 PPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 56.2 bits (134), Expect = 6e-06 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 14/65 (21%) Frame = -1 Query: 279 CST*GSTLVPNSCSPGDPLVLERPPPPYPPPPP--------------PYPPPPPPPYPPP 142 C+T L P S P P V RPPP PPPPP P PPP PPP PPP Sbjct: 196 CATCIEGLYP-SPPPVTPAV-RRPPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPP 253 Query: 141 PPPPP 127 PPPPP Sbjct: 254 PPPPP 258 [219][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 68.6 bits (166), Expect = 1e-09 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPPPP PPP PPPP Sbjct: 213 PSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 65.9 bits (159), Expect = 7e-09 Identities = 28/51 (54%), Positives = 30/51 (58%) Frame = -1 Query: 279 CST*GSTLVPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 C T ++ P P P P PP PP PPP PPPPPPP PPPPPPPP Sbjct: 196 CPTSRASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P P PPPP PP PPP PPPPPPP PPPPP PP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPP 258 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPP PPPPP P PPPPPPPP Sbjct: 212 PPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P SP P PP P PPPPPP PP PPPP PPPPPP P Sbjct: 210 PPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPP PPPPP P PPP PPPP Sbjct: 219 PSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P+ P P PPPP PPPPPP PPPPP P PP PP PP Sbjct: 225 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPP 266 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 P SP P PP P PPPPPP PP PPPP PPPP PPL Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPL 264 Score = 55.8 bits (133), Expect = 7e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -1 Query: 237 PGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 P P PPPP PPPPP PPPP PP P PP PPP Sbjct: 231 PPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 [220][TOP] >UniRef100_C6SZ96 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ96_SOYBN Length = 184 Score = 68.6 bits (166), Expect = 1e-09 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTLCAA+ LLERVG V +CACVIELPE KG +L GK L++LVE Sbjct: 135 GGTLCAAMDLLERVGAEVVECACVIELPELKGRERLNGKPLYVLVE 180 [221][TOP] >UniRef100_Q5CLH8 Protease n=1 Tax=Cryptosporidium hominis RepID=Q5CLH8_CRYHO Length = 1569 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/46 (65%), Positives = 31/46 (67%), Gaps = 4/46 (8%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPP----PYPPPPPPPYPPPPPPPP 127 P+S SP P PPPP PPPPP P PPPPPPP PPPPPPPP Sbjct: 1527 PSSSSPSPP-----PPPPPPPPPPSSSSPSPPPPPPPLPPPPPPPP 1567 [222][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 67.0 bits (162), Expect = 3e-09 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPP L Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPQL 84 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGR 118 PPPP PPPPPP PPPPPPP PPPP GR Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPQLCCFGR 89 [223][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 66.6 bits (161), Expect = 4e-09 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPL 124 PPPP PPPPPP PPPPPPP PPPPPPP L Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPRL 100 [224][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 [225][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 67.0 bits (162), Expect = 3e-09 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASF 103 PPPP PPPPPP PPPPPPP PPPPPPP R +F Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAF 53 [226][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 [227][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 68.6 bits (166), Expect = 1e-09 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 PPPP PPPPPP PPPPPPP PPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [228][TOP] >UniRef100_A7RNZ0 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RNZ0_NEMVE Length = 370 Score = 68.6 bits (166), Expect = 1e-09 Identities = 31/52 (59%), Positives = 31/52 (59%), Gaps = 10/52 (19%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPP-------YPPPPPPYP---PPPPPPYPPPPPPPP 127 P CS P PPPP YPPPPPPYP PPPPPP PPPPPPPP Sbjct: 282 PAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPPP 333 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -1 Query: 252 PNSCSPGDPLVLERPPPPYPPPPPPYPPP-PPPPYPPPPPP 133 P + P P P PPYPPPPPPYP P P PPYPPPP P Sbjct: 244 PYTPYPPPPYPNPYPQPPYPPPPPPYPNPYPQPPYPPPPAP 284 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 5/33 (15%) Frame = -1 Query: 210 PPPPYPPP--PPPYPPPPPP---PYPPPPPPPP 127 PPPPYP P PPYPPPPPP PYP PP PPP Sbjct: 249 PPPPYPNPYPQPPYPPPPPPYPNPYPQPPYPPP 281 Score = 55.8 bits (133), Expect = 7e-06 Identities = 29/61 (47%), Positives = 29/61 (47%), Gaps = 24/61 (39%) Frame = -1 Query: 237 PGDPLVLERPPPPYP----------------PPPPPYP-----PPPPPPYP---PPPPPP 130 P P P PPYP PPPPPYP PPPPPPYP PPPPPP Sbjct: 265 PPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPP 324 Query: 129 P 127 P Sbjct: 325 P 325 Score = 55.8 bits (133), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = -1 Query: 210 PPPPYP-----PPPPPYPPPPPPPYPPPPPPP 130 PPPPYP PPPPP PPPPPPPYP P P P Sbjct: 310 PPPPYPEQVPPPPPPPPPPPPPPPYPYPYPYP 341 [229][TOP] >UniRef100_B9EP65 Cold-inducible RNA-binding protein n=1 Tax=Salmo salar RepID=B9EP65_SALSA Length = 131 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/54 (66%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = +2 Query: 80 VDGRNITVNEA-QSRPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 +DGR I VNEA Q RGGGGGGG G GGGGYGGGGG GGGGRS S G Sbjct: 71 LDGRTIRVNEAGQGGGRGGGGGGGFRGSRGGGGYGGGGGYGGGGGRSDGGYSSG 124 [230][TOP] >UniRef100_Q7V3Q7 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus subsp. pastoris str. CCMP1986 RepID=Q7V3Q7_PROMP Length = 221 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/71 (52%), Positives = 46/71 (64%), Gaps = 9/71 (12%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRP------RGGGGGGGGYGGGG-GGGYGGG--GGGYGG 205 +DG+ +++ GR + +N+A+ R RGGGGG GGYGGGG GGGYGGG GGGYGG Sbjct: 80 IDGLQGTELM-GRPLRINKAEPRGGGGGPRRGGGGGRGGYGGGGNGGGYGGGGNGGGYGG 138 Query: 206 GGRSRTSGSPG 238 GG G G Sbjct: 139 GGNGGGYGGGG 149 Score = 59.7 bits (143), Expect = 5e-07 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 11/51 (21%) Frame = +2 Query: 128 GGGGGGGGYGGGG-GGGYGGGG-GGYGGGGR---------SRTSGSPGLQE 247 GGGG GGGYGGGG GGGYGGGG GGYGGGG +++SG+ G ++ Sbjct: 137 GGGGNGGGYGGGGNGGGYGGGGRGGYGGGGNYSEPASSYVNKSSGAEGWED 187 [231][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 131 GGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGYGGGGGGG GGGGGG+GGGGR G G Sbjct: 55 GGGGGGGYGGGGGGGRGGGGGGFGGGGRGGVGGGGG 90 Score = 62.4 bits (150), Expect = 8e-08 Identities = 29/40 (72%), Positives = 29/40 (72%), Gaps = 2/40 (5%) Frame = +2 Query: 125 RGGGGGGGGYGGGGGGGY--GGGGGGYGGGGRSRTSGSPG 238 RG GGGGGGYGGGGGGG GGGGGGYGGGG G G Sbjct: 36 RGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGGGGG 75 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 30/41 (73%), Gaps = 3/41 (7%) Frame = +2 Query: 125 RGGGGGGGGYG-GGGGGGYGGGGGG--YGGGGRSRTSGSPG 238 RGGGGGGGG G GGGGGGYGGGGGG YGGGG G G Sbjct: 27 RGGGGGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGG 67 [232][TOP] >UniRef100_A7PDA4 Chromosome chr17 scaffold_12, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PDA4_VITVI Length = 277 Score = 68.2 bits (165), Expect = 1e-09 Identities = 39/71 (54%), Positives = 43/71 (60%), Gaps = 9/71 (12%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGG-GGGGGYGGGGGG----GYGGGG----GGYGG 205 + +D D+ GR + VN A R R GG GGGGGYGGGGGG GYGGGG GGYGG Sbjct: 98 IQALDGQDL-HGRRVRVNYATDRARSGGFGGGGGYGGGGGGYGGGGYGGGGYGGSGGYGG 156 Query: 206 GGRSRTSGSPG 238 GG SG G Sbjct: 157 GGYGGGSGGYG 167 [233][TOP] >UniRef100_A5B074 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B074_VITVI Length = 272 Score = 68.2 bits (165), Expect = 1e-09 Identities = 39/71 (54%), Positives = 43/71 (60%), Gaps = 9/71 (12%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSRPRGGG-GGGGGYGGGGGG----GYGGGG----GGYGG 205 + +D D+ GR + VN A R R GG GGGGGYGGGGGG GYGGGG GGYGG Sbjct: 98 IQALDGQDL-HGRRVRVNYATDRARSGGFGGGGGYGGGGGGYGGGGYGGGGYGGSGGYGG 156 Query: 206 GGRSRTSGSPG 238 GG SG G Sbjct: 157 GGYGGGSGGYG 167 [234][TOP] >UniRef100_Q9SVM8 Glycine-rich RNA-binding protein 2, mitochondrial n=1 Tax=Arabidopsis thaliana RepID=GRP2_ARATH Length = 158 Score = 68.2 bits (165), Expect = 1e-09 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 9/63 (14%) Frame = +2 Query: 50 EVDGIDKLDIVDGRNITVNEAQSRPR-------GGG--GGGGGYGGGGGGGYGGGGGGYG 202 E+DG + ++GR+I VN A RP GGG GGGGGYGGGGGG YGGGGGGYG Sbjct: 95 EMDGKE----LNGRHIRVNPANDRPSAPRAYGGGGGYSGGGGGYGGGGGG-YGGGGGGYG 149 Query: 203 GGG 211 GGG Sbjct: 150 GGG 152 [235][TOP] >UniRef100_A9P1W9 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9P1W9_PICSI Length = 182 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTL AA++LLERVG V +CACVIELPE KG +L GK LFILVE Sbjct: 135 GGTLSAAMRLLERVGAEVVECACVIELPELKGRERLGGKPLFILVE 180 [236][TOP] >UniRef100_A9NUD5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NUD5_PICSI Length = 182 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTL AA++LLERVG V +CACVIELPE KG +L GK LFILVE Sbjct: 135 GGTLSAAMRLLERVGAEVVECACVIELPELKGRERLGGKPLFILVE 180 [237][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 5/67 (7%) Frame = +2 Query: 53 VDGIDKLDIVDGRNITVNEAQSR---PRGGGGGGGGYGGGGGGGY--GGGGGGYGGGGRS 217 ++G+ +++ GR + +N+A+ R PR GGGGGG GGGGGGGY GGGGGGYGGGG Sbjct: 59 IEGLQGAELM-GRPLRINKAEPRGSAPRRGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGG 117 Query: 218 RTSGSPG 238 G G Sbjct: 118 GGYGGGG 124 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQE--FGTR 259 GGG GGGG GGG GGG GGGG G GGGG R SG+ G ++ +G R Sbjct: 108 GGGYGGGGGGGGYGGGGGGGGYGGGGGGGDRPSGARGWEDRSYGAR 153 [238][TOP] >UniRef100_Q3EA40 Putative uncharacterized protein At4g13850.2 n=1 Tax=Arabidopsis thaliana RepID=Q3EA40_ARATH Length = 153 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = +2 Query: 50 EVDGIDKLDIVDGRNITVNEAQSRP---RGGGGGGGGYGGGGGGGYGGGGGGYGGGG 211 E+DG + ++GR+I VN A RP R GGGGG GGGGGGYGGGGGGYGGGG Sbjct: 95 EMDGKE----LNGRHIRVNPANDRPSAPRAYGGGGGYSYGGGGGGYGGGGGGYGGGG 147 [239][TOP] >UniRef100_C6SV67 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SV67_SOYBN Length = 156 Score = 67.8 bits (164), Expect = 2e-09 Identities = 36/56 (64%), Positives = 38/56 (67%), Gaps = 3/56 (5%) Frame = +2 Query: 80 VDGRNITVNEAQSRPRGGGGGGGGYGGGGGGGYGGGGGGYGG---GGRSRTSGSPG 238 +DGRNITVNEAQSR G GGGGGGYG GGG GG GGYGG G +R G G Sbjct: 74 LDGRNITVNEAQSR-GGRGGGGGGYGSGGGYNRSGGTGGYGGRREGAYNRNGGGYG 128 [240][TOP] >UniRef100_Q95UX3 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX3_DROVI Length = 161 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = +2 Query: 119 RPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 R RGGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 64 RARGGGGGGGG-GGGGGGGGGGGGGGGGGGGRDRNRGSRG 102 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 112 [241][TOP] >UniRef100_Q95UX2 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX2_DROVI Length = 165 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 106 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 116 [242][TOP] >UniRef100_Q95UW8 No on or off transient A (Fragment) n=1 Tax=Drosophila americana texana RepID=Q95UW8_DROAE Length = 168 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = +2 Query: 119 RPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 R RGGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 72 RARGGGGGGGG-GGGGGGGGGGGGGGGGGGGRDRNRGSRG 110 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 7/41 (17%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGG-------YGGGGRSRTSG 229 GGGGGGGG GGGGGGG GGGGGG GGGG + SG Sbjct: 79 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGQNSG 119 [243][TOP] >UniRef100_Q95UW1 No on or off transient A (Fragment) n=1 Tax=Drosophila kanekoi RepID=Q95UW1_DROKA Length = 159 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = +2 Query: 119 RPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 R RGGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 62 RARGGGGGGGG-GGGGGGGGGGGGGGGGGGGRDRNRGSRG 100 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGCGGQNSG 110 [244][TOP] >UniRef100_Q95NU6 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NU6_DROVI Length = 163 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = +2 Query: 119 RPRGGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 R RGGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 66 RARGGGGGGGG-GGGGGGGGGGGGGGGGGGGRDRNRGSRG 104 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 114 [245][TOP] >UniRef100_B4M1S7 NonA n=1 Tax=Drosophila virilis RepID=B4M1S7_DROVI Length = 699 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPG 238 GGGGGGGG GGGGGGG GGGGGG GGGGR R GS G Sbjct: 199 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRG 235 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +2 Query: 128 GGGGGGGGYGGGGGGGYGGGGGGYGGGGRSRTSGSPGLQEFG 253 GGGGGGGG GGGGGGG GGGGGG SR G G Q G Sbjct: 204 GGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 245 [246][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/40 (72%), Positives = 30/40 (75%), Gaps = 2/40 (5%) Frame = -1 Query: 237 PGDPLVLERPP--PPYPPPPPPYPPPPPPPYPPPPPPPPL 124 P PL +PP PP PPPPPP PPPPPPP PPPPPPPPL Sbjct: 413 PFAPLPQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPL 452 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/54 (57%), Positives = 33/54 (61%) Frame = -1 Query: 210 PPPPYPPPPPPYPPPPPPPYPPPPPPPPLGRD*ASFTVILRPSTISSLSIPSTS 49 PPPP PPPPPP PPPPPPP PPPPPPP L P +ISS +P S Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPP--------PPPSISSFLVPPQS 470 Score = 64.7 bits (156), Expect = 2e-08 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 2/36 (5%) Frame = -1 Query: 228 PLVLERPPPPYPPPPPPYPPPPPPPYPPP--PPPPP 127 PL PPPP PPPPPP PPPPPPP PPP PPPPP Sbjct: 423 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPP 458 Score = 60.5 bits (145), Expect = 3e-07 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -1 Query: 216 ERPPPPYPPPPPPYPPPPPPPYPPPPPP 133 + PPPP PPPPPP PPPPPPP PPP PP Sbjct: 144 QTPPPPPPPPPPPPPPPPPPPPPPPKPP 171 Score = 60.1 bits (144), Expect = 4e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -1 Query: 207 PPPYPPPPPPYPPPPPPPYPPPPPPP 130 PPP PPPPPP PPPPPPP PPPP PP Sbjct: 146 PPPPPPPPPPPPPPPPPPPPPPPKPP 171 Score = 60.1 bits (144), Expect = 4e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -1 Query: 204 PPYPPPPPPYPPPPPPPYPPPPPPPP 127 PP PPPPPP PPPPPPP PPPPP PP Sbjct: 146 PPPPPPPPPPPPPPPPPPPPPPPKPP 171 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -1 Query: 255 VPNSCSPGDPLVLERPPPPYPPPPPPYPPPPPPPYPPPPPPPP 127 +P S P + P P PP PP PPPPPPP PPPPPPPP Sbjct: 401 LPQFYSQSQPSLPFAPLPQIQPPLPPPPPPPPPPPPPPPPPPP 443 [247][TOP] >UniRef100_Q9SUW2 Adenine phosphoribosyltransferase (EC 2.4.2.7)-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9SUW2_ARATH Length = 183 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTLCAAI LLERVG V +CACVIELPE KG +L GK L +LVE Sbjct: 136 GGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVE 181 [248][TOP] >UniRef100_Q8LG17 Adenine phosphoribosyltransferase-like protein n=1 Tax=Arabidopsis thaliana RepID=Q8LG17_ARATH Length = 183 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTLCAAI LLERVG V +CACVIELPE KG +L GK L +LVE Sbjct: 136 GGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLVE 181 [249][TOP] >UniRef100_Q8H534 Os07g0484800 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q8H534_ORYSJ Length = 187 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVE 396 GGTLCAAI LLER G V +CACVIELPE KG +L GK L++LVE Sbjct: 139 GGTLCAAIVLLERAGAEVVECACVIELPELKGRERLNGKPLYVLVE 184 [250][TOP] >UniRef100_B6U1A1 Adenine phosphoribosyltransferase 1 n=1 Tax=Zea mays RepID=B6U1A1_MAIZE Length = 180 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +1 Query: 259 GGTLCAAIKLLERVGVNVADCACVIELPEFKGIVKLAGKSLFILVEGD 402 GGTLCAA+KL+ERVG V +CACVIEL E KG KL + +F+LVE D Sbjct: 132 GGTLCAAVKLIERVGAKVVECACVIELAELKGRDKLGDRPVFVLVEAD 179