[UP]
[1][TOP] >UniRef100_B9GZA9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GZA9_POPTR Length = 91 Score = 92.8 bits (229), Expect = 1e-17 Identities = 43/77 (55%), Positives = 49/77 (63%), Gaps = 9/77 (11%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPP---------PPPPPPPNYHCHHVQHHCHDHNESSDFGSFF 63 P P PPP +PPP P PPPP PPPPPPP+ H +HV+H DH SS SF Sbjct: 14 PPPYPPPDFQPPPVPAPPPPGYQSYFYEGPPPPPPPS-HAYHVRH---DHGGSSGCCSFL 69 Query: 62 QGCLTALCCCCVLDECC 12 +GCL ALCCCCV +ECC Sbjct: 70 RGCLAALCCCCVWEECC 86 [2][TOP] >UniRef100_C6T2Z6 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T2Z6_SOYBN Length = 118 Score = 92.0 bits (227), Expect = 2e-17 Identities = 44/84 (52%), Positives = 50/84 (59%), Gaps = 14/84 (16%) Frame = -2 Query: 218 FPLPTPPPA--PKPPPCPEPPPP------------PPPPPPPNYHCHHVQHHCHDHNESS 81 +P P PPP PPP P PP PPPPPPP+YH HV HH H H+E Sbjct: 37 YPPPPPPPGYGGYPPPHPPQHPPYDSYQGYFDNGRPPPPPPPHYHYQHVDHH-HLHDEPG 95 Query: 80 DFGSFFQGCLTALCCCCVLDECCF 9 F SF +GC+ ALCCCCVL+ECCF Sbjct: 96 CF-SFLRGCIAALCCCCVLEECCF 118 [3][TOP] >UniRef100_B9RH08 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RH08_RICCO Length = 118 Score = 88.2 bits (217), Expect = 3e-16 Identities = 40/79 (50%), Positives = 45/79 (56%), Gaps = 14/79 (17%) Frame = -2 Query: 203 PPPAPKPPPCPE--------------PPPPPPPPPPPNYHCHHVQHHCHDHNESSDFGSF 66 PPP PPP P PPPPP P PP +H +H +HH H + + SF Sbjct: 41 PPPGYPPPPGPRQQYEGYQGYFAEGYPPPPPRPGPPQYHHQYHYEHH-HYQDNTGGCTSF 99 Query: 65 FQGCLTALCCCCVLDECCF 9 FQGCL ALCCCCVLDECCF Sbjct: 100 FQGCLAALCCCCVLDECCF 118 [4][TOP] >UniRef100_B9GMR1 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9GMR1_POPTR Length = 80 Score = 86.7 bits (213), Expect = 7e-16 Identities = 42/81 (51%), Positives = 46/81 (56%), Gaps = 12/81 (14%) Frame = -2 Query: 218 FPLPTPP-PAPKPPPCPEPPPP-----------PPPPPPPNYHCHHVQHHCHDHNESSDF 75 FP P PP P P PPP P PPPP PPPPPP H Q HDH++SS Sbjct: 1 FPPPPPPVPPPPPPPVPAPPPPGYQSYFYDPVPQPPPPPP-----HTQLVHHDHDDSSGC 55 Query: 74 GSFFQGCLTALCCCCVLDECC 12 SF + CL LCCCCVL+ECC Sbjct: 56 CSFLRECLACLCCCCVLEECC 76 [5][TOP] >UniRef100_B8B948 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B948_ORYSI Length = 120 Score = 86.7 bits (213), Expect = 7e-16 Identities = 39/80 (48%), Positives = 43/80 (53%), Gaps = 15/80 (18%) Frame = -2 Query: 203 PPPAPKPPPCPEPPP---------------PPPPPPPPNYHCHHVQHHCHDHNESSDFGS 69 PP P PPP PPP PPPPPPPP HCHH HC D + Sbjct: 47 PPQGPYPPPHQPPPPGYQGYFNQGQQPYYPPPPPPPPPYDHCHH---HCGDEGSGA---G 100 Query: 68 FFQGCLTALCCCCVLDECCF 9 F +GCL ALCCCC+L+ECCF Sbjct: 101 FLKGCLAALCCCCLLEECCF 120 [6][TOP] >UniRef100_A9P8I3 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8I3_POPTR Length = 125 Score = 81.6 bits (200), Expect = 2e-14 Identities = 39/83 (46%), Positives = 45/83 (54%), Gaps = 18/83 (21%) Frame = -2 Query: 203 PPPAPKPP-----PCPEPP-----------PPPPPPPPPNYH--CHHVQHHCHDHNESSD 78 PPP PP P P PP PPPPPPP P + C+H +HH H + Sbjct: 46 PPPGAPPPGYSGYPPPGPPRGYQGYFAEGYPPPPPPPGPQQYQECYHYEHH---HYQDDG 102 Query: 77 FGSFFQGCLTALCCCCVLDECCF 9 SF +GCL ALCCCCVL+ECCF Sbjct: 103 CSSFLRGCLAALCCCCVLEECCF 125 [7][TOP] >UniRef100_Q9LPW8 F13K23.6 protein n=1 Tax=Arabidopsis thaliana RepID=Q9LPW8_ARATH Length = 198 Score = 81.3 bits (199), Expect = 3e-14 Identities = 43/89 (48%), Positives = 46/89 (51%), Gaps = 24/89 (26%) Frame = -2 Query: 203 PPPAPK---PPPCPEPPP------------------PPPPPPPPNY-HCHHVQHHCHDHN 90 PPP P PPP P PPPPPPP NY HCHH HH D Sbjct: 114 PPPQPYGGYPPPSSRPYEGGYQGYFAGGGYPHQHHGPPPPPPPQNYDHCHHDHHHYQD-- 171 Query: 89 ESSDFG--SFFQGCLTALCCCCVLDECCF 9 SD G SF +GCL ALCCCC+L+ECCF Sbjct: 172 --SDSGCFSFIRGCLAALCCCCLLEECCF 198 [8][TOP] >UniRef100_Q940Z6 At1g12810/F13K23_4 n=1 Tax=Arabidopsis thaliana RepID=Q940Z6_ARATH Length = 129 Score = 81.3 bits (199), Expect = 3e-14 Identities = 43/89 (48%), Positives = 46/89 (51%), Gaps = 24/89 (26%) Frame = -2 Query: 203 PPPAPK---PPPCPEPPP------------------PPPPPPPPNY-HCHHVQHHCHDHN 90 PPP P PPP P PPPPPPP NY HCHH HH D Sbjct: 45 PPPQPYGGYPPPSSRPYEGGYQGYFAGGGYPHQHHGPPPPPPPQNYDHCHHDHHHYQD-- 102 Query: 89 ESSDFG--SFFQGCLTALCCCCVLDECCF 9 SD G SF +GCL ALCCCC+L+ECCF Sbjct: 103 --SDSGCFSFIRGCLAALCCCCLLEECCF 129 [9][TOP] >UniRef100_C5YHP3 Putative uncharacterized protein Sb07g025930 n=1 Tax=Sorghum bicolor RepID=C5YHP3_SORBI Length = 110 Score = 80.1 bits (196), Expect = 7e-14 Identities = 42/91 (46%), Positives = 47/91 (51%), Gaps = 22/91 (24%) Frame = -2 Query: 218 FPLPTPPPAPKPPPC----PEPPPPP-----PPP--PPPNY---------HCHHVQHHCH 99 +P P PP PPP P PPPPP PPP PPP Y H + Q H H Sbjct: 17 YPRPPPPDVYPPPPWGHGHPPPPPPPQGPYYPPPQHPPPGYQGYFNDPPPHGEYQQQHHH 76 Query: 98 DHNE--SSDFGSFFQGCLTALCCCCVLDECC 12 +H SS F +GCL ALCCCCVL+ECC Sbjct: 77 NHGNQGSSSSSGFLKGCLAALCCCCVLEECC 107 [10][TOP] >UniRef100_B9N0V9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0V9_POPTR Length = 143 Score = 79.3 bits (194), Expect = 1e-13 Identities = 38/80 (47%), Positives = 42/80 (52%), Gaps = 15/80 (18%) Frame = -2 Query: 203 PPPAPKPPPCPEPPPP--------------PPPPPPPNYH-CHHVQHHCHDHNESSDFGS 69 PPP P PP P PPP P PP PP Y C H +HH + N S Sbjct: 65 PPPGPPPPGYPGYPPPGPPRGYQGYFAEGYPTPPGPPQYQQCCHYEHHPYQDNYGG-CSS 123 Query: 68 FFQGCLTALCCCCVLDECCF 9 F +GCL ALCCCCVL+ECCF Sbjct: 124 FLRGCLAALCCCCVLEECCF 143 [11][TOP] >UniRef100_UPI0001984A01 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984A01 Length = 115 Score = 78.6 bits (192), Expect = 2e-13 Identities = 40/96 (41%), Positives = 50/96 (52%), Gaps = 25/96 (26%) Frame = -2 Query: 221 PFPLPTP-PPAPKPPP--CPEPP-----PPPPPPPPPNYHCH-----------------H 117 P+P P+ P AP PPP CP PP PPPPPPP P Y + + Sbjct: 19 PYPPPSGYPSAPPPPPPGCPPPPGYPGYPPPPPPPGPPYQGYQGYFNEGYPPPPPPPQQY 78 Query: 116 VQHHCHDHNESSDFGSFFQGCLTALCCCCVLDECCF 9 Q+ + + + S SF GCL ALCCCC+L+ECCF Sbjct: 79 QQYQQYQYQDQSGPSSFLPGCLAALCCCCLLEECCF 114 [12][TOP] >UniRef100_B9RFX3 DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RFX3_RICCO Length = 92 Score = 77.8 bits (190), Expect = 3e-13 Identities = 36/77 (46%), Positives = 43/77 (55%), Gaps = 8/77 (10%) Frame = -2 Query: 221 PFPLPT-PPPAPKPPPCPEPPP-------PPPPPPPPNYHCHHVQHHCHDHNESSDFGSF 66 P+P P PPP P PPP P PPP PPPPPPPP + + S SF Sbjct: 22 PYPPPGYPPPPPYPPPPPPPPPYYQDYFYPPPPPPPPQ----------DNRQDDSGCSSF 71 Query: 65 FQGCLTALCCCCVLDEC 15 +GCL ALCCCC+++EC Sbjct: 72 LKGCLAALCCCCLMEEC 88 [13][TOP] >UniRef100_Q6Z1G1 Os08g0536400 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z1G1_ORYSJ Length = 117 Score = 77.4 bits (189), Expect = 4e-13 Identities = 37/78 (47%), Positives = 42/78 (53%), Gaps = 13/78 (16%) Frame = -2 Query: 203 PPPAPKPPPCPEPPPPP-------------PPPPPPNYHCHHVQHHCHDHNESSDFGSFF 63 PP P PPP +PPPP PPPP P HCHH HC D + F Sbjct: 47 PPQGPYPPP-HQPPPPGYQGYFNQGQQPYYPPPPLPYDHCHH---HCGDEGSGA---GFL 99 Query: 62 QGCLTALCCCCVLDECCF 9 +GCL ALCCCC+L+ECCF Sbjct: 100 KGCLAALCCCCLLEECCF 117 [14][TOP] >UniRef100_A7QUR5 Chromosome chr1 scaffold_180, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QUR5_VITVI Length = 99 Score = 72.0 bits (175), Expect = 2e-11 Identities = 35/84 (41%), Positives = 41/84 (48%), Gaps = 14/84 (16%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQ----------HHCHDHNESSDFG 72 PFP PPP P P PPPPPP P P Y + + H H + DF Sbjct: 16 PFPSAVPPPG-FPYDAPPPPPPPPSRPGPGYQDYFTEGYNQPPQPTYEHTHHYRYGDDFR 74 Query: 71 ----SFFQGCLTALCCCCVLDECC 12 SF +GC ALCCCC+L+ECC Sbjct: 75 GRCWSFCRGCCAALCCCCMLEECC 98 [15][TOP] >UniRef100_C5X5A6 Putative uncharacterized protein Sb02g029510 n=1 Tax=Sorghum bicolor RepID=C5X5A6_SORBI Length = 113 Score = 71.6 bits (174), Expect = 2e-11 Identities = 38/93 (40%), Positives = 43/93 (46%), Gaps = 25/93 (26%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPP---------------PPPPNYHCHHVQHHCHD----- 96 P P P P+ P P P PPPP PPP + H HH HH HD Sbjct: 18 PYPPPQAPPQGPFYPPPQQPPPPGYQGYFNNGQQPYGYPPPRDGHHHHGHHHHHDDHHHH 77 Query: 95 ----HNESSDFG-SFFQGCLTALCCCCVLDECC 12 H+E D F +G L ALCCCC+LDECC Sbjct: 78 HHHHHHEDDDCCLGFLKGWLAALCCCCMLDECC 110 [16][TOP] >UniRef100_Q8LG30 Adhesive/proline-rich-like protein n=1 Tax=Arabidopsis thaliana RepID=Q8LG30_ARATH Length = 76 Score = 67.8 bits (164), Expect = 4e-10 Identities = 30/69 (43%), Positives = 34/69 (49%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTALC 39 +P PPP PP PPPPPPPPPPP F +G L ALC Sbjct: 16 YPQGPPPPVGVPPQYYPPPPPPPPPPPPPRKV-----------------GFLEGLLAALC 58 Query: 38 CCCVLDECC 12 CCC++DECC Sbjct: 59 CCCLVDECC 67 [17][TOP] >UniRef100_B6TAP4 Rhodopsin-like receptor n=1 Tax=Zea mays RepID=B6TAP4_MAIZE Length = 115 Score = 67.0 bits (162), Expect = 6e-10 Identities = 35/94 (37%), Positives = 43/94 (45%), Gaps = 24/94 (25%) Frame = -2 Query: 221 PFPLP-TPPPAPKPPPCPEPPP-----------PPPPPPPP------------NYHCHHV 114 P+P P PP P PP +PPP P PPP ++H HH Sbjct: 18 PYPPPQAPPQGPYYPPPQQPPPGYQGYFNDGQQPYGYPPPQGGYYHHGHHHHNDHHHHHH 77 Query: 113 QHHCHDHNESSDFGSFFQGCLTALCCCCVLDECC 12 HH H H + F +G L ALCCCC++DECC Sbjct: 78 GHHHHHHEDDDCCLGFLKGWLAALCCCCMMDECC 111 [18][TOP] >UniRef100_Q0J0G9 Os09g0510000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0J0G9_ORYSJ Length = 121 Score = 64.3 bits (155), Expect = 4e-09 Identities = 35/97 (36%), Positives = 39/97 (40%), Gaps = 29/97 (29%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPP-----------PPNY-------------HCHHVQH 108 P P PP + PP PPP PPP PP Y H HH H Sbjct: 21 PYPPPPSGGQYPPTQYYPPPNQPPPGYQGYFSEGQQPPYYYPPPHDPHHHHGHHHHHEDH 80 Query: 107 HCHDHNESSDFGS-----FFQGCLTALCCCCVLDECC 12 H H H+ F +G L LCCCCVL+ECC Sbjct: 81 HHHGHHHHGHHDDDCCLGFLRGWLAILCCCCVLEECC 117 [19][TOP] >UniRef100_Q0DU86 Os03g0200400 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0DU86_ORYSJ Length = 142 Score = 63.5 bits (153), Expect = 7e-09 Identities = 33/70 (47%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPP-PPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTA 45 P+P P P P PPP PPP PPPPPP+ H + SF QGCL A Sbjct: 88 PYP-PPPQPYGYPPPQMYPPPYAQPPPPPPHRH---------------ERPSFCQGCLAA 131 Query: 44 LCCCCVLDEC 15 LCCCC+LD C Sbjct: 132 LCCCCLLDVC 141 [20][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPPCP PPPPPPPPPPP Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPPPPP 317 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPPCP PPPPPPP PPP Sbjct: 303 PCPPPPPPPPPPPPPCPPPPPPPPPCPPP 331 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 252 PCPPPCPPPCPPPPPPPPPPPPPPPPPPP 280 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPPCP PPPP PPPPPP C Sbjct: 272 PPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPC 304 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = -2 Query: 221 PFPLPTPP-PAPKPPPCPEPPPPPPPPPPP 135 P P P PP P P PPPCP PPPPPPPPPPP Sbjct: 245 PCPPPPPPCPPPCPPPCPPPPPPPPPPPPP 274 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 254 PPPCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 256 PCPPPCPPPPPPPPPPPPPPPPPPPPPCP 284 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 258 PPPCPPPPPPPPPPPPPPPPPPPPPCPPP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPPCP P PPPPPP PP Sbjct: 268 PPPPPPPPPPPPPPPCPPPCPPPPPPCPP 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPPCP P PPP PPPPP Sbjct: 317 PCPPPPPPPPPCPPPCPPPCPPPCPPPPP 345 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPPPPPP Sbjct: 248 PPPPPCPPPCPPPCPPPPPPPPPPPPPPP 276 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -2 Query: 221 PFPLPTPPPAPKPPP-CPEPPPPPPPPPPP 135 P P P PPP P PPP CP PPPPPPP PPP Sbjct: 278 PPPPPCPPPCPPPPPPCPPPPPPPPPCPPP 307 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = -2 Query: 221 PFPLPTPPPAPK-PPPCPEP-PPPPPPPPPP 135 P P P PPP P PPPCP P PPPPPPPPPP Sbjct: 241 PAPPPCPPPPPPCPPPCPPPCPPPPPPPPPP 271 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 250 PPPCPPPCPPPCPPPPPPPPPPPPPPPPP 278 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 293 PCPPPPPPPPPCPPPPPPPPPPPPPCPPP 321 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 301 PPPCPPPPPPPPPPPPPCPPPPPPPPPCP 329 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 5/34 (14%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP-----PPPPPP 135 P P P PPP P PPP P PPPPP PPPPPP Sbjct: 260 PCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPP 293 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 5/34 (14%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEP-----PPPPPPPPPP 135 P P P PPP P PPPCP P PPP PPPPPP Sbjct: 313 PPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPP 346 [21][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 62.4 bits (150), Expect = 1e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PPP P+PPP P PPPPPPPPPPP Sbjct: 15 PPPLPPPPPPPRPPPPPPPPPPPPPPPPP 43 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PLPPPPPPPRPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPRPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 23 PPPRPPPPPPPPPPPPPPPPPPPPPPPLP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 LP P P P PPP P PPPPPPPPPPP Sbjct: 14 LPPPLPPPPPPPRPPPPPPPPPPPPP 39 [22][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 62.4 bits (150), Expect = 1e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPPPPN Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPN 138 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P PPP P PPP P PPPPPPPPPPP+ Sbjct: 97 PPPPPPPPPPPPPSPPPPPPPPPPPPPS 124 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+P PPP P PPP P PPPPPPPPPP Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPPPPPP 120 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP PPPPPPPPPPP Sbjct: 94 PVPPPPPPPPPPPPPPSPPPPPPPPPPPP 122 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPP 148 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPP PPPPP Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P P PPPPPPPPP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PP PPPPPPPP Sbjct: 90 PPPPPVPPPPPPPPPPPPPPSPPPPPPPP 118 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 99 PPPPPPPPPPPSPPPPPPPPPPPPPSPPP 127 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPP PPPPP Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P P PPPPPPPPP Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPPPPPP 147 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P+PPP P PP P PPPPPPPPPPP+ Sbjct: 83 PSPSPPPPPPPPVPPPPPPPPPPPPPPS 110 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 113 PPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPP PPPP Sbjct: 88 PPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPP---PPPN 132 P P P PPP P PPP P PPPPPPPP PPP+ Sbjct: 123 PSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPS 155 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PFP P+PPP PPP P PP PPPP PPP Sbjct: 235 PFPPPSPPPPRPPPPAPPPPRPPPPSPPP 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PLP P P PPP P PPPPPPPPPPP Sbjct: 80 PLPPSPSPPPPPPPPVPPPPPPPPPPP 106 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPP P Sbjct: 83 PSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111 [23][TOP] >UniRef100_B9MZR3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZR3_POPTR Length = 256 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G+G Sbjct: 112 GGGGGGGIGGGSGHGGGFGAGGGVGGGHG 140 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 78 GGGGGGGVGGGSGHGGGFGAGGGVGGGLG 106 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 185 GGGGGGGIGGGSGHGGGFGAGGGVGGGAG 213 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = +1 Query: 136 GGGGGGGG--GGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 150 GGGGGGGGCVGGGSGHGGGFGAGGGVGGGLG 180 [24][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/61 (45%), Positives = 30/61 (49%), Gaps = 12/61 (19%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP------------NYHCHHVQHHCHDHNESSD 78 P P P PPP P PPP P PPPPPPPPPPP H H+V + H S Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCNLWDVGANTKHSHNVAEYAGGHGSSIP 76 Query: 77 F 75 F Sbjct: 77 F 77 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [25][TOP] >UniRef100_B3M2B3 GF17078 n=1 Tax=Drosophila ananassae RepID=B3M2B3_DROAN Length = 599 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHH 105 P PPP P PPP P PPPPPPPPPPP HH HH Sbjct: 157 PPPPPPPPPPPPPPPPPPPPPPPPP----HHPHHH 187 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYH 126 P P PPP P PPP P PPPPPPPP P++H Sbjct: 158 PPPPPPPPPPPPPPPPPPPPPPPPHHPHHH 187 [26][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PPP P PPP P PPPPPPPPPPP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYH 126 P PLP PP P PPP P PPPPPPPPPPP H Sbjct: 672 PPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP PPP P PPPPPPPPPPP Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPP 253 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPP PP Sbjct: 677 PSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP PPP P PPPPPPPPPPP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPP 259 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PPPPPPPPPPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP+P PPP P PPPPPPPPPPP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PPPPPPPPPPP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPP PPPP+ Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPPPPS 708 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PPPPPPPPPPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PPPPPPPPPPP Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPP PP+ Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PPPPPPPPPPP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PP PPPPPPPP Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 [27][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPPPPN Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPPP N Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPLPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPLPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 [28][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYH 126 P P P PPP P PPP P PPPPPPPPPPP+ H Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTH 532 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCH 120 P P P PPP P PPP P PPPPPPPPPPP H Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTH 532 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 L PPP P PPP P PPPPPPPPPPP Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPP 511 [29][TOP] >UniRef100_A7SGL4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SGL4_NEMVE Length = 620 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPPCP P PPPPPPPPP+ Sbjct: 425 PVPCPPPPPPPPPPPCPVPCPPPPPPPPPS 454 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P+P P PP+P PPPCP P PPPPPPPPP Sbjct: 409 PYPAPYTPPSPPPPPCPVPCPPPPPPPPP 437 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P+ P+PPP P P PCP PPPPPPPPP P Sbjct: 413 PYTPPSPPPPPCPVPCPPPPPPPPPPPCP 441 [30][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PPP P PPP P PPPPPPPPPPP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPP 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPP PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PP PPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 [31][TOP] >UniRef100_P09789 Glycine-rich cell wall structural protein 1 n=1 Tax=Petunia x hybrida RepID=GRP1_PETHY Length = 384 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 176 GGGGGGGVGGGSGHGGGFGAGGGVGGGAG 204 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 298 GGGGGGGVGGGSGHGGGFGAGGGVGGGAG 326 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSG 216 GGGGGGG GGGSGHGGGFGAGGGVG G Sbjct: 260 GGGGGGGLGGGSGHGGGFGAGGGVGGG 286 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 G GGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 218 GSGGGGGIGGGSGHGGGFGAGGGVGGGVG 246 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 G GGGGG GGG+G GGGFGAGGGVG G G Sbjct: 136 GAGGGGGVGGGAGSGGGFGAGGGVGGGAG 164 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +1 Query: 133 LGGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 LGGGGGGG GGG G GGG G+GGG G+G G Sbjct: 129 LGGGGGGGAGGGGGVGGGAGSGGGFGAGGG 158 [32][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPPPPN Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPPP N Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 [33][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPPPPN Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPPP N Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPNN 68 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 [34][TOP] >UniRef100_Q8H776 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana RepID=Q8H776_ARATH Length = 163 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 101 GGGGGGGIGGGSGHGGGFGAGGGVGGGAG 129 [35][TOP] >UniRef100_B9MZR2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZR2_POPTR Length = 150 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 79 GGGGGGGIGGGSGHGGGFGAGGGVGGGAG 107 [36][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPPP Y Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAY 290 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F P PPP P PPP P PPPPPPPPPPP Sbjct: 256 FASPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 54.3 bits (129), Expect = 4e-06 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 + +PPP P PPP P PPPPPPPPPPP Sbjct: 254 YSFASPPPPPPPPPPPPPPPPPPPPPPP 281 [37][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPPPPPPPP+ Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPS 276 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP+P PPP P PPPPPPPPPPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPPPPPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPPPPPPPP Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 273 PPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P PPP P PPP P PPPPPPPPPPP Y Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPVY 304 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 275 PSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P P P P PPPPPPPPPPP Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPP PP Sbjct: 224 PSPPPPPPPSPPPSPPPPPPPPPPSPP 250 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPP PPPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PP PPPPPPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP PPPPPPPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPPPPPP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PPPPPPPPPPP Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP+P PPP P PP PPP PPPP Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPP 256 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP PP PPPPPPPP Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPP 260 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P PLP PP P PP P PPPPPPPPPP+ Sbjct: 219 PSPLPPSPPPPPPPSPPPSPPPPPPPPPPS 248 [38][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPP P PPPPPPPPPPP C Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPC 119 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPP P PPPPPPPPPPP C Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTC 117 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P PPP P PPP P PPPPPPPPPPP Sbjct: 76 IPPPPPPPPPPPPPPPPPPPPPPPPP 101 [39][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPP P PPPPPPPPPPP C Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLCC 86 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPP P PPPPPPPPPPP C Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQLC 85 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 [40][TOP] >UniRef100_B9SFQ6 Glycine-rich cell wall structural protein 1, putative n=1 Tax=Ricinus communis RepID=B9SFQ6_RICCO Length = 313 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 112 GGGGGGGIGGGSGHGGGFGAGGGVGGGVG 140 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 155 GGGGGGGIGGGSGHGGGFGAGGGVGGGLG 183 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 197 GGGGGGGIGGGSGHGGGFGAGGGVGGGIG 225 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGG+G G G Sbjct: 238 GGGGGGGVGGGSGHGGGFGAGGGLGGGAG 266 [41][TOP] >UniRef100_B9IPT3 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IPT3_POPTR Length = 186 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 38 GGGGGGGIGGGSGHGGGFGAGGGVGGGLG 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGG GGG GGGSGHGGGFGAGGGVG G G Sbjct: 110 GGGAGGGIGGGSGHGGGFGAGGGVGGGAG 138 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSG 216 G GGGGG GGGSGHGGGFGAGGGVG G Sbjct: 75 GAGGGGGIGGGSGHGGGFGAGGGVGGG 101 [42][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPPPPPP Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPP 184 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPPPPPP Sbjct: 164 PSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 162 PPPSPPPPPPPSPPPPPPPPPPPPPPPPP 190 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPPPPPPPP Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 172 PSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 170 PPPSPPPPPPPPPPPPPPPPPPPPPPPPP 198 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 174 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP+P PPP P PPPPP PPPPP+ Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPS 165 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPP PPPPP Sbjct: 150 PSPPPPPPPSPPPPPSPPPPPPPSPPPPP 178 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPP PPPPP Sbjct: 142 PPPSPPPPPSPPPPPPPSPPPPPSPPPPP 170 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPP 186 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 134 PPPSPPPPPPPSPPPPPSPPPPPPPSPPP 162 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 148 PPPSPPPPPPPSPPPPPSPPPPPPPSPPP 176 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P P PPPPPPPPP Sbjct: 154 PPPPPSPPPPPSPPPPPPPSPPPPPPPPP 182 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P P P P PPPPPPPPPPP Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPPPP 188 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 166 PPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP+P PPP P PPPPP PPPPP Sbjct: 132 PPPPPSPPPPPPPSPPPPPSPPPPP 156 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P P PPPPP PPP Sbjct: 140 PPPPPSPPPPPSPPPPPPPSPPPPPSPPP 168 [43][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 60.1 bits (144), Expect = 7e-08 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPP P PPPPPPPPPPP C Sbjct: 378 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPC 410 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPPPPPP Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPPPPPPPP Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 390 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPP 396 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 376 PPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/72 (38%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQ--HHCHDHNESSDFGSFFQGCLT 48 P P P PPP P PPP P PPPPPPPPPP C CH + ++ T Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSCGFGCHYRDRLLPTLTYPCDTCT 441 Query: 47 ALCCCCVLDECC 12 +C CC Sbjct: 442 LICLPGCEQSCC 453 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPPPP 384 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 386 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PP PPPPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPP 387 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPPP 388 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPP 389 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP PPPPPPPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPPPPPP Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PPPPPPPPPPP Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 [44][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 423 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -2 Query: 206 TPPPAPKPPPCPEPPPPPPPPPPP 135 TPPP P PPP P PPPPPPPPPPP Sbjct: 145 TPPPPPPPPPPPPPPPPPPPPPPP 168 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYH 126 P P PPP P PPP P PPPPPPP PP H Sbjct: 146 PPPPPPPPPPPPPPPPPPPPPPPKPPKTQH 175 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP--PPPPPPN 132 P P P PPP P PPP P PPPPP PPPPPP+ Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPLLPPPPPPS 460 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPP--PPP 135 P P P PPP P PPP P PPPPPPPP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPLLPPP 456 [45][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 60.1 bits (144), Expect = 7e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHV 114 P P PPP P PPP P PPPPPPPPPPP H +V Sbjct: 2801 PPPPPPPTPPPPPPPPPPPPPPPPPPPPQHSINV 2834 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PP P PPP P PPPPPPPPPPP + Sbjct: 2800 PPPPPPPPTPPPPPPPPPPPPPPPPPPPPQH 2830 [46][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPP 1501 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1503 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 1477 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 1505 [47][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 60.1 bits (144), Expect = 7e-08 Identities = 27/65 (41%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC----HHVQHHCHDHNESSDFGSFFQGCLT 48 P P PPP P PPP P PPPPPPPPPPP C + V + + N + + + +T Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPPTTPCNTGPYIVFFNWDESNITPEAATILNNAVT 281 Query: 47 ALCCC 33 A C Sbjct: 282 AYANC 286 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F PPP P PPP P PPPPPPPPPPP Sbjct: 218 FGAAPPPPPPPPPPPPPPPPPPPPPPPP 245 [48][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPPPPPP Sbjct: 503 PSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPPPPPP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P+PPP P PPP P PPPPPPPPPP Sbjct: 507 PPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P P P P PPPPPPPPPPP Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPP 515 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPPN 132 P PPP P PPP P PPP PPPPPPP+ Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPS 512 [49][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPPPPPPPP+ Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 240 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPPPPPPPP+ Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 252 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPPN 132 P PPP P PPP P PPPPPPPPPPP+ Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPS 228 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPPPP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPP 235 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPPPP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPPPP Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPP 233 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPP P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSP 229 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPP---PPP 135 P P P+PPP P PPP P PPPPPPPP PPP Sbjct: 235 PPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPP----PPPPPN 132 P P P PPP P PPP P PPPPPP PPPPP+ Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPS 270 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPP PPP Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPP PPP Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 [50][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPPPPPPPP+ Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPS 250 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP+P PPP P PPPPPPPPP P Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSP 239 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPPPP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPP 233 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+P P P PPP P PPPPPPPPPPP+ Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPS 238 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPP PPPPP Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPPPP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPPPP 245 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPP PPPPP+ Sbjct: 227 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPS 256 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P+PPP P PPP P PPPPP PPPP Sbjct: 233 PPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPP PP Sbjct: 235 PPPSPPPPPPPPPPPSPPPPPSPPPPSPP 263 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P P PPP P P P P PPPPP PPPPP Sbjct: 204 YPPPPPPPPPSPSPPPSPPPPPSPPPPP 231 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPP PPP Sbjct: 225 PSPPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPP P Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPPSP 257 [51][TOP] >UniRef100_B9RX52 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RX52_RICCO Length = 70 Score = 60.1 bits (144), Expect = 7e-08 Identities = 29/71 (40%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPP--PPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTA 45 +P P P PPP PP PPPPPP F +GCL A Sbjct: 8 YPYPPPGAYQGPPPVMAPPHYYAAPPPPPPRREV-----------------GFLEGCLAA 50 Query: 44 LCCCCVLDECC 12 LCCCC+LDECC Sbjct: 51 LCCCCLLDECC 61 [52][TOP] >UniRef100_B5DWM1 GA26446 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DWM1_DROPS Length = 580 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -2 Query: 203 PPPAPKPPPCPEPPPPPPPPPPPNYHCH 120 PPP P PPP P PPPPPPPPPPP++H H Sbjct: 141 PPPGPPPPPPPPPPPPPPPPPPPHHHHH 168 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 197 PAPKPPPCPEPPPPPPPPPPPNYHCHHVQH 108 P P PPP P PPPPPPPPPPP H HH H Sbjct: 141 PPPGPPPPPPPPPPPPPPPPPPPHHHHHPH 170 [53][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 60.1 bits (144), Expect = 7e-08 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHH 117 P P P PPP P PPP P PPPPPPPPPP HH Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHH 65 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHH 105 P P P PPP P PPP P PPPPPPPPPPP + H+ Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHN 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -2 Query: 206 TPPPAPKPPPCPEPPPPPPPPPPP 135 TPPP P PPP P PPPPPPPPPPP Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 L PPP P PPP P PPPPPPPPPPP Sbjct: 7 LTPPPPPPPPPPPPPPPPPPPPPPPP 32 [54][TOP] >UniRef100_Q0WQG4 Putative uncharacterized protein At1g05135 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q0WQG4_ARATH Length = 153 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHGGGFGAGGG+G G G Sbjct: 61 GGGGGGGVGGGSGHGGGFGAGGGLGGGAG 89 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGSGHG GFGAGGGVG G G Sbjct: 23 GGGGGGGANGGSGHGSGFGAGGGVGGGVG 51 [55][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1940 PPPPPPPPPTPAPPPTPPPPPPPPPPPPP 1968 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PTP P P PPP P PPPPPPPPPPP Sbjct: 1944 PPPPPTPAPPPTPPPPPPPPPPPPPPPPP 1972 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 1946 PPPTPAPPPTPPPPPPPPPPPPPPPPPP 1973 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 1934 PPPPPPPPPPPPPPPTPAPPPTPPPPPPP 1962 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPPPPPP Sbjct: 1938 PPPPPPPPPPPTPAPPPTPPPPPPPPPPP 1966 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPP 138 L TPPP P PPP P PPPPPPPPPP Sbjct: 3063 LQTPPPPPPPPPPPPPPPPPPPPPP 3087 [56][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPP P PPPPPPPPPPP C Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 67 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P PCP PPPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 64 PRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPP P PPPPPPPPPPP C Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPC 105 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 62 PPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P PPP P PPP P PPPPPPPPPPP Sbjct: 23 IPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P+P P P PPPPPPPPPPP Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPP 82 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPRPCPPPPPPPPP 76 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPP---PPPPPNYHC 123 P P P PPP P PPP P PPPPPP PPPPP C Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPC 114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPP---PPPP 135 P P P PPP P PPP P PPPPPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPP---PPPPP 135 P P P PPP P PPP P PPPPPP PPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPP 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP---PPPPPP 135 P P P PPP P PPP P PPPPP PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPP---PPPPPPP 135 P P P PPP P PPP P PPPP PPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPP---PPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPP 75 [57][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 235 PSPSPRPPPPPMPPPPPPPPPPPPPPPPP 263 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 250 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+P PPP P PPP P PPPP PPPPPP Sbjct: 243 PPPMPPPPPPPPPPPPPPPPPPSPPPPPP 271 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 237 PSPRPPPPPMPPPPPPPPPPPPPPPPPP 264 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PP PPPPPPPP Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPP PPPP Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP PPPPPPPPPPP Sbjct: 249 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P +P P+P+PPP P PPPPPPPPPPP Sbjct: 231 PPSSPSPSPRPPPPPMPPPPPPPPPPP 257 [58][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYH 126 P P P PPP P PPP P PPPPPPPPPPP H Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [59][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQ 111 P P P PPP P PPP P PPPPPPPPPPP + +VQ Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQ 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 [60][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYH 126 P P P PPP P PPP P PPPPPPPPPPP H Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [61][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPPP + Sbjct: 986 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPGF 1016 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 985 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1013 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P L PPP P PPP P PPPPPPPPPPP Sbjct: 980 PNGLSPPPPPPPPPPPPPPPPPPPPPPPP 1008 [62][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P PLP PPP P PPP P PPPPPPPPPP Sbjct: 375 PPPLPPPPPRPVPPPAPPPPPPPPPPPP 402 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P+P P P PPPPPPPPPPP Sbjct: 373 PPPPPLPPPPPRPVPPPAPPPPPPPPPPP 401 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P PPP P PPP P PPPPPPPPPP Sbjct: 474 PPPVPPPTPPPPPPPPPPPPPPPPPP 499 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPPAP PPP P PPPP PPPPP Sbjct: 381 PPPRPVPPPAPPPPPPPPPPPPRPPPPP 408 [63][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPAP PPP P PPP PPPPPPP Sbjct: 646 PPPAPPPPPAPPPPPAPAPPPAPPPPPPP 674 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPAP PPP P PPPPPPP PPP Sbjct: 652 PPPAPPPPPAPAPPPAPPPPPPPPPAPPP 680 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPAP PPP P PPPPP PPPPP Sbjct: 626 PPPPPPPPPAPPPPPAPPPPPPPAPPPPP 654 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPAP PPP P PPPPP PPPPP Sbjct: 632 PPPAPPPPPAPPPPPPPAPPPPPAPPPPP 660 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 620 PPPAPPPPPPPPPPPAPPPPPAPPPPPPP 648 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 618 PAPPPAPPPPPPPPPPPAPPPPPAPPPPP 646 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 666 PAPPPPPPPPPAPPPPPAPPPPPAPPPPP 694 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 624 PPPPPPPPPPPAPPPPPAPPPPPPPAPPP 652 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 7/36 (19%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPP-------PPPPPPPP 135 P P P PPPAP PPP P PPP PPPPPPPP Sbjct: 640 PAPPPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPP 675 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPAP PPP P P PPPPP PPP Sbjct: 658 PPPAPAPPPAPPPPPPPPPAPPPPPAPPP 686 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -2 Query: 221 PFPLPTP-PPAPKPPPCPEPPPPPPPPPPP 135 P P P P PPAP PPP P PPPPPPPPP P Sbjct: 607 PAPPPAPAPPAPAPPPAPPPPPPPPPPPAP 636 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPP P Sbjct: 662 PAPPPAPPPPPPPPPAPPPPPAPPPPPAP 690 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPPAP PPP P PPP PPPPP P Sbjct: 616 PAPAPPPAPPPPPPPPPPPAPPPPPAP 642 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = -2 Query: 221 PFPLPTPPPAPKPP-PCPEP-PPPPPPPPPP 135 P P P PPPAP PP P P P PPPPPPPPPP Sbjct: 603 PPPAPAPPPAPAPPAPAPPPAPPPPPPPPPP 633 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPP-------PPPPPPPPP 135 P P PPPAP PPP P PP PPPPPPPPP Sbjct: 599 PGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPP 632 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP P PPP Sbjct: 638 PPPAPPPPPPPAPPPPPAPPPPPAPAPPP 666 [64][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCHDHNESS 81 P P PPP P PPP P PPPPPPPPPPP C V + +SS Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPACDDVSFPVYFEWDSS 261 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F P PPP P PPP P PPPPPPPPPPP Sbjct: 213 FAAPPPPPPPPPPPPPPPPPPPPPPPPP 240 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 + PPP P PPP P PPPPPPPPPPP Sbjct: 211 YSFAAPPPPPPPPPPPPPPPPPPPPPPP 238 [65][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P PPP P PPP P PPPPPPPPPPP Y Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPP Y Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVY 410 [66][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 253 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP+P PPP P PPPPPPPPPP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPPP PPPP+ Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPPPPS 266 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPPPP 251 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP PPPPPPPPPPP Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 254 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPPPPPP Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPP PPPP PN Sbjct: 239 PPPSPPPPPPPPPPPPPPPPPPSPPPPSPN 268 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+PPP P PPP P PPPPP PPPPP Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPP 247 [67][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [68][TOP] >UniRef100_A5HIJ5 Cysteine protease Cp5 n=1 Tax=Actinidia deliciosa RepID=A5HIJ5_ACTDE Length = 509 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/76 (39%), Positives = 33/76 (43%), Gaps = 6/76 (7%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTAL 42 P+P P PP P PPP P PPPPPPPP P+ +C FF CL Sbjct: 371 PYPSPAVPPPPPPPPPPPSPPPPPPPPSPSPTQCGDFSYCAATETCCCIFEFFDYCLIYG 430 Query: 41 CC------CCVLDECC 12 CC CC E C Sbjct: 431 CCDYTDAVCCTGTEYC 446 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/77 (36%), Positives = 33/77 (42%), Gaps = 7/77 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTAL 42 P P P+P P PPP P PP PPPPPPPP+ + G F T Sbjct: 369 PSPYPSPAVPPPPPPPPPPPSPPPPPPPPS-------------PSPTQCGDFSYCAATET 415 Query: 41 CCC-------CVLDECC 12 CCC C++ CC Sbjct: 416 CCCIFEFFDYCLIYGCC 432 [69][TOP] >UniRef100_A2Q1A7 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=A2Q1A7_MEDTR Length = 69 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/74 (39%), Positives = 32/74 (43%), Gaps = 5/74 (6%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPP-----PPPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGC 54 +P P P PPP PP PPPPP P F +GC Sbjct: 8 YPYPAQGPYQGPPPVAAPPQYYAAPPPPPKREPG---------------------FLEGC 46 Query: 53 LTALCCCCVLDECC 12 L ALCCCC+LDECC Sbjct: 47 LAALCCCCLLDECC 60 [70][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PP P PPP P PPPPPPPPPPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPP 83 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQ 111 P P P PPP P PPP P PPPP PPPPPP+ H++ Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLHLE 116 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPP PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 [71][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 51 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P PPP P PPP P PPPPPPPPPPP Sbjct: 50 VPAPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 [72][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPPP + Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQW 100 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 206 TPPPAPKPPPCPEPPPPPPPPPPP 135 +PPP P PPP P PPPPPPPPPPP Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPP 67 [73][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P P PPP P PPP P PPPPPPPPPPP C Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPC 65 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -2 Query: 206 TPPPAPKPPPCPEPPPPPPPPPPP 135 TPPP P PPP P PPPPPPPPPPP Sbjct: 16 TPPPPPPPPPPPPPPPPPPPPPPP 39 [74][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPPPP 146 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPPPP 147 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 114 PIFTPAPPPPPPPPPPPPPPPPPPPPPPP 142 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCH 99 P P P PPP P PPP P PPPPPPPPP P + V H Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPRFTTRGVSFPPH 161 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 147 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+ TP P P PPP P PPPPPPPPPPP Sbjct: 112 PPPIFTPAPPPPPPPPPPPPPPPPPPPPP 140 [75][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P PPP+P PPP P PPPPPPPPPPP+ Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPS 277 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPP PPPPP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP+P PPP P PPPPPPPPPP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 258 PSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP PPPPPPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP P PPPPPPPPPPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPPPPPP Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+P P PPP P PPPPPPPPPPP Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPPPPPP 270 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P P P P PPPPPPPPPPP Sbjct: 246 PSPRPPSPPPPSPSPPPPPPPPPPPPPPP 274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P P P P PPPPPPPPPPP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPP 272 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPPP P PP Sbjct: 272 PPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 [76][TOP] >UniRef100_Q6Z498 Os07g0511100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z498_ORYSJ Length = 359 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGG GHGGGFGAGGGVG G G Sbjct: 138 GGGGGGGLGGGGGHGGGFGAGGGVGGGAG 166 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 G GGGGGGG G GHGGGFG G GVGSG G Sbjct: 242 GFGGGGGGGLGGGHGGGFGGGAGVGSGAG 270 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 G GGGGGGG G GHGGGFGAG GVG G G Sbjct: 314 GFGGGGGGGLGGGHGGGFGAGAGVGGGAG 342 [77][TOP] >UniRef100_B9MZQ9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MZQ9_POPTR Length = 252 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSG 216 GGGGGGG GGGSGHGGGFGAGGGVG G Sbjct: 115 GGGGGGGIGGGSGHGGGFGAGGGVGGG 141 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGGSGHG GFGAGGGVG G G Sbjct: 76 GGGGGGGVGGGSGHGEGFGAGGGVGGGLG 104 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 G GGGGG GGGSGHGGGFGAGGGVG G G Sbjct: 150 GEGGGGGLGGGSGHGGGFGAGGGVGGGAG 178 [78][TOP] >UniRef100_A2YLR5 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YLR5_ORYSI Length = 356 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 133 LGGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 LGGGGGGG GGG G GGGFGAGGGVG G+G Sbjct: 132 LGGGGGGGVGGGGGQGGGFGAGGGVGGGSG 161 [79][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P PPP P PPP P PPPPPPPPPPP C Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPPPPVVFC 169 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+ PPP P PPP P PPPPPPPPPPP Sbjct: 132 PPPMCAPPPPPPPPPPPPPPPPPPPPPPP 160 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 134 PMCAPPPPPPPPPPPPPPPPPPPPPPPPP 162 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP C PPPPPPPPPPP Sbjct: 177 PPPAPCPPPPPPPPMCLPPPPPPPPPPPP 205 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 165 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPPCP PPPPPP PPPP Sbjct: 195 PPPPPPPPPPPCPLPPPPPPCPPPP 219 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%), Gaps = 6/35 (17%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPP------PPPPPPPP 135 P P P PPP P PP CP PPP PPPPPPPP Sbjct: 114 PPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPP 148 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 10/39 (25%) Frame = -2 Query: 221 PFPLPTPPP----------APKPPPCPEPPPPPPPPPPP 135 P P P PPP AP PPP P PPPPPPPPPPP Sbjct: 118 PCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPP 156 [80][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPPP + Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPF 262 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F P PPP P PPP P PPPPPPPPPPP Sbjct: 230 FAPPPPPPPPPPPPPPPPPPPPPPPPPP 257 [81][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPPPP+ Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPD 685 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 680 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 681 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 [82][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPPP + Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAF 338 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F P PPP P PPP P PPPPPPPPPPP Sbjct: 303 FASPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 54.3 bits (129), Expect = 4e-06 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 + +PPP P PPP P PPPPPPPPPPP Sbjct: 301 YSFASPPPPPPPPPPPPPPPPPPPPPPP 328 [83][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P+P PPP P PPP P PPPPPPPPPPP Sbjct: 213 PVPPPPPPPPPPPPPPPPPPPPPPPPP 239 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F P PPP P PPP P PPPPPPPPPPP Sbjct: 210 FGAPVPPPPPPPPPPPPPPPPPPPPPPP 237 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 213 PVPPPPPPPPPPPPPPPPPPPPPPPPPP 240 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPP P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPAP 242 [84][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/65 (44%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHC-HDHNES---SDFGSFFQGCLT 48 P P PPP P PPP P PPPPPPPPPPP C+ + D +ES +D + +T Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNTGPYIVFFDFDESVITADAATILDNAVT 284 Query: 47 ALCCC 33 A C Sbjct: 285 AYANC 289 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 224 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 252 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 253 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 [85][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHV 114 P P P PPP P PPP P PPPPPPPPPPP H+ Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHL 111 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 [86][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P LP PP P PPP P PPPPPPPPPPP Sbjct: 20 PHLLPPRPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 99 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPP PPPP N Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPLPPPPRN 104 [87][TOP] >UniRef100_Q0U2K7 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0U2K7_PHANO Length = 390 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P PAP PPP P PPPPPPPPPPP Sbjct: 141 PSPAPAPVPAPPPPPPPPPPPPPPPPPPP 169 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P+P PPP P PPP P PPPPPPPP P+ Sbjct: 145 PAPVPAPPPPPPPPPPPPPPPPPPPPSGPS 174 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P P P P PPP P PPPPPPPPPP Sbjct: 143 PAPAPVPAPPPPPPPPPPPPPPPPPPPP 170 [88][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPPP + Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPF 300 [89][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P+PPP P PPPPPPPPPPP Sbjct: 331 PVSAPPPPPPPRPPPPPPPPPPPPPPPPP 359 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 335 PPPPPPPRPPPPPPPPPPPPPPPPPPP 361 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P PPP P+PPP P PPPPPPPPP Sbjct: 778 PVSAPPPPPPPRPPPPPPPPPPPPPPP 804 [90][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 882 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 883 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPP 879 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPP--PPP 135 P P P PPP P PPP P PPPPPPPP PPP Sbjct: 937 PPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPP--PPPPP 135 P P P PPP P PPP P PPPPPP PPPPP Sbjct: 939 PPPPPPPPPPPPPPPPPPPPPPPPGAPPPPP 969 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP--PPPPPP 135 P P P PPP P PPP P PPPPP PPPPPP Sbjct: 940 PPPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970 [91][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 LP PPP P PPP P PPPPPPPPPPP Sbjct: 2 LPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [92][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 262 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P PPP P PPP P PPPPPPPPPPP Sbjct: 233 VPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 257 PPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPP PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPP PPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPP PPPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PP PPPPPPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 [93][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1437 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 1425 PPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPP PP Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P T PP P PPP P PPPPPPPPPPP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPP 1430 [94][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPP PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 [95][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 206 TPPPAPKPPPCPEPPPPPPPPPPP 135 +PPP P PPP P PPPPPPPPPPP Sbjct: 467 SPPPPPPPPPPPPPPPPPPPPPPP 490 [96][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPPPPPP P+ Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 [97][TOP] >UniRef100_B9F962 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9F962_ORYSJ Length = 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/78 (43%), Positives = 37/78 (47%), Gaps = 11/78 (14%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPP----PP----PPP---PPPPNYHCHHVQHHCHDHNESSDFGS 69 P PPPA PP PP PP PPP PPPP HH S S Sbjct: 24 PAGYPPPAQGYPPQGYPPQQGYPPQQGYPPPYAQPPPPQQQQHH-----------SSGPS 72 Query: 68 FFQGCLTALCCCCVLDEC 15 F +GCL ALCCCC+L+ C Sbjct: 73 FMEGCLAALCCCCLLEAC 90 [98][TOP] >UniRef100_Q75KQ4 Os03g0431100 protein n=2 Tax=Oryza sativa RepID=Q75KQ4_ORYSJ Length = 98 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/78 (43%), Positives = 37/78 (47%), Gaps = 11/78 (14%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPP----PP----PPP---PPPPNYHCHHVQHHCHDHNESSDFGS 69 P PPPA PP PP PP PPP PPPP HH S S Sbjct: 31 PAGYPPPAQGYPPQGYPPQQGYPPQQGYPPPYAQPPPPQQQQHH-----------SSGPS 79 Query: 68 FFQGCLTALCCCCVLDEC 15 F +GCL ALCCCC+L+ C Sbjct: 80 FMEGCLAALCCCCLLEAC 97 [99][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPP P Y Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPPPVPGY 119 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -2 Query: 206 TPPPAPKPPPCPEPPPPPPPPPPP 135 TPPP P PPP P PPPPPPPPPPP Sbjct: 71 TPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 L PPP P PPP P PPPPPPPPPPP Sbjct: 70 LTPPPPPPPPPPPPPPPPPPPPPPPP 95 [100][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [101][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [102][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPP ++ Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPQSF 58 [103][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [104][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [105][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 [106][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P PPP P PPP P PPPPPPPPPPP Sbjct: 2 VPPPPPPPPPPPPPPPPPPPPPPPPP 27 [107][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [108][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [109][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 + TPPP P PPP P PPPPPPPPPPP Sbjct: 73 MTTPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P + T PP P PPP P PPPPPPPPPPP Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPP 97 [110][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPPPP Y Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPAPY 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP P PPP P PPPPPPPP P Y Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPAPYVY 71 [111][TOP] >UniRef100_UPI0001796908 PREDICTED: zinc finger homeobox 4 n=1 Tax=Equus caballus RepID=UPI0001796908 Length = 3574 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 PL PPP P PPP P PPPPPPPPPPP+ Sbjct: 1993 PLQAPPPTPPPPPPPPPPPPPPPPPPPS 2020 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PTPPP P PPP P PPPPPPP PP Sbjct: 1997 PPPTPPPPPPPPPPPPPPPPPPPSAPP 2023 [112][TOP] >UniRef100_UPI00001809D7 UPI00001809D7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI00001809D7 Length = 3593 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 PL PPP P PPP P PPPPPPPPPPP+ Sbjct: 2014 PLQAPPPTPPPPPPPPPPPPPPPPPPPS 2041 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PTPPP P PPP P PPPPPPP PP Sbjct: 2018 PPPTPPPPPPPPPPPPPPPPPPPSAPP 2044 [113][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PPP P PPP P PPPPPPP PPP Sbjct: 79 PPPLPPPPPLPPPPPLPPPPPPPPPLPPP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 89 PPPPPLPPPPPPPPPLPPPPPLPPPPPPP 117 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPP PP Sbjct: 93 PLPPPPPPPPPLPPPPPLPPPPPPPPLPP 121 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 77 PPPPPLPPPPPLPPPPPLPPPPPPPPPLP 105 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PPP P PPP P P PPPPP PPP Sbjct: 85 PPPLPPPPPLPPPPPPPPPLPPPPPLPPP 113 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P PPP P PPP P PPP PPPPPPP Sbjct: 76 VPPPPPLPPPPPLPPPPPLPPPPPPP 101 [114][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 232 PAPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 232 PAPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPP P PPPPPPPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F P PP P PPP P PPPPPPPPPPP Sbjct: 228 FAAPPAPPPPPPPPPPPPPPPPPPPPPP 255 [115][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 62 PTPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P P PPP P PPP P PPPPPPPPP Sbjct: 62 PTPPPPPPPPPPPPPPPPPPPPPPPPP 88 [116][TOP] >UniRef100_Q7DLN2 Pistil extensin like protein, partial CDS only (Fragment) n=1 Tax=Nicotiana tabacum RepID=Q7DLN2_TOBAC Length = 171 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/67 (40%), Positives = 33/67 (49%), Gaps = 5/67 (7%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP-----PPPPPPNYHCHHVQHHCHDHNESSDFGSFFQG 57 P P P+PPP P+P PCP PPPPP P PPPP+ C +ES+ + F Sbjct: 50 PRPCPSPPPPPRPRPCPSPPPPPQPRPRPSPPPPSPPPPAPSSSCSASDESNIYRCMFNE 109 Query: 56 CLTALCC 36 CC Sbjct: 110 TKIDPCC 116 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/34 (61%), Positives = 23/34 (67%), Gaps = 5/34 (14%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP-----PPPPPP 135 P P P+PPP P+P PCP PPPPP P PPPP Sbjct: 38 PRPCPSPPPPPRPRPCPSPPPPPRPRPCPSPPPP 71 [117][TOP] >UniRef100_Q08198 Cysteine-rich extensin-like protein n=1 Tax=Nicotiana tabacum RepID=Q08198_TOBAC Length = 161 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/34 (64%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP-PPPPPPNYHC 123 P+P P+PPP P P PCP PPPPP PPPP P+ C Sbjct: 55 PWPCPSPPPPPPPRPCPPPPPPPCPPPPAPSSSC 88 [118][TOP] >UniRef100_Q08194 Cysteine-rich extensin-like protein-1 n=1 Tax=Nicotiana tabacum RepID=Q08194_TOBAC Length = 209 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/67 (40%), Positives = 33/67 (49%), Gaps = 5/67 (7%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP-----PPPPPPNYHCHHVQHHCHDHNESSDFGSFFQG 57 P P P+PPP P+P PCP PPPPP P PPPP+ C +ES+ + F Sbjct: 88 PRPCPSPPPPPRPRPCPSPPPPPQPRPRPSPPPPSPPPPAPSSSCSASDESNIYRCMFNE 147 Query: 56 CLTALCC 36 CC Sbjct: 148 TKIDPCC 154 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/34 (61%), Positives = 23/34 (67%), Gaps = 5/34 (14%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP-----PPPPPP 135 P P P+PPP P+P PCP PPPPP P PPPP Sbjct: 76 PRPCPSPPPPPRPRPCPSPPPPPRPRPCPSPPPP 109 [119][TOP] >UniRef100_C5YG10 Putative uncharacterized protein Sb06g028480 n=1 Tax=Sorghum bicolor RepID=C5YG10_SORBI Length = 99 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/70 (45%), Positives = 36/70 (51%), Gaps = 7/70 (10%) Frame = -2 Query: 203 PPPAPK--PPPCPEPPPPP-----PPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTA 45 PPP + PPP PPP PPPPPP Q D S+ G F +GCL A Sbjct: 37 PPPGQQAYPPPAYGAPPPMAAGGYPPPPPP-------QQQQQDSKGGSNDG-FLKGCLAA 88 Query: 44 LCCCCVLDEC 15 LCCCC+LD C Sbjct: 89 LCCCCMLDMC 98 [120][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 257 PSPPPPPPPSPPPPPPPPPPPPPPPPP 283 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP+P PPP P PPPPPPPPPP Sbjct: 257 PSPPPPPPPSPPPPPPPPPPPPPPPPPP 284 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PP P PP P PPPPPPPPPPP Sbjct: 252 PSPLPPSPPPPPPPSPPPPPPPPPPPPPP 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = -2 Query: 215 PLPTP-PPAPKPPPCPEPPPPPPPPPPP 135 P P+P PP+P PPP P PPPPPPPPPPP Sbjct: 250 PPPSPLPPSPPPPPPPSPPPPPPPPPPP 277 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPPP P PP Sbjct: 261 PPPPPSPPPPPPPPPPPPPPPPPPSPSPP 289 [121][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPP 144 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 114 PIFTPAPPPPPPPPPPPPPPPPPPPPPPP 142 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/37 (59%), Positives = 23/37 (62%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCH 99 P PPP P PPP P PPPPPPPPPPP + V H Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPPLFTTRGVSFPPH 157 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+ TP P P PPP P PPPPPPPPPPP Sbjct: 112 PPPIFTPAPPPPPPPPPPPPPPPPPPPPP 140 [122][TOP] >UniRef100_Q5ANI0 Potential fungal zinc cluster transcription factor n=1 Tax=Candida albicans RepID=Q5ANI0_CANAL Length = 1130 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/49 (55%), Positives = 29/49 (59%), Gaps = 11/49 (22%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPE---------PPPPPPPPPPPNYHCHHV--QHH 105 FP P PPP P PPP P+ PPPPPPPPPPP +H HH HH Sbjct: 283 FP-PPPPPPPPPPPHPDHLHHQYYGYPPPPPPPPPPPLHHHHHYPPSHH 330 [123][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPP 170 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F P PPP P PPP P PPPPPPPPPPP Sbjct: 141 FGEPAPPPPPPPPPPPPPPPPPPPPPPP 168 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P P PPP P PPP P PPPPPPPPP Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPP 170 [124][TOP] >UniRef100_P08001 Acrosin heavy chain n=1 Tax=Sus scrofa RepID=ACRO_PIG Length = 415 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPPAP PPP P PPPPPPPPPPP Sbjct: 342 PAPPPAPPPPPPPPPPPPPPPPPPP 366 [125][TOP] >UniRef100_UPI0001984057 PREDICTED: similar to cysteine protease Cp5 n=1 Tax=Vitis vinifera RepID=UPI0001984057 Length = 796 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/79 (37%), Positives = 34/79 (43%), Gaps = 9/79 (11%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP---PNYHCHHVQHHCHDHNESSDFGSFFQGCL 51 P+P P PP P PPP P PPPPP PPPP P+ +C F+ CL Sbjct: 655 PYPSPAVPPPPPPPPSPPPPPPPSPPPPSPGPSPSECGDFSYCPSDETCCCIYEFYDFCL 714 Query: 50 TALCC------CCVLDECC 12 CC CC E C Sbjct: 715 IYGCCEYENAVCCTGTEYC 733 [126][TOP] >UniRef100_UPI000186A01D hypothetical protein BRAFLDRAFT_106142 n=1 Tax=Branchiostoma floridae RepID=UPI000186A01D Length = 550 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPP---PPPP 135 P PLPTPPP P PPP P PPPPPPP PPPP Sbjct: 105 PPPLPTPPPYPPPPPPPPPPPPPPPNSLPPPP 136 Score = 57.0 bits (136), Expect = 6e-07 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P+PPP P PPP P PPPPPPPPPPP Sbjct: 103 PSPPPLPTPPPYPPPPPPPPPPPPP 127 [127][TOP] >UniRef100_UPI0000122FAC Hypothetical protein CBG05832 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000122FAC Length = 208 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/76 (39%), Positives = 33/76 (43%), Gaps = 12/76 (15%) Frame = -2 Query: 221 PFPLPTPPP-------APKPPPCPEPPPPP-----PPPPPPNYHCHHVQHHCHDHNESSD 78 P PLP PPP P PPPCP PPPPP PPPPPP Y C + + Sbjct: 40 PPPLPCPPPPICPPQFCPPPPPCPPPPPPPPPPMCPPPPPPMY------SPCQSYAPAPV 93 Query: 77 FGSFFQGCLTALCCCC 30 F + CC C Sbjct: 94 FNQYAMQPANDCCCRC 109 [128][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PL PPP P PPP P PPPPPPPPPPP Sbjct: 2004 PLQAPPPTPPPPPPPPPPPPPPPPPPP 2030 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P P P PPP P PPPPPPPPPPP+ Sbjct: 2004 PLQAPPPTPPPPPPPPPPPPPPPPPPPPPS 2033 [129][TOP] >UniRef100_UPI0000EE3DB8 zinc finger homeodomain 4 n=1 Tax=Homo sapiens RepID=UPI0000EE3DB8 Length = 3571 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PL PPP P PPP P PPPPPPPPPPP Sbjct: 1989 PLQAPPPTPPPPPPPPPPPPPPPPPPP 2015 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PTPPP P PPP P PPPPPPPP P Sbjct: 1993 PPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 [130][TOP] >UniRef100_UPI00004576BB Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Homo sapiens RepID=UPI00004576BB Length = 3567 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PL PPP P PPP P PPPPPPPPPPP Sbjct: 1989 PLQAPPPTPPPPPPPPPPPPPPPPPPP 2015 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PTPPP P PPP P PPPPPPPP P Sbjct: 1993 PPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 [131][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = -2 Query: 221 PFPLPTPPPAPKP-PPCPEPPPPPPPPPPP 135 P P P PPPAP P PP P PPPPPPPPPPP Sbjct: 125 PAPPPPPPPAPPPAPPAPPPPPPPPPPPPP 154 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPAP PPP P P PP PPPPPP Sbjct: 104 PPPAPPPPPAPPPPPAPPPAPPAPPPPPP 132 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PP Sbjct: 108 PPPPPAPPPPPAPPPAPPAPPPPPPPAPP 136 [132][TOP] >UniRef100_A7QDJ5 Chromosome chr10 scaffold_81, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QDJ5_VITVI Length = 155 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/79 (37%), Positives = 34/79 (43%), Gaps = 9/79 (11%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP---PNYHCHHVQHHCHDHNESSDFGSFFQGCL 51 P+P P PP P PPP P PPPPP PPPP P+ +C F+ CL Sbjct: 14 PYPSPAVPPPPPPPPSPPPPPPPSPPPPSPGPSPSECGDFSYCPSDETCCCIYEFYDFCL 73 Query: 50 TALCC------CCVLDECC 12 CC CC E C Sbjct: 74 IYGCCEYENAVCCTGTEYC 92 [133][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPPPP PPP Sbjct: 1772 PSPPPSPPPPPSPPPPPSPPPPPPPSPPP 1800 Score = 56.2 bits (134), Expect = 1e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPPN 132 +P+PPP+P PPP P PPP PPPPPPP+ Sbjct: 1771 IPSPPPSPPPPPSPPPPPSPPPPPPPS 1797 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPP PPPPPP+ Sbjct: 1558 PSPPPSPPPPP-PPPSPPPPPPSPPPPPPS 1586 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = -2 Query: 221 PFPLPTPPPAPKPP-PCPEPPPPPPPPPPP 135 P P P+PPP+P PP P P PPPPPPPP PP Sbjct: 1545 PSPPPSPPPSPPPPSPPPSPPPPPPPPSPP 1574 [134][TOP] >UniRef100_B7QDE3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QDE3_IXOSC Length = 908 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPE----PPPPPPPPPPP 135 P P P PPP P PPPCP PPPPPPPPPPP Sbjct: 741 PPPPPPPPPPPPPPPCPSVGSIPPPPPPPPPPP 773 [135][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P PPP P PPP P PPPPPPPPPPP+ Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPS 525 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 494 PSSTPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P P PPP P PPP P PPPPPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPP 524 [136][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 6/35 (17%) Frame = -2 Query: 221 PFPLPTPPPAPKP------PPCPEPPPPPPPPPPP 135 P P P PPPAPKP PP P+PPPPPPPPPPP Sbjct: 212 PTPPPPPPPAPKPKPPPPPPPKPKPPPPPPPPPPP 246 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPP---PPPP 135 P P PTPPP P P P P+PPPPPPP PPPP Sbjct: 208 PAPAPTPPPPPPPAPKPKPPPPPPPKPKPPPP 239 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P P P P PPPPPPPPP P Sbjct: 220 PAPKPKPPPPPPPKPKPPPPPPPPPPPAP 248 [137][TOP] >UniRef100_A8X1J0 C. briggsae CBR-GRL-4 protein n=1 Tax=Caenorhabditis briggsae RepID=A8X1J0_CAEBR Length = 217 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/76 (39%), Positives = 33/76 (43%), Gaps = 12/76 (15%) Frame = -2 Query: 221 PFPLPTPPP-------APKPPPCPEPPPPP-----PPPPPPNYHCHHVQHHCHDHNESSD 78 P PLP PPP P PPPCP PPPPP PPPPPP Y C + + Sbjct: 40 PPPLPCPPPPICPPQFCPPPPPCPPPPPPPPPPMCPPPPPPMY------SPCQSYAPAPV 93 Query: 77 FGSFFQGCLTALCCCC 30 F + CC C Sbjct: 94 FNQYAMQPANDCCCRC 109 [138][TOP] >UniRef100_Q86UP3 Zinc finger homeobox protein 4 n=1 Tax=Homo sapiens RepID=ZFHX4_HUMAN Length = 3567 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PL PPP P PPP P PPPPPPPPPPP Sbjct: 1989 PLQAPPPTPPPPPPPPPPPPPPPPPPP 2015 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PTPPP P PPP P PPPPPPPP P Sbjct: 1993 PPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 [139][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 LP PPP P PPP P PPPPPPPPPPP Sbjct: 459 LPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPP P PPPPPPPPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P PPP P PPP P PPPPPPPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/48 (50%), Positives = 24/48 (50%), Gaps = 15/48 (31%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPP---------------PPPNYHC 123 P P P PPP P PPP P PPPPPPPP PPP Y C Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPLDVGEASNLQPPPPLPPPPYSC 507 [140][TOP] >UniRef100_UPI00001CF1F0 formin binding protein 4 n=1 Tax=Rattus norvegicus RepID=UPI00001CF1F0 Length = 1074 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PL PPP P PP P PPPPPPPPPPP Sbjct: 757 PLPLEMPPPPPPPPESPPPPPPPPPPPPP 785 [141][TOP] >UniRef100_UPI0001B7B45F Fnbp4 protein. n=1 Tax=Rattus norvegicus RepID=UPI0001B7B45F Length = 1076 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PL PPP P PP P PPPPPPPPPPP Sbjct: 757 PLPLEMPPPPPPPPESPPPPPPPPPPPPP 785 [142][TOP] >UniRef100_B4RDQ2 OmpA family protein n=1 Tax=Phenylobacterium zucineum HLK1 RepID=B4RDQ2_PHEZH Length = 410 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 F P PPP P PPP P PPPPPPPPPPP Sbjct: 268 FAAPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P PPP P PPP P PPPPPPPPP P Y Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPAPAY 299 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 + PPP P PPP P PPPPPPPPPPP Sbjct: 266 YSFAAPPPPPPPPPPPPPPPPPPPPPPP 293 [143][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPP PPPPP+ Sbjct: 525 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 554 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPP PPPPP+ Sbjct: 531 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 560 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPP PPPPP+ Sbjct: 537 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 566 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPP PPPPP+ Sbjct: 543 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 572 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPP PPPPP+ Sbjct: 549 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 578 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPP PPPPP+ Sbjct: 555 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 584 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PPP+P PPP P PPP PPPPP P + Sbjct: 557 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPRH 587 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPPN 132 P+PPP P PPP P PPPPP PPPPP+ Sbjct: 523 PSPPPPPSPPPPPSPPPPPSPPPPPS 548 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPP P Sbjct: 527 PPPSPPPPPSPPPPPSPPPPPSPPPPPSP 555 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPP P Sbjct: 533 PPPSPPPPPSPPPPPSPPPPPSPPPPPSP 561 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPP P Sbjct: 539 PPPSPPPPPSPPPPPSPPPPPSPPPPPSP 567 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPP P Sbjct: 545 PPPSPPPPPSPPPPPSPPPPPSPPPPPSP 573 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPP PPPPP P Sbjct: 551 PPPSPPPPPSPPPPPSPPPPPSPPPPPSP 579 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPP PPPPP P Sbjct: 523 PSPPPPPSPPPPPSPPPPPSPPPPPSP 549 [144][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 266 PSPPPPPPPSPPPPPPPRPPPPPPPSPPP 294 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 258 PSPPPPPPPSPPPPPPPSPPPPPPPRPPP 286 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 326 PPPSPPPPPPPSPPPPPSPPPPPPPRPPP 354 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP+P PPP P PPPPP PPPP Sbjct: 328 PSPPPPPPPSPPPPPSPPPPPPPRPPPP 355 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P+PPP P P PPPP PPPP+ Sbjct: 272 PPPSPPPPPPPRPPPPPPPSPPPPSPPPPS 301 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P+PPP PPP PPPPPPP+ Sbjct: 308 PPPSPPPPPPPRPPPPSPPPPSPPPPPPPS 337 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPP PPPP P Sbjct: 370 PSPPPPPPPSPPPPPPPRPPPPSPPPPSP 398 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPP PPPP P Sbjct: 401 PSPPPPPPPSPPPPPPPRPPPPSPPPPSP 429 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPP PPPP P Sbjct: 334 PPPSPPPPPSPPPPPPPRPPPPSPPPPSP 362 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPPPP PPP Sbjct: 250 PPPPSPPPPSPPPPPPPSPPPPPPPSPPP 278 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPP PPPP P Sbjct: 274 PSPPPPPPPRPPPPPPPSPPPPSPPPPSP 302 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP PPP P PPPPP PPPPP+ Sbjct: 314 PPPPPRPPPPSPPPPSPPPPPPPSPPPPPS 343 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPP PPPPP Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPSPPPPP 348 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P P PPPP PPPP+ Sbjct: 332 PPPPPSPPPPPSPPPPPPPRPPPPSPPPPS 361 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPPPP PPP Sbjct: 362 PPPPSPPPPSPPPPPPPSPPPPPPPRPPP 390 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P P PPPP PPPP+ Sbjct: 368 PPPSPPPPPPPSPPPPPPPRPPPPSPPPPS 397 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPPPP PPP Sbjct: 393 PPPPSPPPPSPPPPPPPSPPPPPPPRPPP 421 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P P PPPP PPPP+ Sbjct: 399 PPPSPPPPPPPSPPPPPPPRPPPPSPPPPS 428 [145][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 271 PSPPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSPPP 400 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 426 PSPPPPPPPSPPPPPPPSPPPPPPPSPPP 454 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPPPPPSPPP 462 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 442 PSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPPPPP PPP Sbjct: 486 PSPPPPPPPSPPPPPPPSPPPPPPPSPPP 514 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPP PPPP P Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSP 307 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPP PPPP P Sbjct: 336 PSPPPPPPPSPPPPPPPSPPPPSPPPPSP 364 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPP PPPP P Sbjct: 380 PSPPPPPPPSPPPPPPPSPPPPSPPPPSP 408 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPP PPPP P Sbjct: 450 PSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P PPP P PPPP PPPP P Sbjct: 494 PSPPPPPPPSPPPPPPPSPPPPSPPPPSP 522 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP PPP P PPPPP PPPPP Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP PPP PPPPPPP+ Sbjct: 233 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 262 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP PPP PPPPPPP+ Sbjct: 251 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 280 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPPPP PPP Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPP 291 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P P PPPP PPPP+ Sbjct: 277 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 306 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPPPP PPP Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPP 348 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P P PPPP PPPP+ Sbjct: 334 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 363 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPPPP PPP Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPP 392 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P P PPPP PPPP+ Sbjct: 378 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 407 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPPPP PPP Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPP 446 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P P PPPP PPPP+ Sbjct: 448 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 477 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP+P PPP P PPPPPPP PPP Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPP 506 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P P PPPP PPPP+ Sbjct: 492 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 521 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPP P Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPP PPPPPP Sbjct: 285 PPPSPPPPPPPSPPP-PSPPPPSPPPPPP 312 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPP P Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 354 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPP P Sbjct: 370 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPP P Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 452 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPP P Sbjct: 432 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 460 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPP P Sbjct: 440 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 468 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPP P Sbjct: 484 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 [146][TOP] >UniRef100_A9PHQ3 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PHQ3_POPTR Length = 498 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/66 (42%), Positives = 34/66 (51%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTAL 42 P +P+PP P PPP P PPPPPP PPPP C ++ D SF C + Sbjct: 353 PTKVPSPPSPPSPPPPPSPPPPPPSPPPP----------CPQPSDCGD-SSF---CPSDE 398 Query: 41 CCCCVL 24 CCC+L Sbjct: 399 TCCCIL 404 [147][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 100 PPPPPPPPPPPPPPPPPPPPPPPPPPP 126 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 101 PPPPPPPPPPPPPPPPPPPPPPPPPPP 127 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 100 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 127 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 L PPP P PPP P PPPPPPPPPPP Sbjct: 98 LQPPPPPPPPPPPPPPPPPPPPPPPP 123 [148][TOP] >UniRef100_B4PM92 GE24601 n=1 Tax=Drosophila yakuba RepID=B4PM92_DROYA Length = 595 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -2 Query: 203 PPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQ 111 P PAP PPP P PPPPPPPPP P+ H HH Q Sbjct: 153 PAPAPPPPPPPPPPPPPPPPPHPHPHPHHPQ 183 [149][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 470 PPPPPPPLPPPPPPPPPPPPPPPPPPP 496 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 LP PPP P PPP P PPPPPPPPPPP Sbjct: 469 LPPPPPPPLPPPPPPPPPPPPPPPPP 494 [150][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 LP PPP P PPP P PPPPPPPPPPP Sbjct: 840 LPPPPPPPPPPPPPPPPPPPPPPPPP 865 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 841 PPPPPPPPPPPPPPPPPPPPPPPPPPP 867 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P P PPP P PPP P PPPPPPPPP Sbjct: 841 PPPPPPPPPPPPPPPPPPPPPPPPPPP 867 [151][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 LP PPP P PPP P PPPPPPPPPPP Sbjct: 918 LPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P P PPP P PPP P PPPPPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [152][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 LP PPP P PPP P PPPPPPPPPPP Sbjct: 918 LPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P P PPP P PPP P PPPPPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [153][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPA PPP P PPPPPPPPPPP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP +P PPP P PPPPPPPPPPP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PP P PPP P PPPPPPPPPP Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P +PPP P PPP P PPPPPPPPP P Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPPEP 75 [154][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P PPP P PPP P PPPPPPPPPPP Sbjct: 1032 VPPPPPPPPPPPPPPPPPPPPPPPPP 1057 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPP P PPPPPPPPPPP Sbjct: 1027 PAVTAVPPPPPPPPPPPPPPPPPPPPPPP 1055 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P P PPP P PPP P PPPPPPPPP Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 5/34 (14%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPC-----PEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPPP Sbjct: 1045 PPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPP 1078 [155][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPA PPP P PPPPPPPPPPP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP +P PPP P PPPPPPPPPPP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PP P PPP P PPPPPPPPPP Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P +PPP P PPP P PPPPPPPPP P Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPPEP 75 [156][TOP] >UniRef100_Q6ZQ03 Formin-binding protein 4 n=1 Tax=Mus musculus RepID=FNBP4_MOUSE Length = 1031 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PL PPP P PP P PPPPPPPPPPP Sbjct: 712 PLPLEMPPPPPPPPESPPPPPPPPPPPPP 740 [157][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPA + PP P PPPPPPPPPPP Sbjct: 339 PHPRPPQPPAAQAPPPPPPPPPPPPPPPP 367 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPP 141 P P P PPP P PPP P PPPPPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPP 378 [158][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPPN 132 L TPPP P PPP P PPPPPPPPPPP+ Sbjct: 3065 LQTPPPPPPPPPPPPPPPPPPPPPPPS 3091 [159][TOP] >UniRef100_UPI0001661EAE PREDICTED: similar to Putative acrosin-like protease n=1 Tax=Homo sapiens RepID=UPI0001661EAE Length = 355 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PPP P PPPPPPPPP P+ Sbjct: 278 PRPPPSPPPPPPPPPSPLPPPPPPPPPTPS 307 [160][TOP] >UniRef100_UPI0000F2C630 PREDICTED: similar to zinc finger homeodomain 4, n=1 Tax=Monodelphis domestica RepID=UPI0000F2C630 Length = 3606 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P PL PPP P PPP P PPPPPPPPPP Sbjct: 1995 PTPLQAPPPTPPPPPPPPPPPPPPPPPP 2022 [161][TOP] >UniRef100_UPI0000E7FF28 PREDICTED: similar to zinc-finger homeodomain protein 4 isoform 2 n=1 Tax=Gallus gallus RepID=UPI0000E7FF28 Length = 3618 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P PL PPP P PPP P PPPPPPPPPP Sbjct: 2022 PTPLQAPPPTPPPPPPPPPPPPPPPPPP 2049 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPP 138 L TPPP P PPP P PPPPPPPPPP Sbjct: 3149 LQTPPPPPPPPPPPPPPPPPPPPPP 3173 [162][TOP] >UniRef100_UPI0000ECD10B Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10B Length = 3578 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P PL PPP P PPP P PPPPPPPPPP Sbjct: 1982 PTPLQAPPPTPPPPPPPPPPPPPPPPPP 2009 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPP 138 L TPPP P PPP P PPPPPPPPPP Sbjct: 3109 LQTPPPPPPPPPPPPPPPPPPPPPP 3133 [163][TOP] >UniRef100_Q2RTE8 Putative uncharacterized protein n=1 Tax=Rhodospirillum rubrum ATCC 11170 RepID=Q2RTE8_RHORT Length = 208 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 85 PIPEPEPEPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPP P Sbjct: 87 PEPEPEPPPPPPPPPPPPPPPPPPPPPEP 115 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 89 PEPEPPPPPPPPPPPPPPPPPPPPPEPPP 117 [164][TOP] >UniRef100_C5SH71 Putative uncharacterized protein n=1 Tax=Asticcacaulis excentricus CB 48 RepID=C5SH71_9CAUL Length = 677 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PLP PPP P PP P PPPPPPPPPPP Sbjct: 37 PLPQPPPPPPPPAPPPPPPPPPPPPPP 63 [165][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPPAP PPP P PPP P PPPPP+ Sbjct: 844 PSPPPSPPPAPSPPPPPNPPPAPTPPPPPS 873 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PTPPP P PPP P P PPPPP PPP Sbjct: 862 PPPAPTPPPPPSPPPSPPPSPPPPPSPPP 890 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPP PPP P Sbjct: 850 PPPAPSPPPPPNPPPAPTPPPPPSPPPSP 878 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP+P P P P PPPPP PPPPP+ Sbjct: 864 PAPTPPPPPSPPPSPPPSPPPPPSPPPPPS 893 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPPAP PPP P PPP PPP PPP Sbjct: 856 PPPPPNPPPAPTPPPPPSPPPSPPPSPPP 884 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPP-PPPPPN 132 P P P PP+P PPP P PPPPPP PPPPPN Sbjct: 789 PSPPPPLPPSPPPPPSPPPPPPPPSPPPPPN 819 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P+PPP P PP P PPPPP PPPPP+ Sbjct: 808 PPPPPSPPPPPNPPTPPSPPPPPSPPPPPS 837 [166][TOP] >UniRef100_B4KQN5 GI19702 n=1 Tax=Drosophila mojavensis RepID=B4KQN5_DROMO Length = 194 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -2 Query: 221 PFPLPTP-PPAPKPPPCPEPPPPPPPPPPPN 132 P P P P PP P PPP P PPPPPPPPPPPN Sbjct: 163 PGPFPGPFPPFPPPPPPPPPPPPPPPPPPPN 193 [167][TOP] >UniRef100_O73590 Zinc finger homeobox protein 4 n=1 Tax=Gallus gallus RepID=ZFHX4_CHICK Length = 3573 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P PL PPP P PPP P PPPPPPPPPP Sbjct: 1977 PTPLQAPPPTPPPPPPPPPPPPPPPPPP 2004 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPP 138 L TPPP P PPP P PPPPPPPPPP Sbjct: 3104 LQTPPPPPPPPPPPPPPPPPPPPPP 3128 [168][TOP] >UniRef100_Q9M3Y2 Glycine-rich protein n=1 Tax=Triticum aestivum RepID=Q9M3Y2_WHEAT Length = 390 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 G GGGGG GGG+GHGGGFGAGGG G+G G Sbjct: 208 GSGGGGGLGGGAGHGGGFGAGGGAGAGGG 236 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGG+GHGGGFGAGGG G G G Sbjct: 250 GGGGGGGLGGGAGHGGGFGAGGGGGFGGG 278 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGG GGGGG G GHGGGFGAGGG G G G Sbjct: 64 GGGLGGGGGLGGGHGGGFGAGGGAGGGAG 92 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGG GGG G GHGGGFG G GVG G G Sbjct: 276 GGGGGAGGGLGGGHGGGFGGGAGVGGGAG 304 [169][TOP] >UniRef100_Q9LW52 Genomic DNA, chromosome 3, P1 clone: MLM24 n=1 Tax=Arabidopsis thaliana RepID=Q9LW52_ARATH Length = 452 Score = 57.0 bits (136), Expect = 7e-07 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGGFG GGG G G+G Sbjct: 77 GGGGGGGGGGGGGGGGGFGGGGGFGGGHG 105 [170][TOP] >UniRef100_A2YLR2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YLR2_ORYSI Length = 342 Score = 57.0 bits (136), Expect = 7e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GG GHGGGFGAGGGVG G G Sbjct: 138 GGGGGGGLGGSGGHGGGFGAGGGVGGGAG 166 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 G GGGGGGG G GHGGGFGAG GVG G G Sbjct: 297 GFGGGGGGGLGGGHGGGFGAGAGVGGGAG 325 [171][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PLP P AP+PPP P PPPPPPPPPPP Sbjct: 425 PLPGPTTAPRPPPPPPPPPPPPPPPPP 451 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P PT P P PPP P PPPPPPPPPP Sbjct: 425 PLPGPTTAPRPPPPPPPPPPPPPPPPPP 452 [172][TOP] >UniRef100_Q9KYF3 Putative membrane protein n=1 Tax=Streptomyces coelicolor RepID=Q9KYF3_STRCO Length = 687 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P PTPPP PKP P P PPPPPP PPP Sbjct: 515 PTPTPTPPPKPKPTPTPTPPPPPPSPPP 542 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PTP P PKP P P P PPPPPP PP Sbjct: 513 PAPTPTPTPPPKPKPTPTPTPPPPPPSPP 541 [173][TOP] >UniRef100_Q3MC83 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC 29413 RepID=Q3MC83_ANAVT Length = 387 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P+PPPPPPP PPP Sbjct: 323 PDPPPPPPPDPPPPPPPDPPPPPPPDPPP 351 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P+PPPPPPP PPP Sbjct: 331 PDPPPPPPPDPPPPPPPDPPPPPPPDPPP 359 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P+PPPPPPP PPP Sbjct: 339 PDPPPPPPPDPPPPPPPDPPPPPPPDPPP 367 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P+PPPPPPP PPP Sbjct: 347 PDPPPPPPPDPPPPPPPDPPPPPPPDPPP 375 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P+PPPPPPP PPP Sbjct: 355 PDPPPPPPPDPPPPPPPDPPPPPPPDPPP 383 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPP P+PPPPPPP PPP Sbjct: 319 PPPPPDPPPPPPPDPPPPPPPDPPP 343 [174][TOP] >UniRef100_Q1GRM3 OmpA/MotB n=1 Tax=Sphingopyxis alaskensis RepID=Q1GRM3_SPHAL Length = 373 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 P P PP P PPP P PPPPPPPPPPP C Sbjct: 227 PEPVAPPPPPPPPPPPPPPPPPPPPPPVVEC 257 [175][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P+PPP P PPP P PPPPPPPPPPP Sbjct: 1537 PSPPPPPPPPPPPPPPPPPPPPPPP 1561 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = -2 Query: 221 PFPLPTPPPA----PKPPPCPEPPPPPPPPPPP 135 P P P PPP+ P PPP P PPPPPPPPPPP Sbjct: 1523 PPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPP 1555 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 23/34 (67%), Gaps = 5/34 (14%) Frame = -2 Query: 221 PFPLPTPP-----PAPKPPPCPEPPPPPPPPPPP 135 P P P PP P+P PPP P PPPPPPPPPPP Sbjct: 1524 PPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPP 1557 [176][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P PPPPPPPPPP Sbjct: 1219 PPPPPLPPPPPPPPPLPPPPPPPPPPPP 1246 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPP PPPPPPP Sbjct: 1213 PLPPPPPPPPPLPPPPPPPPPLPPPPPPP 1241 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPP PPP Sbjct: 1209 PPPPPLPPPPPPPPPLPPPPPPPPPLPPP 1237 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P P PPPPPPPPP Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPPP 1243 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P PPP P PPPPPPPPPPP Sbjct: 1217 PPPPPPPLPPPPPPPPPLPPPPPPPPPPP 1245 [177][TOP] >UniRef100_Q6BI43 DEHA2G13574p n=1 Tax=Debaryomyces hansenii RepID=Q6BI43_DEBHA Length = 985 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/39 (56%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = -2 Query: 203 PPPAPKPPPCPEPPPPPP-PPPPPNYHCHHVQHHCHDHN 90 PPP P PP P P PPPP PPP P+YH H+ +H+ +DH+ Sbjct: 213 PPPGPPPPGPPPPGPPPPGPPPGPSYHPHYSKHYWNDHS 251 [178][TOP] >UniRef100_B6HEZ9 Pc20g08960 protein n=1 Tax=Penicillium chrysogenum Wisconsin 54-1255 RepID=B6HEZ9_PENCW Length = 661 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P PAP P P PEP PPPPPPPPP Sbjct: 322 PAPAPAPAPAPAPAPAPEPAPPPPPPPPP 350 [179][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PTPPP P PPP P PPPPPPPP P Sbjct: 801 PAPAPTPPPPPPPPPPPPPPPPPPPPSAP 829 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P PLP PP P P P P PPPPPPPPPPP Sbjct: 791 PPPLPPAPPQPAPAPTPPPPPPPPPPPPP 819 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P PPP P PPPPPPPPPPP Sbjct: 799 PQPAPAPTPPPPPPPPPPPPPPPPPPP 825 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P+P P P PPPPPPPPPPP Sbjct: 789 PPPPPLPPAPPQPAPAPTPPPPPPPPPPP 817 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P P P P PPP P PPPPPPPPPP Sbjct: 799 PQPAPAPTPPPPPPPPPPPPPPPPPPPP 826 [180][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPPPP Sbjct: 242 PAAPPPPPPPPPPPPPPPPPPPPPPPPPP 270 [181][TOP] >UniRef100_Q08195 Cysteine-rich extensin-like protein-2 n=1 Tax=Nicotiana tabacum RepID=Q08195_TOBAC Length = 196 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/36 (61%), Positives = 24/36 (66%), Gaps = 7/36 (19%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP-------PPPPPP 135 P P P+PPP P+P PCP PPPPP PPPPPP Sbjct: 73 PRPCPSPPPPPRPRPCPSPPPPPQPRPRPSPPPPPP 108 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P+P P P PPPPPPP PPP Sbjct: 85 PRPCPSPPPPPQPRPRPSPPPPPPPSPPP 113 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP-PPPPPPNYHC 123 P P P PPP P+P P P PPPPP PPPP P+ C Sbjct: 87 PCPSPPPPPQPRPRPSPPPPPPPSPPPPAPSSSC 120 [182][TOP] >UniRef100_B9RYC5 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RYC5_RICCO Length = 510 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = -2 Query: 221 PFPLPTPPPA--PKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PPP P PPPPPPPPPPP Sbjct: 90 PLPPPSPPPPKHPPPPPPPSPPPPPPPPPPP 120 [183][TOP] >UniRef100_Q7F1U6 cDNA clone:J023048B07, full insert sequence n=2 Tax=Oryza sativa RepID=Q7F1U6_ORYSJ Length = 89 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/77 (40%), Positives = 34/77 (44%), Gaps = 9/77 (11%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPP---------PPPPPPPPPNYHCHHVQHHCHDHNESSDFGSF 66 +P P PPA PP PP PPP PPP H S SF Sbjct: 24 YPPPGYPPAGYPPAQGYPPAGYPPQQGYPPPYAQPPPQQQQH------------SSGPSF 71 Query: 65 FQGCLTALCCCCVLDEC 15 +GCL ALCCCC+LD C Sbjct: 72 MEGCLAALCCCCLLDAC 88 [184][TOP] >UniRef100_B6T2F1 Rhodopsin n=1 Tax=Zea mays RepID=B6T2F1_MAIZE Length = 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/67 (41%), Positives = 31/67 (46%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTALCC 36 P PPPA PP PP PPPP + S SF +GCL ALCC Sbjct: 31 PAGYPPPAQGYPPQGYPPQYAQPPPP--------------QQQQSSGPSFMEGCLAALCC 76 Query: 35 CCVLDEC 15 CC+LD C Sbjct: 77 CCLLDAC 83 [185][TOP] >UniRef100_B6SHT2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B6SHT2_MAIZE Length = 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/67 (41%), Positives = 31/67 (46%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTALCC 36 P PPPA PP PP PPPP + S SF +GCL ALCC Sbjct: 31 PAGYPPPAQGYPPQGYPPQYAQPPPP--------------QQQQSSGPSFMEGCLAALCC 76 Query: 35 CCVLDEC 15 CC+LD C Sbjct: 77 CCLLDAC 83 [186][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+PPP P PPP P PPPPPP PPPP Sbjct: 303 PPPSPPPPPPPPPLPSPPPPPPTPPPP 329 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPP Sbjct: 307 PPPPPPPPPLPSPPPPPPTPPPPPPPPPP 335 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P PLP+PPP P PP P PPPPPPPPP P + Sbjct: 313 PPPLPSPPPPPPTPPPPPPPPPPPPPPNPPF 343 [187][TOP] >UniRef100_Q96VI4 Protease 1 n=1 Tax=Pneumocystis carinii RepID=Q96VI4_PNECA Length = 938 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+PPP P PPP P P PPPPPPPPP Sbjct: 783 PPPSPPPPPPPPPAPAPAPPPPPPPPP 809 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P P P P PPPPPPPPPP Sbjct: 783 PPPSPPPPPPPPPAPAPAPPPPPPPPPP 810 [188][TOP] >UniRef100_Q5KAA5 Cytokinesis protein sepa (Fh1/2 protein), putative n=1 Tax=Filobasidiella neoformans RepID=Q5KAA5_CRYNE Length = 1776 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 6/41 (14%) Frame = -2 Query: 221 PFPLPTPPPAPKPPP------CPEPPPPPPPPPPPNYHCHH 117 P P P PPP P PPP P PPPPPPPPPPP HH Sbjct: 1093 PPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPPLTTLHH 1133 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 22/36 (61%), Gaps = 7/36 (19%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPP-------PPPPP 135 P P P PPP P PPP P PPPPPP PPPPP Sbjct: 1084 PLPHPPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPP 1119 [189][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 25/31 (80%), Gaps = 1/31 (3%) Frame = -2 Query: 221 PFPLPTPP-PAPKPPPCPEPPPPPPPPPPPN 132 P P P+PP P+P PPP P PPPPPPPPPPP+ Sbjct: 123 PPPPPSPPSPSPSPPPPPPPPPPPPPPPPPS 153 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P P P P PPPPPPPPPPP Sbjct: 120 PPPPPPPPSPPSPSPSPPPPPPPPPPPPP 148 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP+P P P P PPPPPPPPPPP Sbjct: 122 PPPPPPSPPSPSPSPPPPPPPPPPPPPPP 150 [190][TOP] >UniRef100_UPI0001983A53 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983A53 Length = 79 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/74 (40%), Positives = 36/74 (48%), Gaps = 7/74 (9%) Frame = -2 Query: 215 PLPTPPPAPKP----PPCPEPPPPPPP---PPPPNYHCHHVQHHCHDHNESSDFGSFFQG 57 P+ PPP P P PPP PP PPP Y + Q ++ G F +G Sbjct: 10 PVGVPPPQGYPVEGYPKDAYPPPGYPPQAYPPPQAYPPQYAQPP-----PKNETGGFLEG 64 Query: 56 CLTALCCCCVLDEC 15 CL ALCCCC+LD C Sbjct: 65 CLAALCCCCLLDAC 78 [191][TOP] >UniRef100_UPI000176023F PREDICTED: similar to protein kinase beta like (3E511) n=1 Tax=Danio rerio RepID=UPI000176023F Length = 639 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -2 Query: 221 PFPLPTPPPAPKP-PPCPEPPPPPPPPPPPNYHCH 120 P P PPPAP P PP P PPPPPPPPPPP C+ Sbjct: 346 PSPGTAPPPAPPPQPPPPPPPPPPPPPPPPPSRCN 380 [192][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 +P P PPP P PPP P PPPPPPP PPP Sbjct: 32 WPSPPPPPPPPPPPSPPPPPPPPPSPPP 59 [193][TOP] >UniRef100_UPI000184A345 DMRT-like family B with proline-rich C-terminal, 1 n=1 Tax=Canis lupus familiaris RepID=UPI000184A345 Length = 346 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 +PLP PPP P PPP P PPPPPPPPP P + Sbjct: 259 YPLPPPPPPPPPPP-PPPPPPPPPPPQPQF 287 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P PPP P PPP P PPPPPPPPPP Sbjct: 256 PSYYPLPPPPPPPPPPPPPPPPPPPPPP 283 [194][TOP] >UniRef100_Q8VAY0 WSSV295 n=1 Tax=Shrimp white spot syndrome virus RepID=Q8VAY0_WSSV Length = 127 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 PFP P PPP P PPP PPPP PPPPPP Sbjct: 26 PFPFPFPPPFPFPPPFVPPPPPSPPPPPP 54 [195][TOP] >UniRef100_C6XK60 OmpA/MotB domain protein n=1 Tax=Hirschia baltica ATCC 49814 RepID=C6XK60_HIRBI Length = 386 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPP P PPPPPPPPPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/52 (46%), Positives = 28/52 (53%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCHDHNESSDFGSFFQ 60 P PPP P PPP P PPPPPPPPPPP + +S DF +F+ Sbjct: 231 PAAPPPPPPPPPPPPPPPPPPPPPPPPPETLVEEAPVVNCVAQSQDFAVYFE 282 [196][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPP P PPPPPPPPPPP Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPP 255 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPP P PPPPPPPPPPP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P PPP P PPP P PPPPPPPPPP Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P PPPPPPPPP P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPAP 258 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCH 120 P P P PPP P PPP P PPPPPPPP P C+ Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPPPAPEPAPCN 264 [197][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPP PPPPPP Sbjct: 434 PPPPPPPPPPPPPPPTPPPPPPRPPPPPP 462 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PPPPPPPPPP Sbjct: 438 PPPPPPPPPPPTPPPPPPRPPPPPPPPPP 466 [198][TOP] >UniRef100_Q5VR46 Os01g0180000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5VR46_ORYSJ Length = 520 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -2 Query: 215 PLPTPPPAPKP-PPCPEPPPPPPPPPP 138 P P PPPAP+P PPCPE PPPPPPPPP Sbjct: 434 PPPPPPPAPQPHPPCPELPPPPPPPPP 460 [199][TOP] >UniRef100_Q1EP07 Putative uncharacterized protein n=1 Tax=Musa acuminata RepID=Q1EP07_MUSAC Length = 390 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPPAP+PPP P P PPPPPPP P+ Sbjct: 192 PGPEPPPPPAPEPPPPPAPEPPPPPPPKPD 221 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPP---PPPPPP 135 P P P P P P PPP PEPPPPP PPPPPP Sbjct: 186 PEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPP 217 [200][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP PPPPPPPPPPP+ Sbjct: 48 PPPSPPPPPPPLPPPPSPPPPPPPPPPPPS 77 [201][TOP] >UniRef100_B8ADK4 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8ADK4_ORYSI Length = 520 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 1/27 (3%) Frame = -2 Query: 215 PLPTPPPAPKP-PPCPEPPPPPPPPPP 138 P P PPPAP+P PPCPE PPPPPPPPP Sbjct: 434 PPPPPPPAPQPHPPCPELPPPPPPPPP 460 [202][TOP] >UniRef100_B6SLH4 Annexin A7 n=1 Tax=Zea mays RepID=B6SLH4_MAIZE Length = 122 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 23/93 (24%) Frame = -2 Query: 221 PFPLPTPPPAPKPPP----------------CPEPPPP-------PPPPPPPNYHCHHVQ 111 P P P PPPA PP PPPP P PP P+ Sbjct: 30 PPPPPAPPPAMANPPQGGYGYGYQYQGYLGEAANPPPPYYYTGSWPEQPPAPSDGAPFRY 89 Query: 110 HHCHDHNESSDFGSFFQGCLTALCCCCVLDECC 12 + D ++++ +F +GCL LCCCC+L+ CC Sbjct: 90 RYLQDQDDANCI-TFLRGCLAGLCCCCLLERCC 121 [203][TOP] >UniRef100_B4FEM0 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FEM0_MAIZE Length = 102 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/77 (37%), Positives = 35/77 (45%), Gaps = 9/77 (11%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPP---------PPPNYHCHHVQHHCHDHNESSDFGSF 66 +P P PPA PPP PP PP P Y + Q + S SF Sbjct: 25 YPPPGYPPAGYPPPAQGYPPQGYPPQGYPPQQGYPQQGYPPQYSQPPPPPRQQQSSGPSF 84 Query: 65 FQGCLTALCCCCVLDEC 15 +GCL ALCCCC+L+ C Sbjct: 85 MEGCLAALCCCCLLEAC 101 [204][TOP] >UniRef100_A4RZU2 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RZU2_OSTLU Length = 779 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P PPP P PPP P PPPPPPPPPPP + Sbjct: 336 PLECAPPPPPPPPPPPPPPPPPPPPPPPPGF 366 [205][TOP] >UniRef100_B4M7B5 GJ16487 n=1 Tax=Drosophila virilis RepID=B4M7B5_DROVI Length = 880 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 + TPPP P PPP P PPPPPPPPPPP Sbjct: 183 METPPPPPPPPPPPPPPPPPPPPPPP 208 [206][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP P PPP P PPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 [207][TOP] >UniRef100_A7RNZ0 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7RNZ0_NEMVE Length = 370 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/79 (39%), Positives = 36/79 (45%), Gaps = 32/79 (40%) Frame = -2 Query: 221 PFPLPTPPP-------APKPPPCPE-----PPPPPPPPPPPNY----------------- 129 P+P P PPP P PPP PE PPPPPPPPPPP Y Sbjct: 292 PYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPPPYPYPYPYPDESENTKHKS 351 Query: 128 --HC-HHVQHHCHDHNESS 81 H HH +HH +H++ S Sbjct: 352 KKHAKHHEKHHKENHSKKS 370 [208][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P PPP+P PPP P PPPP PPPPPP+ Sbjct: 226 PPPPPPPSPPPPPPPSPPPPSPPPPPPS 253 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP P PP P PPPPP PPPPP Sbjct: 1 PPPPPSPPPPPPPPSSPPPPPPPSPPPPP 29 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -2 Query: 209 PTPPPAPKPPPCPEPPPPPPPPPPP 135 P PPP+P PPP P PPPPPP PPPP Sbjct: 144 PPPPPSPPPPPPPSPPPPPPSPPPP 168 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP +P PPP P PPPPPP PPPP Sbjct: 7 PPPPPPPPSSPPPPPPPSPPPPPPSPPPP 35 [209][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGGVG G G Sbjct: 102 GGGGGGGGGGGGGGGGGVGGGGGVGGGGG 130 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGGVG G G Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGVGGGGG 124 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGGVG G G Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGVGGGGG 170 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGG GSG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGSGGG 83 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGG GSG G Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGSGGG 350 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGGSG GGG G GGG G G G Sbjct: 336 GGGGGGGGGGGSGGGGGGGGGGGGGGGGG 364 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGG G G+G Sbjct: 63 GGGGGGGGGGGGGGGGGSGGGGGGGGGSG 91 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGG G G G Sbjct: 67 GGGGGGGGGGGGGSGGGGGGGGGSGGGGG 95 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGG G G G Sbjct: 148 GGGGGGGGGGGGGGGGGVGGGGGGGGGGG 176 [210][TOP] >UniRef100_UPI0000DB7618 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB7618 Length = 608 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSG 216 GGGGGGGGGGG G GGGFG+GGG GSG Sbjct: 79 GGGGGGGGGGGFGSGGGFGSGGGFGSG 105 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 G GGGGGGGGG G GGGFG+GGG GSG G Sbjct: 73 GFGGGGGGGGGGGGGGGFGSGGGFGSGGG 101 [211][TOP] >UniRef100_Q8H797 Putative uncharacterized protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q8H797_ARATH Length = 105 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGGFG GGG G G G Sbjct: 77 GGGGGGGGGGGGGGGGGFGGGGGFGGGPG 105 [212][TOP] >UniRef100_A3BK86 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BK86_ORYSJ Length = 344 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +1 Query: 133 LGGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 +GGGGGGG GGG G GGGFGAGGG+G G G Sbjct: 196 MGGGGGGGFGGGGGKGGGFGAGGGMGGGAG 225 [213][TOP] >UniRef100_UPI0000F2CB43 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2CB43 Length = 252 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGG G G+G Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGGGSG 223 Score = 22.7 bits (47), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 105 MMLDMVTMIIRRRRRRRRRR 164 ++L+ + RR+RRRRRRR Sbjct: 161 LLLNAGGRLERRQRRRRRRR 180 [214][TOP] >UniRef100_UPI0000DA3E0C PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3E0C Length = 542 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P PPP P PPP P PPPPPPPPPP Sbjct: 412 PPPVPPPTPPPPPPPPPPPPPPPPPP 437 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPPAP PPP P PPPP PPPPP Sbjct: 319 PPPRPVPPPAPPPPPPPPPPPPRPPPPP 346 [215][TOP] >UniRef100_UPI00016E4781 UPI00016E4781 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4781 Length = 906 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 24/41 (58%), Gaps = 12/41 (29%) Frame = -2 Query: 221 PFPLPTP------------PPAPKPPPCPEPPPPPPPPPPP 135 P PLP P PP P+PPP P PPPPPPPPPPP Sbjct: 584 PLPLPPPSPRLNPTIPNQSPPTPRPPPPPPPPPPPPPPPPP 624 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 16/48 (33%) Frame = -2 Query: 221 PFPLPTPPPAPK----------------PPPCPEPPPPPPPPPPPNYH 126 P PLP PPP+P+ PPP P PPPPPPPPPPP H Sbjct: 582 PPPLPLPPPSPRLNPTIPNQSPPTPRPPPPPPPPPPPPPPPPPPPPQH 629 [216][TOP] >UniRef100_Q4SUB2 Chromosome 3 SCAF13974, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SUB2_TETNG Length = 692 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPE----PPPPPPPPPPP 135 PLP PPP P PPP P PPPPPPPPPPP Sbjct: 113 PLPPPPPPPPPPPLPSFTLSPPPPPPPPPPP 143 [217][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P+PPP PPP P PPPPPPPPPPP+ Sbjct: 200 PSASPSPPPPSPPPPSPPPPPPPPPPPPPS 229 [218][TOP] >UniRef100_Q8YQB7 All3916 protein n=1 Tax=Nostoc sp. PCC 7120 RepID=Q8YQB7_ANASP Length = 383 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP P+PPPPPPP PPP Sbjct: 336 PPPDPPPPPDPPPPPDPPPPPPPDPPP 362 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPPP PPPPP+ Sbjct: 336 PPPDPPPPPDPPPPPDPPPPPPPDPPPPPD 365 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P+PPPPP PPPPP Sbjct: 328 PDPPPPDPPPPDPPPPPDPPPPPDPPPPP 356 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP P+PPPPP PPPP Sbjct: 342 PPPDPPPPPDPPPPPPPDPPPPPDPPPP 369 [219][TOP] >UniRef100_Q7WFN5 Proline-rich inner membrane protein n=1 Tax=Bordetella bronchiseptica RepID=Q7WFN5_BORBR Length = 379 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P+P P PEPPPPPPPPPPP Sbjct: 80 PQPEPEPQPQPEPEPEPEPPPPPPPPPPP 108 [220][TOP] >UniRef100_Q7W477 Proline-rich inner membrane protein n=1 Tax=Bordetella parapertussis RepID=Q7W477_BORPA Length = 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P+P P PEPPPPPPPPPPP Sbjct: 80 PQPEPEPKPQPEPEPEPEPPPPPPPPPPP 108 [221][TOP] >UniRef100_Q7VU02 Proline-rich inner membrane protein n=1 Tax=Bordetella pertussis RepID=Q7VU02_BORPE Length = 324 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P P+P P PEPPPPPPPPPPP Sbjct: 80 PQPEPEPQPQPEPEPEPEPPPPPPPPPPP 108 [222][TOP] >UniRef100_Q53N23 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q53N23_ORYSJ Length = 376 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PP P PPP P PP PPPPPPPP Sbjct: 86 PPPAPSPPAPPPPPPAPSPPAPPPPPPPP 114 [223][TOP] >UniRef100_Q00ZZ2 Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins (ISS) n=1 Tax=Ostreococcus tauri RepID=Q00ZZ2_OSTTA Length = 685 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -2 Query: 206 TPPPAPKPPPCPEPPPPPPPPPPP 135 TPPP P PPP P PPPPPPPPPPP Sbjct: 523 TPPPPPPPPPPPPPPPPPPPPPPP 546 [224][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPN 132 P P P PPP P PPP P PPPP PPPPPP+ Sbjct: 1209 PPPSPPPPPPPPPPPPPLPPPPSPPPPPPS 1238 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PPP P PP PPPPPP P Sbjct: 1211 PSPPPPPPPPPPPPPLPPPPSPPPPPPSP 1239 [225][TOP] >UniRef100_C1FHQ4 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FHQ4_9CHLO Length = 1159 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP+P+ PP P PPP PPPPPPP Sbjct: 334 PPPPPLPPPSPRAPPSPNPPPAPPPPPPP 362 [226][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P+PPP+P PPP P PPPPP PPPP Sbjct: 1155 PSPPPSPPPSPPPPPSPMPPPPPSPPPP 1182 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP+P PPP P PPPP PPPPP Sbjct: 1092 PSPPPPPPPSPPPPPPPSPPPPRPPPPP 1119 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP+P PPP P PPPP PPPPP Sbjct: 1161 PPPSPPPPPSPMPPPPPSPPPPRPPPPP 1188 [227][TOP] >UniRef100_B6T850 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6T850_MAIZE Length = 102 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/77 (37%), Positives = 35/77 (45%), Gaps = 9/77 (11%) Frame = -2 Query: 218 FPLPTPPPAPKPPPCPEPPPPPPPP---------PPPNYHCHHVQHHCHDHNESSDFGSF 66 +P P PPA PPP PP PP P Y + Q + S SF Sbjct: 25 YPPPGYPPAGYPPPAQGYPPQGYPPQGYPPQQGYPQQGYPPQYSQPPPPPXQQQSSGPSF 84 Query: 65 FQGCLTALCCCCVLDEC 15 +GCL ALCCCC+L+ C Sbjct: 85 MEGCLAALCCCCLLEAC 101 [228][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PP P PPP P PPPPPPPPPPP Sbjct: 413 PSPAPPAPPSPPPPPPPPPPPPPPPPP 439 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P+P PPAP PP P PPPPPPPPPPP + Sbjct: 410 PYPPSPAPPAPPSPPPPPPPPPPPPPPPPPF 440 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPPNY 129 P P P PP+P PPP P PPPPPPPPP P + Sbjct: 413 PSPAPPAPPSPPPPPPPPPPPPPPPPPFPPF 443 [229][TOP] >UniRef100_B4GDZ6 GL21920 n=1 Tax=Drosophila persimilis RepID=B4GDZ6_DROPE Length = 590 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 203 PPPAPKPPPCPEPPPPPPPPPPPNYHCHH 117 PPP P PPP PPPPPPPPPPP +H HH Sbjct: 139 PPPGPPPPP---PPPPPPPPPPPPHHHHH 164 [230][TOP] >UniRef100_Q96VJ2 Protease-1 (PRT1) protein, putative n=1 Tax=Pneumocystis carinii RepID=Q96VJ2_PNECA Length = 874 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -2 Query: 221 PFPLPTPP-PAPKPPPCPEPPPPPPPPPP 138 P P P PP PAP PPP P PPPPPPPPPP Sbjct: 787 PPPAPAPPAPAPPPPPAPAPPPPPPPPPP 815 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -2 Query: 221 PFPLPTP-PPAPKPPPCPEPPPPPPPPPPP 135 P P P P PPAP PPP P P PPPPPPPPP Sbjct: 785 PPPPPAPAPPAPAPPPPPAPAPPPPPPPPP 814 [231][TOP] >UniRef100_Q6AHU5 Protease-1 (PRT1) protein, putative n=1 Tax=Pneumocystis carinii RepID=Q6AHU5_PNECA Length = 874 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -2 Query: 221 PFPLPTPP-PAPKPPPCPEPPPPPPPPPP 138 P P P PP PAP PPP P PPPPPPPPPP Sbjct: 787 PPPAPAPPAPAPPPPPAPAPPPPPPPPPP 815 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -2 Query: 221 PFPLPTP-PPAPKPPPCPEPPPPPPPPPPP 135 P P P P PPAP PPP P P PPPPPPPPP Sbjct: 785 PPPPPAPAPPAPAPPPPPAPAPPPPPPPPP 814 [232][TOP] >UniRef100_Q6Z495 Os07g0511300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z495_ORYSJ Length = 296 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGG GGG GGG G GGGFGAGGGVG G+G Sbjct: 128 GGGSGGGVGGGGGQGGGFGAGGGVGGGSG 156 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGG GGG G GGGFGAGGGVG G Sbjct: 170 GGGGGGGIGGGGGKGGGFGAGGGVGGAAG 198 [233][TOP] >UniRef100_UPI0000F2E662 PREDICTED: similar to CBLL1 protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2E662 Length = 608 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQH 108 P P PPP P PPP PPPPPPPPPPP H +++ Sbjct: 442 PPPLPPPFPPPPPPLPPPPPPPPPPPPGAVSHSMRY 477 [234][TOP] >UniRef100_UPI00003BE6BF hypothetical protein DEHA0G14432g n=1 Tax=Debaryomyces hansenii CBS767 RepID=UPI00003BE6BF Length = 985 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -2 Query: 203 PPPAPKPPPCPEP-PPPPPPPPPPNYHCHHVQHHCHDHN 90 PPP P PP P P PPPP PPP P YH H+ +H+ +DH+ Sbjct: 213 PPPGPPPPGPPPPGPPPPGPPPGPLYHPHYSKHYWNDHS 251 [235][TOP] >UniRef100_UPI000069F105 Formin-like protein 3 (Formin homology 2 domain-containing protein 3). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069F105 Length = 1108 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPPNYHC 123 +P PPP P PPP P PPPPPPPPP P C Sbjct: 607 VPAPPPPPPPPPPPPPPPPPPPPPMPTGKC 636 [236][TOP] >UniRef100_UPI00015DEC3D chromodomain helicase DNA binding protein 3 n=1 Tax=Mus musculus RepID=UPI00015DEC3D Length = 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = -2 Query: 221 PFPLPTPPPAPK---PPPCPEPPPPPPPPPPP 135 P P P PPP P+ PPP P PPPPPPPPPPP Sbjct: 45 PPPPPGPPPLPRRTPPPPLPRPPPPPPPPPPP 76 [237][TOP] >UniRef100_UPI000184A096 Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Canis lupus familiaris RepID=UPI000184A096 Length = 3623 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPP 138 PL PPP P PPP P PPPPPPPPPP Sbjct: 2045 PLQAPPPTPPPPPPPPPPPPPPPPPP 2070 [238][TOP] >UniRef100_B0SVF7 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0SVF7_CAUSK Length = 409 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPP 138 P P P PPP P PPP PEPP PPPPPPP Sbjct: 267 PPPPPPPPPPPPPPPPPEPPAPPPPPPP 294 [239][TOP] >UniRef100_A4TEZ3 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4TEZ3_MYCGI Length = 177 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PP P PPPPPPPPPPP Sbjct: 124 PPPPPPPPPPPPGAPPPPPPPPPPPPP 150 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PPP PPPPPPPPPPP Sbjct: 123 PPPPPPPPPPPPPGAPPPPPPPPPPPP 149 [240][TOP] >UniRef100_A3PW04 U5 snRNP spliceosome subunit-like protein n=1 Tax=Mycobacterium sp. JLS RepID=A3PW04_MYCSJ Length = 137 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P PPP P PP P PPPPPPPPPPP Sbjct: 83 PPPPPPPPPPPPGAPPPPPPPPPPPPP 109 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 212 LPTPPPAPKPPPCPEPPPPPPPPPPP 135 LP PPP P PPP PPPPPPPPPPP Sbjct: 82 LPPPPPPPPPPPPGAPPPPPPPPPPP 107 [241][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = -2 Query: 221 PFPLPTPPPAPKPP--PCPEPPPPPPPPPPPN 132 P P P PPP+P PP P P PPPPPPPPPPP+ Sbjct: 94 PPPPPPPPPSPPPPSPPPPSPPPPPPPPPPPS 125 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPP PPP P PPPPPPPPP P Sbjct: 98 PPPPPSPPPPSPPPPSPPPPPPPPPPPSP 126 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP PPP P PP PPPPPPPP Sbjct: 93 PPPPPPPPPPSPPPPSPPPPSPPPPPPPP 121 [242][TOP] >UniRef100_Q7XHB6 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa RepID=Q7XHB6_ORYSJ Length = 773 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PP P PPP P PP PPPPPPPP Sbjct: 435 PAPSPPAPPPPPPPPAPSPPAPPPPPPPP 463 Score = 54.3 bits (129), Expect = 4e-06 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P+PP P PPP P PP PPPPPPPP Sbjct: 423 PAPSPPAPPPPPPAPSPPAPPPPPPPP 449 [243][TOP] >UniRef100_Q08197 Cysteine-rich extensin-like protein-4 n=1 Tax=Nicotiana tabacum RepID=Q08197_TOBAC Length = 157 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/38 (60%), Positives = 25/38 (65%), Gaps = 5/38 (13%) Frame = -2 Query: 221 PFPLPTP----PPAPKPPPCPEPPPPP-PPPPPPNYHC 123 PFP P P PP P+P PCP PPPPP PPPP P+ C Sbjct: 47 PFPFPRPYPCSPPRPRPRPCPPPPPPPCPPPPAPSSSC 84 [244][TOP] >UniRef100_Q08196 Cysteine-rich extensin-like protein-3 n=1 Tax=Nicotiana tabacum RepID=Q08196_TOBAC Length = 165 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/63 (42%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPP-PPPPNYHCHHVQHHCHDHNESSDFGSFFQGCLTA 45 PFP P P P P P P P PPPPPPP PPPP+ C +ES+ + F Sbjct: 50 PFPFPRPYPCPPPRPRPCPPPPPPPCPPPPSPPPPAPSSSCSASDESNIYRCMFNETKID 109 Query: 44 LCC 36 CC Sbjct: 110 PCC 112 [245][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P+PPPAP PPP P PPP PPPPP P Sbjct: 2128 PPPPPSPPPAPLPPPPPSPPPSPPPPPSP 2156 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P P P+P PPP P PPPP PPPPPP Sbjct: 2068 PLPPPAPSPSPPPPPPPWPPPPSPPPPPP 2096 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPP------PPPPPPP 135 P P+PPP P PPP P PPPP PPPPPPP Sbjct: 2025 PPPSPPPLPSPPPLPSPPPPSPPPLSPPPPPPP 2057 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -2 Query: 221 PFPLPTPPPAPKP-PPCPEPPPPPPPPPPP 135 P P P+PPP P P PP P PPPPPPP PPP Sbjct: 2072 PAPSPSPPPPPPPWPPPPSPPPPPPPAPPP 2101 [246][TOP] >UniRef100_B4KDX8 GI10278 n=1 Tax=Drosophila mojavensis RepID=B4KDX8_DROMO Length = 756 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/53 (45%), Positives = 28/53 (52%), Gaps = 12/53 (22%) Frame = -2 Query: 221 PFPLPTPP------------PAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCH 99 P P P+PP P P PPP PPPPPPPPP P++H HH C+ Sbjct: 258 PAPAPSPPNVIIKRPAHYHPPPPPPPPVFFPPPPPPPPPRPHHHHHHPPPKCN 310 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/53 (49%), Positives = 26/53 (49%), Gaps = 14/53 (26%) Frame = -2 Query: 221 PFPLPTPPPAPKPP-----------PCPEPPPP---PPPPPPPNYHCHHVQHH 105 P P P P PAP PP P P PPPP PPPPPPP HH HH Sbjct: 252 PAPAPAPAPAPSPPNVIIKRPAHYHPPPPPPPPVFFPPPPPPPPPRPHHHHHH 304 [247][TOP] >UniRef100_B3P3J0 GG21917 n=1 Tax=Drosophila erecta RepID=B3P3J0_DROER Length = 573 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -2 Query: 215 PLPTPPPAPKPPPCPEPPPPPPPPPPPNYHCHH 117 P P PPP P PPP P PPPPPP P P+ H HH Sbjct: 150 PAPPPPPPPPPPPPPPPPPPPPSYPHPHPHPHH 182 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = -2 Query: 203 PPPAPKPPPCPEPPPPPPPPPPPNYHCHHVQHH 105 P P P PPP P PPPPPPPPPP H H HH Sbjct: 150 PAPPPPPPPPPPPPPPPPPPPPSYPHPHPHPHH 182 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -2 Query: 197 PAPKPPPCPEPPPPPPPPPPPNYHCHHVQHHCH 99 PAP PPP P PPPPPPPPPPP + H H H Sbjct: 150 PAPPPPPPPPPPPPPPPPPPPPSYPHPHPHPHH 182 [248][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 221 PFPLPTPPPAPKPPPCPEPPPPPPPPPPP 135 P P P PPP P PP PPPPPPPPPPP Sbjct: 150 PLPQPPPPPPPPPPASAPPPPPPPPPPPP 178 [249][TOP] >UniRef100_UPI0000DB6D2F PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6D2F Length = 143 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG G GGG G GGGVG G G Sbjct: 8 GGGGGGGGGGGGGGGGGGGGGGGVGGGGG 36 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +1 Query: 133 LGGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 +GGGGGGGGGGG G GGG G GGG G G G Sbjct: 1 MGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 30 [250][TOP] >UniRef100_UPI0000DC1359 UPI0000DC1359 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DC1359 Length = 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 136 GGGGGGGGGGGSGHGGGFGAGGGVGSGNG 222 GGGGGGGGGGG GHGGG G GGG G G G Sbjct: 21 GGGGGGGGGGGGGHGGGRGGGGGGGGGCG 49