[UP]
[1][TOP] >UniRef100_O22612 Dormancy-associated protein n=1 Tax=Pisum sativum RepID=O22612_PEA Length = 129 Score = 71.6 bits (174), Expect = 3e-11 Identities = 34/41 (82%), Positives = 34/41 (82%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG----GGGGYHNGGGG--GGGG 1 GYNGGGGYHN GGGGYHNGG GGGGYHNGGGG GGGG Sbjct: 78 GYNGGGGYHN-GGGGYHNGGGGYNGGGGYHNGGGGYHGGGG 117 Score = 67.8 bits (164), Expect = 4e-10 Identities = 33/47 (70%), Positives = 34/47 (72%), Gaps = 12/47 (25%) Frame = -3 Query: 105 GYNGGGGYHNG-----GGGGYHNGG----GGGGYHNGGGG---GGGG 1 GY+ GGGYHNG GGGGYHNGG GGGGYHNGGGG GGGG Sbjct: 52 GYHNGGGYHNGGGGYNGGGGYHNGGGGYNGGGGYHNGGGGYHNGGGG 98 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/39 (71%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = -3 Query: 102 YNGGGGYHNG-----GGGGYHNGGGGGGYHNGGGGGGGG 1 +NGGGGYHNG GGGGYHN GGGGYH GGG GG G Sbjct: 86 HNGGGGYHNGGGGYNGGGGYHN--GGGGYHGGGGHGGHG 122 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 GYNGGGGYHN GGGGYH GGG GG H G G Sbjct: 98 GYNGGGGYHN-GGGGYHGGGGHGG-HGGASNNG 128 [2][TOP] >UniRef100_A0R4Q4 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis str. MC2 155 RepID=A0R4Q4_MYCS2 Length = 93 Score = 70.1 bits (170), Expect = 7e-11 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW---*PPPPPLW*PPPP 97 PPPPPPPP W PPPPPP+W PPPPP W PPPP Sbjct: 51 PPPPPPPPFWRPPPPPPIWLPPPPPPPPFWGPPPP 85 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 5/37 (13%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPP----LW*PPPPP-LW*PPPP 97 PPPPPPPP W PPPPPP W PPPPP +W PPPP Sbjct: 38 PPPPPPPPFWGPPPPPPPPPPFWRPPPPPPIWLPPPP 74 [3][TOP] >UniRef100_B4NCX9 GK10119 n=1 Tax=Drosophila willistoni RepID=B4NCX9_DROWI Length = 201 Score = 70.1 bits (170), Expect = 7e-11 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 H G GGGGYH GGGGG + GGGGGGYH GGGGGGG Sbjct: 104 HHGGGGGGGYHGGGGGGGYPGGGGGGYHGGGGGGGG 139 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 4/38 (10%) Frame = -3 Query: 102 YNGGGGYHN--GGGGGYHNGGGGGGYHNGGGGG--GGG 1 Y GGGG H+ GGGGGYH GGGGGGY GGGGG GGG Sbjct: 97 YQGGGGGHHGGGGGGGYHGGGGGGGYPGGGGGGYHGGG 134 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYH-NGGGGGGYHNGGGGGGGG 1 + G GGGGY GGGGGYH GGGGGGY GGGGG G Sbjct: 113 YHGGGGGGGYPGGGGGGYHGGGGGGGGYPQWGGGGGSG 150 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 14/47 (29%) Frame = -3 Query: 105 GYNGGGG--------------YHNGGGGGYHNGGGGGGYHNGGGGGG 7 G+ GGGG + GGGGG+H GGGGGGYH GGGGGG Sbjct: 75 GHGGGGGGRGGTTIDVYVVKPVYQGGGGGHHGGGGGGGYHGGGGGGG 121 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG+ GGGG Y +GGGGG Y +GGGGGG G Sbjct: 50 GGGGGGGWGGGGGGNYGHGGGGGNYGHGGGGGGRG 84 [4][TOP] >UniRef100_P37703 Glycine-rich protein DC9.1 n=1 Tax=Daucus carota RepID=GRP9_DAUCA Length = 144 Score = 69.7 bits (169), Expect = 1e-10 Identities = 34/47 (72%), Positives = 34/47 (72%), Gaps = 11/47 (23%) Frame = -3 Query: 108 EGYNGGGGYHNGG-----GGGYHNGGG----GGGYHNGGGG--GGGG 1 EGYN GGGYHNGG GGGYHNGGG GGGYHNGGGG GGG Sbjct: 36 EGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 82 Score = 67.8 bits (164), Expect = 4e-10 Identities = 33/46 (71%), Positives = 33/46 (71%), Gaps = 11/46 (23%) Frame = -3 Query: 105 GYNGGGGYHNGGGG-----GYHNGGG----GGGYHNGGGG--GGGG 1 GYN GGGYHNGGGG GYHNGGG GGGYHNGGGG GGG Sbjct: 50 GYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 95 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/46 (69%), Positives = 33/46 (71%), Gaps = 11/46 (23%) Frame = -3 Query: 105 GYNGGGGYHNGG-----GGGYHNGGG----GGGYHNGGGG--GGGG 1 GYN GGGYHNGG GGGYHNGGG GGG+HNGGGG GGG Sbjct: 63 GYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGGHHNGGGGYNNGGG 108 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG----GGGGYHNGGGGGGGG 1 GYN GGGYHN GGGGY+NGG GGGGY+NGGG GGG Sbjct: 76 GYNNGGGYHN-GGGGYNNGGGHHNGGGGYNNGGGHHGGG 113 [5][TOP] >UniRef100_P11898 Glycine-rich protein HC1 n=1 Tax=Chenopodium rubrum RepID=GRP1_CHERU Length = 144 Score = 69.7 bits (169), Expect = 1e-10 Identities = 34/47 (72%), Positives = 34/47 (72%), Gaps = 11/47 (23%) Frame = -3 Query: 108 EGYNGGGGYHNGG-----GGGYHNGGG----GGGYHNGGGG--GGGG 1 EGYN GGGYHNGG GGGYHNGGG GGGYHNGGGG GGG Sbjct: 36 EGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 82 Score = 67.8 bits (164), Expect = 4e-10 Identities = 33/46 (71%), Positives = 33/46 (71%), Gaps = 11/46 (23%) Frame = -3 Query: 105 GYNGGGGYHNGGGG-----GYHNGGG----GGGYHNGGGG--GGGG 1 GYN GGGYHNGGGG GYHNGGG GGGYHNGGGG GGG Sbjct: 50 GYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 95 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/46 (69%), Positives = 33/46 (71%), Gaps = 11/46 (23%) Frame = -3 Query: 105 GYNGGGGYHNGG-----GGGYHNGGG----GGGYHNGGGG--GGGG 1 GYN GGGYHNGG GGGYHNGGG GGG+HNGGGG GGG Sbjct: 63 GYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGGHHNGGGGYNNGGG 108 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG----GGGGYHNGGGGGGGG 1 GYN GGGYHN GGGGY+NGG GGGGY+NGGG GGG Sbjct: 76 GYNNGGGYHN-GGGGYNNGGGHHNGGGGYNNGGGYHGGG 113 [6][TOP] >UniRef100_A7YFB9 Glycine-rich protein n=1 Tax=Lilium formosanum RepID=A7YFB9_9LILI Length = 135 Score = 67.4 bits (163), Expect = 5e-10 Identities = 31/41 (75%), Positives = 31/41 (75%), Gaps = 9/41 (21%) Frame = -3 Query: 105 GYNGGGGYHNGGG-----GGYHNG----GGGGGYHNGGGGG 10 GY GGGGYHNGGG GGYHNG GGGGGYHNGGGGG Sbjct: 57 GYPGGGGYHNGGGYQGGGGGYHNGGGYQGGGGGYHNGGGGG 97 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/41 (75%), Positives = 32/41 (78%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG----GGGYHNGGG--GGGGG 1 GY+GGGGY GGGGYHNGGG GGGYHNGGG GGGGG Sbjct: 51 GYSGGGGYP--GGGGYHNGGGYQGGGGGYHNGGGYQGGGGG 89 [7][TOP] >UniRef100_B4JMZ8 GH24721 n=1 Tax=Drosophila grimshawi RepID=B4JMZ8_DROGR Length = 207 Score = 67.4 bits (163), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 H G GGGGYH GGGGGYH GGGGGGYH GGGGGG G Sbjct: 68 HPG-GGGGGYHGGGGGGYH-GGGGGGYHGGGGGGGYG 102 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 GY GGGG H GGGGG H GGGGGGYH GGGGG GGG Sbjct: 52 GYGGGGGGHPGGGGGGHPGGGGGGYHGGGGGGYHGGG 88 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 5/41 (12%) Frame = -3 Query: 111 HEGYNGGGGYHNG--GGGGYHNGG---GGGGYHNGGGGGGG 4 ++G GGGGYH G GGGGYH GG GGGGYH GGGGGGG Sbjct: 116 YQGGGGGGGYHGGGAGGGGYHGGGGGVGGGGYHGGGGGGGG 156 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/39 (74%), Positives = 30/39 (76%), Gaps = 2/39 (5%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 H G GGGG+ GGGGGYH GGGGGGYH GGGGG GGG Sbjct: 60 HPG-GGGGGHPGGGGGGYH-GGGGGGYHGGGGGGYHGGG 96 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 4/41 (9%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGG----GYHNGGGGGGYHNGGGGGGGG 1 H G GGGGYH GGGG GYH GGGGGG GGGGGG Sbjct: 126 HGGGAGGGGYHGGGGGVGGGGYHGGGGGGGGPQCCGGGGGG 166 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/54 (51%), Positives = 29/54 (53%), Gaps = 17/54 (31%) Frame = -3 Query: 111 HEGYNGGGGYHN----------------GGGGGYHNGG-GGGGYHNGGGGGGGG 1 + G GGGGY GGGGGYH GG GGGGYH GGGG GGG Sbjct: 92 YHGGGGGGGYGRKPTIEVYVVKPVYQGGGGGGGYHGGGAGGGGYHGGGGGVGGG 145 [8][TOP] >UniRef100_Q2PF07 Putative uncharacterized protein (Fragment) n=1 Tax=Trifolium pratense RepID=Q2PF07_TRIPR Length = 149 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/37 (75%), Positives = 30/37 (81%), Gaps = 3/37 (8%) Frame = -3 Query: 102 YNGGGGYHNGGGGGYHNGGG---GGGYHNGGGGGGGG 1 +NGGG YHNGGG GYHNGGG GGGYH+GGG GG G Sbjct: 100 HNGGGSYHNGGGSGYHNGGGYHNGGGYHHGGGHGGHG 136 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/43 (69%), Positives = 31/43 (72%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG-----GGGYHNGGG---GGGGG 1 GY+GG GYHNGGG YHNGGG GGGYHNGGG GGG G Sbjct: 92 GYHGGSGYHNGGGS-YHNGGGSGYHNGGGYHNGGGYHHGGGHG 133 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY+ GGGYHN GGGYH+GGG GG H GGG GG G Sbjct: 113 GYHNGGGYHN--GGGYHHGGGHGG-HGGGGHGGHG 144 [9][TOP] >UniRef100_Q1IRT5 Putative uncharacterized protein n=1 Tax=Candidatus Koribacter versatilis Ellin345 RepID=Q1IRT5_ACIBL Length = 315 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG--GGGG 1 G GGGG+H GGGGG+H GGGGGG+H GGGG GGGG Sbjct: 48 GGGGGGGFHGGGGGGFHGGGGGGGFHGGGGGFHGGGG 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGG---GGGGGG 1 G++GGGG ++GGGG YH GG GGGYH G GG GGG Sbjct: 78 GFHGGGGGYHGGGGAYHGGGYGGGYHGAGAYHGGYGGG 115 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 93 GGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 GGG+ GGGGG+H GGGGGG+H GGGGGG Sbjct: 44 GGGHGGGGGGGFH-GGGGGGFHGGGGGGG 71 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 G++GGGG +GGGGGYH GGGG YH GG GGG Sbjct: 71 GFHGGGGGFHGGGGGYH--GGGGAYHGGGYGGG 101 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 3/35 (8%) Frame = -3 Query: 96 GGGGYH-NGGGGGYHNGGGGGGYHNGGGG--GGGG 1 GGGG+H GGGGG+H GGGGG+H GGGG GGGG Sbjct: 59 GGGGFHGGGGGGGFH--GGGGGFHGGGGGYHGGGG 91 [10][TOP] >UniRef100_Q20BN3 GBR5-like protein n=1 Tax=Panax ginseng RepID=Q20BN3_PANGI Length = 129 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 7/42 (16%) Frame = -3 Query: 105 GYNGGGGYHNG----GGGGYHNGG---GGGGYHNGGGGGGGG 1 GY+GGGGYH G GGGGYH GG GGGGYH GGG GGGG Sbjct: 59 GYHGGGGYHGGGGYHGGGGYHGGGGYHGGGGYHGGGGHGGGG 100 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/40 (72%), Positives = 29/40 (72%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNG--GGGYHNGGGGGYHNGGG---GGGYHNGGGGGGGG 1 GYNG GGGYH GGGGYH GGG GGGYH GGG GGG Sbjct: 51 GYNGYGGGGYH--GGGGYHGGGGYHGGGGYHGGGGYHGGG 88 [11][TOP] >UniRef100_B3MYN1 GF22178 n=1 Tax=Drosophila ananassae RepID=B3MYN1_DROAN Length = 223 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG----GGGGYHNGGGGG--GGG 1 G+NGGGG +NGGGGGYH GG GGGGYH GGGGG GGG Sbjct: 59 GFNGGGGGYNGGGGGYHGGGGGYNGGGGYHGGGGGGNYGGG 99 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGG 10 GYNGGGGYH GGGGG + GGGGGGYH GGGGG Sbjct: 80 GYNGGGGYHGGGGGGNY-GGGGGGYHGGGGGG 110 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 G GGGGYH GGGGGY GGGGGGYH GGGGGG Sbjct: 141 GGGGGGGYHGGGGGGYP-GGGGGGYHGGGGGGG 172 Score = 63.2 bits (152), Expect = 9e-09 Identities = 28/37 (75%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGG--YHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY+GGGG Y GGGGGYH GGGGGG GGGGGGGG Sbjct: 147 GYHGGGGGGYPGGGGGGYHGGGGGGGPQWGGGGGGGG 183 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/43 (69%), Positives = 30/43 (69%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGG-YHNGGGG-----GYHNGGGGGGYHNGGGG--GGGG 1 GYNGGGG YH GGGG GYH GGGGG Y GGGG GGGG Sbjct: 66 GYNGGGGGYHGGGGGYNGGGGYHGGGGGGNYGGGGGGYHGGGG 108 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 4/37 (10%) Frame = -3 Query: 99 NGGGGYHN--GGGGGYHNGGGGGGYHNGGGGG--GGG 1 +GGGG H GGGGG + GGGGGGYH GGGGG GGG Sbjct: 124 SGGGGGHRWGGGGGGGYGGGGGGGYHGGGGGGYPGGG 160 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGG--GGGG 1 GGGG NGGGGGY+ GGGGGYH GGGG GGGG Sbjct: 55 GGGGGFNGGGGGYN--GGGGGYHGGGGGYNGGGG 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/37 (67%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 G GGGG+ GGGGG+ GGGGGG NGGGGG GGG Sbjct: 35 GGGGGGGWGGGGGGGFGWGGGGGGGFNGGGGGYNGGG 71 [12][TOP] >UniRef100_Q7Y087 GBR5 n=1 Tax=Panax ginseng RepID=Q7Y087_PANGI Length = 123 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/38 (76%), Positives = 30/38 (78%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG---GGGGYHNGGGGGGGG 1 GY+GGGGYH GGGGYH GG GGGGYH GGG GGGG Sbjct: 59 GYHGGGGYH--GGGGYHGGGGYHGGGGYHGGGGHGGGG 94 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/40 (72%), Positives = 29/40 (72%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNG--GGGYHNGGGGGYHNGGG---GGGYHNGGGGGGGG 1 GYNG GGGYH GGGGYH GGG GGGYH GGG GGG Sbjct: 51 GYNGYGGGGYH--GGGGYHGGGGYHGGGGYHGGGGYHGGG 88 [13][TOP] >UniRef100_B4H321 GL13352 n=1 Tax=Drosophila persimilis RepID=B4H321_DROPE Length = 191 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+NGGGGY +GGGGG+HNGGGGGG GGGGGG G Sbjct: 110 GHNGGGGYPSGGGGGFHNGGGGGG---GGGGGGSG 141 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G NGGGG HNGGGG + GGGGG+HNGGGGGGGG Sbjct: 104 GGNGGGG-HNGGGG--YPSGGGGGFHNGGGGGGGG 135 [14][TOP] >UniRef100_B8ESL3 Putative uncharacterized protein n=1 Tax=Methylocella silvestris BL2 RepID=B8ESL3_METSB Length = 169 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG-GGGYHNGGGGGGGG 1 G+NGGGG +GGGGG+H GGG GGG+H GGGG GGG Sbjct: 116 GWNGGGGNWHGGGGGWHGGGGHGGGWHGGGGGHGGG 151 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 4/38 (10%) Frame = -3 Query: 102 YNGGGGYHNGG--GGGYHNGGG--GGGYHNGGGGGGGG 1 + GGGG+H GG GGG+H GGG GGG H GGG GGGG Sbjct: 125 HGGGGGWHGGGGHGGGWHGGGGGHGGGGHGGGGHGGGG 162 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 H G GGG+H GGGGG+ GG GGG H GGG GGGG Sbjct: 132 HGGGGHGGGWH-GGGGGHGGGGHGGGGHGGGGHGGGG 167 [15][TOP] >UniRef100_A2C5L0 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9303 RepID=A2C5L0_PROM3 Length = 202 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGGGGGGG Sbjct: 105 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGGGGG 137 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGG GGGGGGG Sbjct: 112 GYGGGGGGYGGGGGGYGGGGGGGGGGGYGGGGGGG 146 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 91 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 123 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY GGGG + GGGG GGGGGGY GGGGGGG Sbjct: 119 GYGGGGGGYGGGGG----GGGGGGYGGGGGGGGG 148 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 87 GGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 116 [16][TOP] >UniRef100_A5GHM5 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. WH 7803 RepID=A5GHM5_SYNPW Length = 207 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG + GGGGGY++GGGGGGY GGGG GGG Sbjct: 92 GGGGGGGGYRGGGGGYNDGGGGGGYRGGGGGYGGG 126 [17][TOP] >UniRef100_Q2H6U7 Putative uncharacterized protein n=1 Tax=Chaetomium globosum RepID=Q2H6U7_CHAGB Length = 430 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGG+ GGGGGGY+ GGG GGGG Sbjct: 38 GGGGGGGYSGGGGGGHGGGGGGGGYNGGGGKGGGG 72 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG ++GGGGG H GGGGGG +NGGGG GGG Sbjct: 37 GGGGGGGGYSGGGGGGHGGGGGGGGYNGGGGKGGG 71 [18][TOP] >UniRef100_UPI0001552F36 PREDICTED: similar to SH3 domain binding protein n=1 Tax=Mus musculus RepID=UPI0001552F36 Length = 455 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPPL PPPPPL PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPP 35 [19][TOP] >UniRef100_UPI0001552DAA PREDICTED: similar to CR16 n=1 Tax=Mus musculus RepID=UPI0001552DAA Length = 483 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPPL PPPPPL PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPP 35 [20][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY GGGGGGY GGGG GGG Sbjct: 104 GYGGGGGYGGGGGGGY--GGGGGGYGGGGGGYGGG 136 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 118 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGSGGG 150 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGY-----HNGGGGGGYHNGGGGGGGG 1 G+ GGGG GGGGGY + GGGGGGY GGGG GGG Sbjct: 90 GFGGGGGGFGGGGGGYGGGGGYGGGGGGGYGGGGGGYGGG 129 [21][TOP] >UniRef100_Q9VD49 CG5778, isoform A n=1 Tax=Drosophila melanogaster RepID=Q9VD49_DROME Length = 117 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 102 YNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 Y GG G GGGGGY+ GGGGGGY+NGGGGGGGG Sbjct: 42 YTGGNG-GRGGGGGYNAGGGGGGYYNGGGGGGGG 74 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/50 (58%), Positives = 31/50 (62%), Gaps = 15/50 (30%) Frame = -3 Query: 105 GYNGGGGYH-NGGGGGYHNGGGGGG--------------YHNGGGGGGGG 1 G GGGGY+ GGGGGY+NGGGGGG Y NGGGGGGGG Sbjct: 48 GRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGG 97 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 18/52 (34%) Frame = -3 Query: 105 GYN---GGGGYHNGGGGG---------------YHNGGGGGGYHNGGGGGGG 4 GYN GGGGY+NGGGGG Y NGGGGGG GGGGGGG Sbjct: 54 GYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGG 105 [22][TOP] >UniRef100_P0C7L0-2 Isoform 2 of WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=P0C7L0-2 Length = 451 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPPL PPPPPL PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPP 35 [23][TOP] >UniRef100_P0C7L0 WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=WIPF3_MOUSE Length = 485 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPPL PPPPPL PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPP 35 [24][TOP] >UniRef100_Q09134 Abscisic acid and environmental stress-inducible protein n=1 Tax=Medicago sativa subsp. falcata RepID=GRPA_MEDFA Length = 159 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-----GGGGYHNGGGG---GGGG 1 GYN GGG +N GGGGY+NGG GGGGY+NGGGG GGGG Sbjct: 72 GYNNGGGGYNHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGGG 114 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/43 (69%), Positives = 32/43 (74%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-----GGGGYHNGGGG---GGGG 1 GYN GGGY N GGGGY+NGG GGGGY+NGGGG GGGG Sbjct: 59 GYNNGGGY-NHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGGG 100 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 7/42 (16%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG----GGGGYHNGGGG---GGGG 1 GYNGGG +N GGGGY+NGG GGGGY+NGGGG GGGG Sbjct: 47 GYNGGG--YNHGGGGYNNGGGYNHGGGGYNNGGGGYNHGGGG 86 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/43 (62%), Positives = 32/43 (74%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-----GGGGYHNGGGG---GGGG 1 GYN GGG +N GGGGY++GG GGGGY++GGGG GGGG Sbjct: 65 GYNHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGGGYNNGGGG 107 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/48 (58%), Positives = 32/48 (66%), Gaps = 13/48 (27%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG----------GGGYHNGGGG---GGGG 1 GYN GGG +N GGGGY+NGGG GGGY++GGGG GGGG Sbjct: 86 GYNNGGGGYNHGGGGYNNGGGGYNHGGGGYNGGGYNHGGGGYNHGGGG 133 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGG-----GGYHNGGGGGGGG 1 GYN GGG +N GGGGY++GGGG GGY++GGGG GG Sbjct: 79 GYNHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGGGYNGG 118 [25][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGG + GGGGGGY GGGGG GG Sbjct: 122 GYGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGYGG 156 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGGGGY GGGGG GG Sbjct: 131 GGGGGGGYGGGGGGGY-GGGGGGGYGGGGGGGYGG 164 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G GGGGY GGGGGY GGGGGG + GGGGGGG Sbjct: 139 GGGGGGGYGGGGGGGY--GGGGGGGYGGGGGGGG 170 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGG + GGGGGY GGGGGGY GGGGG GG Sbjct: 118 GGGGGYGGGGGGY-GGGGGGGYGGGGGGGYGG 148 [26][TOP] >UniRef100_Q6YNS1 Putative glycine-rich RNA-binding protein n=1 Tax=Prunus avium RepID=Q6YNS1_PRUAV Length = 178 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNGGGGY-----HNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY GGGGGGY +GGGG GGG Sbjct: 108 GYGGGGGYGGGGRREGGGGGYSRGGGGGGYGSGGGGYGGG 147 [27][TOP] >UniRef100_B4IZJ4 GH14508 n=1 Tax=Drosophila grimshawi RepID=B4IZJ4_DROGR Length = 272 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGG----GGGGGG 1 GY GGGGY GGGGG + GGGGGGY GG GGGGGG Sbjct: 69 GYGGGGGYGGGGGGGGYGGGGGGGYGGGGDSGYGGGGGG 107 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGGY GGGGGY GGGGGGY GGGGG GG Sbjct: 66 GGGGY--GGGGGYGGGGGGGGYGGGGGGGYGG 95 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGG-GYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGG GGGGGY GGGGGGY GGG GGGG Sbjct: 140 GYGGGGWASGGGGGGGYGGGGGGGGYGGGGGYGGGG 175 [28][TOP] >UniRef100_UPI00017466C4 RNA-binding protein (RRM domain) n=1 Tax=Verrucomicrobium spinosum DSM 4136 RepID=UPI00017466C4 Length = 158 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY+GGGG GGGGGY GGGGGGY GGGGGGG Sbjct: 97 GYSGGGG---GGGGGYKGGGGGGGYKGGGGGGGG 127 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGY--HNGGGGGGYHNGGGGGGGG 1 ++G GGGGY GGGGG + GGGGGG + GGGGGGGG Sbjct: 89 YKGGGGGGGYSGGGGGGGGGYKGGGGGGGYKGGGGGGGG 127 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGG GGGGGY GGGGGGY GGGGGGGG Sbjct: 80 GGGA---GGGGGYKGGGGGGGYSGGGGGGGGG 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/34 (70%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = -3 Query: 105 GYNGGGGYH-NGGGGGYHNGGGGGGYHNGGGGGG 7 G GGGGY GGGGGY GGGGGG + GGGGGG Sbjct: 102 GGGGGGGYKGGGGGGGYKGGGGGGGGYKGGGGGG 135 [29][TOP] >UniRef100_A6RXS7 Putative uncharacterized protein n=1 Tax=Botryotinia fuckeliana B05.10 RepID=A6RXS7_BOTFB Length = 197 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGG----GGYHNGGGGGGYHNGGGGG--GGG 1 GY+GGGGY GGG GGY+ GGGGGGY GGGGG GGG Sbjct: 139 GYSGGGGYSGGGGYSGGGGYNGGGGGGGYSGGGGGGYSGGG 179 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/41 (60%), Positives = 29/41 (70%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGG------GGGGG 1 GY+GGGGY+ GGGGG ++GGGGGGY GGG GG G Sbjct: 151 GYSGGGGYNGGGGGGGYSGGGGGGYSGGGGYDRNQSGGNAG 191 [30][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP++ PPPPPP PPPPP++ PPPP Sbjct: 440 PPPPPPPPVYSPPPPPPP--PPPPPVYSPPPP 469 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP++ PPPPPP PPPPP++ PPPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPP-PPPPPVYSPPPPSPP 488 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 5 PPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPP++ PPPPPP PPPPP++ PPPP Sbjct: 487 PPPPPPPVYSPPPPPPP--PPPPPVYSPPPP 515 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP++ PPPP P PPPPP++ PPPP Sbjct: 471 PPPPPPPPVYSPPPPSPP--PPPPPVYSPPPP 500 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPP PPPP++ PPPPPP PPPP++ PPPP Sbjct: 427 PPPSPPPPVYSPPPPPP----PPPPVYSPPPP 454 [31][TOP] >UniRef100_A8W7L0 Putative RNA helicase n=1 Tax=Phytophthora infestans RepID=A8W7L0_PHYIN Length = 544 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG ++GGGGGY GGGGGGY GG GGGGG Sbjct: 42 GYGGGGGGYSGGGGGY--GGGGGGYSGGGRGGGGG 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY+GGGG + GGGGGY GG GGG GGG GGGG Sbjct: 49 GYSGGGGGYGGGGGGYSGGGRGGG--GGGGFGGGG 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGG---GYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGG G GGGGGY GGGGGGY GGGG GGG Sbjct: 25 GYGGGGYGGGSRGGGGGGY--GGGGGGYSGGGGGYGGG 60 [32][TOP] >UniRef100_UPI0001B58635 hypothetical protein StAA4_25414 n=1 Tax=Streptomyces sp. AA4 RepID=UPI0001B58635 Length = 326 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP PPPPPP+ PPPPP+ PPPP+ Sbjct: 242 PPPPPPPPPTPPPPPPPVTAPPPPPVSPPPPPV 274 [33][TOP] >UniRef100_B2ICA8 Putative uncharacterized protein n=1 Tax=Beijerinckia indica subsp. indica ATCC 9039 RepID=B2ICA8_BEII9 Length = 152 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGGG +GGGGG+H GGGGGG+H GGGG GGG Sbjct: 115 GWRGGGGGWHGGGGGWH-GGGGGGWHGGGGGHGGG 148 [34][TOP] >UniRef100_Q8GVD4 Glycine-rich protein n=1 Tax=Lilium hybrid division VII RepID=Q8GVD4_9LILI Length = 138 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/41 (73%), Positives = 30/41 (73%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG----GGGGGYHNGGGG--GGGG 1 GYN GGGY GGGGGYHNG GGGGGY GGGG GGGG Sbjct: 52 GYNNGGGYP-GGGGGYHNGGGYPGGGGGYPGGGGGYPGGGG 91 Score = 57.0 bits (136), Expect = 6e-07 Identities = 29/43 (67%), Positives = 29/43 (67%), Gaps = 11/43 (25%) Frame = -3 Query: 105 GY-NGGGGYHN-----GGGGGYHNG-----GGGGGYHNGGGGG 10 GY GGGGYHN GGGGGY G GGGGGYHNGGGGG Sbjct: 58 GYPGGGGGYHNGGGYPGGGGGYPGGGGGYPGGGGGYHNGGGGG 100 [35][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 5 PPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPP++ PPPPPP++ PPPPP PPPP Sbjct: 281 PPPPPPPVYSPPPPPPVYSPPPPPPSPPPPP 311 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +2 Query: 8 PPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPP++ PPPPPP PPPPP++ PPPP Sbjct: 291 PPPPPPVYSPPPPPPSPPPPPPPVYSPPPP 320 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 28/34 (82%), Gaps = 2/34 (5%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPP-LW-*PPPPPLW*PPPP 97 PPP PPPP++ PPPPPP ++ PPPPP++ PPPP Sbjct: 270 PPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPP 303 [36][TOP] >UniRef100_B4N419 GK25112 n=1 Tax=Drosophila willistoni RepID=B4N419_DROWI Length = 258 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = -3 Query: 111 HEGYNGGGGY-HNGGGGG---YHNGGGGGGYHNGGGGGGGG 1 H GY+GGGG H+ GGGG Y GGGGGGY GGGGGGGG Sbjct: 28 HGGYSGGGGSSHSAGGGGGYSYGGGGGGGGYSYGGGGGGGG 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYH---NGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGG H +GGGG H+ GGGGGY GGGGGGGG Sbjct: 20 GGGGGGSSHGGYSGGGGSSHSAGGGGGYSYGGGGGGGG 57 [37][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG--GGGG 1 GY GGGG + GGGGG + GGGGGGY GGGG GGGG Sbjct: 93 GYGGGGGGYGGGGGGGYGGGGGGGYGGGGGGRSGGGG 129 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG +GGGGGY GGGGGG GGGGGG G Sbjct: 116 GYGGGGGGRSGGGGGY--GGGGGGRSGGGGGGGDG 148 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 99 NGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 +GGGGY GGGGG + GGGGGGY GGGGG GG Sbjct: 89 SGGGGY--GGGGGGYGGGGGGGYGGGGGGGYGG 119 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGGGG GGGG GGG Sbjct: 102 GGGGGGGYGGGGGGGY--GGGGGGRSGGGGGYGGG 134 [38][TOP] >UniRef100_A3PW04 U5 snRNP spliceosome subunit-like protein n=1 Tax=Mycobacterium sp. JLS RepID=A3PW04_MYCSJ Length = 137 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP PPPPPP PPPPP++ PPPP+ Sbjct: 86 PPPPPPPPPGAPPPPPPPPPPPPPPVYVPPPPV 118 [39][TOP] >UniRef100_B7PGI0 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PGI0_IXOSC Length = 136 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-GGGGYHNGGGGGGGG 1 G NGGGGY NG GGGY GG GGGGY NG GGG GG Sbjct: 98 GGNGGGGYGNGNGGGYGGGGNGGGGYGNGNGGGYGG 133 [40][TOP] >UniRef100_B5DKG6 GA22867 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DKG6_DROPS Length = 191 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G NGGGG HNGGGG + GGGGG+HNGGGGGGGG Sbjct: 107 GGNGGGG-HNGGGG--YPSGGGGGFHNGGGGGGGG 138 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGG 10 G+NGGGGY +GGGGG+HNGGGGGG GGG G Sbjct: 113 GHNGGGGYPSGGGGGFHNGGGGGG---GGGSG 141 [41][TOP] >UniRef100_B3MYN0 GF22177 n=1 Tax=Drosophila ananassae RepID=B3MYN0_DROAN Length = 131 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 7/42 (16%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG-------YHNGGGGGGYHNGGGGGGGG 1 G NGGGG H GGGGG + GGGGGG H GGGGGGGG Sbjct: 84 GGNGGGGKHGGGGGGGNGGGGKHGGGGGGGGKHGGGGGGGGG 125 [42][TOP] >UniRef100_A7EC48 Glycine-rich RNA-binding protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7EC48_SCLS1 Length = 193 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGG---GGGYHNGGGGGGYHNGGGGG---GGG 1 GY+GGGGY GG GGG +NGGGGGGY GGGGG GGG Sbjct: 137 GYSGGGGYSGGGGYSGGGGYNGGGGGGYSGGGGGGYSSGGG 177 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGG---GGGGG 1 GY+GGGGY+ GGGGGY +GGGGGGY +GGG G GGG Sbjct: 149 GYSGGGGYNGGGGGGY-SGGGGGGYSSGGGYDRGQGGG 185 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG---GGGGYHNGGG--GGGGG 1 GY GG GY N GGGY GG GGGGY GGG GGGGG Sbjct: 123 GYGGGRGYDNNSGGGYSGGGGYSGGGGYSGGGGYNGGGGG 162 [43][TOP] >UniRef100_UPI000180C465 PREDICTED: similar to cold-inducible RNA-binding protein n=1 Tax=Ciona intestinalis RepID=UPI000180C465 Length = 167 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGG GGGG Sbjct: 108 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGYGGGG 140 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 102 YNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 Y GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 102 YGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 133 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 94 GGRGGGGRYGGGGGGY--GGGGGGYGGGGGGYGGG 126 [44][TOP] >UniRef100_UPI00016C5334 RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C5334 Length = 137 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 99 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 131 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGGY GGGGGGY GGGG GGG Sbjct: 85 GGGGGGGRRGGGGGGY--GGGGGGYGGGGGGYGGG 117 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 95 GGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 124 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 GY GGGG + GGGGGY GGGGGGY GGGGGG Sbjct: 106 GYGGGGGGYGGGGGGY--GGGGGGY--GGGGGG 134 [45][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW-*PPPPPLW*PPPP 97 PPPPPPPP + PPPPPP + PPPPP + PPPP Sbjct: 332 PPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPP 364 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +2 Query: 8 PPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPP + PPPPPP + PPPPP + PPPP Sbjct: 90 PPPPPPAYAPPPPPPAYAPPPPPAYAPPPP 119 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 3/35 (8%) Frame = +2 Query: 2 PPPPP---PPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPP PPP PPPPPP + PPPPP + PPPP Sbjct: 131 PPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPP 165 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 3/35 (8%) Frame = +2 Query: 2 PPPPP---PPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPP PPP PPPPPP + PPPPP + PPPP Sbjct: 154 PPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPP 188 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 3/35 (8%) Frame = +2 Query: 2 PPPPP---PPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPP PPP PPPPPP + PPPPP + PPPP Sbjct: 177 PPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPP 211 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 3/35 (8%) Frame = +2 Query: 2 PPPPP---PPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPP PPP PPPPPP + PPPPP + PPPP Sbjct: 200 PPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPP 234 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 3/35 (8%) Frame = +2 Query: 2 PPPPP---PPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPP PPP PPPPPP + PPPPP + PPPP Sbjct: 108 PPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPP 142 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP + PPPPP PPPPP PPPP Sbjct: 143 PPPPPPPPAYGPPPPPAYGPPPPPP---PPPP 171 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP + PPPPP PPPPP PPPP Sbjct: 166 PPPPPPPPAYGPPPPPAYGPPPPPP---PPPP 194 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP + PPPPP PPPPP PPPP Sbjct: 189 PPPPPPPPAYGPPPPPAYGPPPPPP---PPPP 217 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP + PPPPP PPPPP PPPP Sbjct: 212 PPPPPPPPAYGPPPPPAYGPPPPPP---PPPP 240 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPP + PPPPP PPPP Sbjct: 119 PPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPP 150 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPP + PPPPP PPPP Sbjct: 142 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 173 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPP + PPPPP PPPP Sbjct: 165 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 196 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPP + PPPPP PPPP Sbjct: 188 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 219 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPP + PPPPP PPPP Sbjct: 211 PPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPP 242 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPP + PPPPP PPPP Sbjct: 249 PPPPPPPPAAYGPPPPPAYGPPPPP---PPPP 277 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 8 PPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPP PPPPPP + PPPPP + PPPP Sbjct: 286 PPPPPP---PPPPPPAYSPPPPPAYGPPPP 312 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW--*PPPPPLW*PPPP 97 PPPPPPPP + PPPPP PPPPP + PPPP Sbjct: 290 PPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPP 323 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 25/38 (65%), Gaps = 6/38 (15%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPP------PLW*PPPPPLW*PPPP 97 PPPPPPPP + PPPPP P PPPPP + PPPP Sbjct: 309 PPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPP 346 [46][TOP] >UniRef100_UPI0000DB7892 PREDICTED: similar to Osiris 16 CG31561-PA n=1 Tax=Apis mellifera RepID=UPI0000DB7892 Length = 796 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGY GGGGGY GGGGGGY GGGGGGGG Sbjct: 590 GGGAGGGYGGGGGGGY-GGGGGGGYGGGGGGGGGG 623 [47][TOP] >UniRef100_C5CY78 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CY78_VARPS Length = 137 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGG--GGGG 1 GGGGY GGGGGY GGGGGGY GGGG GGGG Sbjct: 91 GGGGYGGGGGGGYGGGGGGGGYGGGGGGRSGGGG 124 [48][TOP] >UniRef100_A5GPV8 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. RCC307 RepID=A5GPV8_SYNR3 Length = 204 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 110 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 142 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY GGGG + GGGGGY GGGGGGY GGGGGGG Sbjct: 117 GYGGGGGGYGGGGGGY--GGGGGGY--GGGGGGG 146 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGY---HNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 100 GYGGGGGGRGGYGGGGGGY--GGGGGGYGGGGGGYGGG 135 [49][TOP] >UniRef100_C1YIL2 Small secreted domain-containing protein (DUF320) n=1 Tax=Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111 RepID=C1YIL2_NOCDA Length = 238 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 H+ GGG + GGGGG H+GGGGGG H GG GGGGG Sbjct: 142 HDDGYGGGDHGGGGGGGGHHGGGGGGDHGGGNGGGGG 178 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 H+G GG+ +G GGG H GGGGGG H+GGGGGG Sbjct: 133 HDGGGHDGGHDDGYGGGDHGGGGGGGGHHGGGGGG 167 [50][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G +GGGG GGGGGY GGGGGGY GGGGGG G Sbjct: 110 GRDGGGGGGRGGGGGYDGGGGGGGYGGGGGGGGYG 144 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 G GGGGY GGGGG + GGGGGG + GGGG GGGG Sbjct: 118 GRGGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGG 155 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 ++G GGGGY GGGGG + GGGG Y GG GGGG Sbjct: 125 YDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGG 160 [51][TOP] >UniRef100_Q75QN8 Cold shock domain protein 3 n=1 Tax=Triticum aestivum RepID=Q75QN8_WHEAT Length = 231 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 94 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 126 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GG GGGGG Sbjct: 101 GYGGGGGGYGGGGGGY--GGGGGGYGGGGYGGGGG 133 [52][TOP] >UniRef100_Q0E7L3 Putative glycine rich protein n=1 Tax=Pisum sativum RepID=Q0E7L3_PEA Length = 171 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 G+ GGGGY +GGGGGY +GGGGG H GGGG GGGG Sbjct: 72 GHGGGGGYGHGGGGGYGHGGGGGYGHGGGGGYGHGGGG 109 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGGGY +GGGGGY +GGGGG H GGGG GG Sbjct: 80 GHGGGGGYGHGGGGGYGHGGGGGYGHGGGGGYNGG 114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GY-NGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY +G GGY +GGGGGY +GGGGG H GGGG GGGG Sbjct: 63 GYGHGHGGYGHGGGGGYGHGGGGGYGHGGGGGYGHGGGG 101 [53][TOP] >UniRef100_A8JAG8 Argonaute-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JAG8_CHLRE Length = 1037 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGG GGGGGGY GGG GGGG Sbjct: 49 GGGGGGGYGGGGGGGGRGGGGGGGYGGGGGRGGGG 83 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG---GGGGYHNGGGGGGGG 1 GY GGGGY GGGGG GG GGGGY GG GGGGG Sbjct: 16 GYGGGGGYGGGGGGGRGGGGGDRGGGGYGGGGRGGGGG 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG GGGGGY GGGGGG GGGGG GG Sbjct: 42 GY-GGGGRGGGGGGGYGGGGGGGGRGGGGGGGYGG 75 [54][TOP] >UniRef100_Q7PST4 AGAP011248-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=Q7PST4_ANOGA Length = 435 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/46 (58%), Positives = 32/46 (69%), Gaps = 10/46 (21%) Frame = -3 Query: 111 HEGYNGGGG--YHNGGGGGYHNG--------GGGGGYHNGGGGGGG 4 ++GYN GGG YH GG GGY++G GGGGG+H GGGGGGG Sbjct: 357 NKGYNQGGGQNYHQGGRGGYNHGAGNGTGGGGGGGGFHQGGGGGGG 402 [55][TOP] >UniRef100_B9PV72 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9PV72_TOXGO Length = 488 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 64 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 96 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGGG Sbjct: 71 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGAGGGG 106 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGGG Sbjct: 78 GYGGGGGGYGGGGGGY--GGGGGGYGAGGGGYGAGGGG 113 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY G GGGGY GGGG GGGG Sbjct: 85 GYGGGGGGYGGGGGGY--GAGGGGYGAGGGGYGAGGGG 120 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY GGG + GGGGY GGGGGGY GGG GG Sbjct: 106 GYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSGG 139 [56][TOP] >UniRef100_B3MW45 GF22329 n=1 Tax=Drosophila ananassae RepID=B3MW45_DROAN Length = 207 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG-GGGGGYHNGGGGGGGG 1 GY GGGG H GGGGG G GGGGG H GGGGG GG Sbjct: 55 GYGGGGGKHGGGGGGGQGGYGGGGGKHGGGGGGQGG 90 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = -3 Query: 105 GYNGGGGYHNGG--GGGYHNGGGGGGYHNGGGGGGG 4 G +GGGGY GG GGG+H GGGGGG H+GGGGGGG Sbjct: 163 GGSGGGGY-GGGNQGGGHHGGGGGGGGHHGGGGGGG 197 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = -3 Query: 105 GYNGGGGYHN--GGGGGYHNGGGGGGYHNGGGGGG 7 G N GGG+H GGGGG+H GGGGGG + GGGGGG Sbjct: 172 GGNQGGGHHGGGGGGGGHHGGGGGGGKYGGGGGGG 206 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG H GGGGG GGGGG G GGGGGG Sbjct: 73 GYGGGGGKHGGGGGGQGGYGGGGGGQGGYGGGGGG 107 [57][TOP] >UniRef100_UPI0000E491FD PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E491FD Length = 116 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGGY +GGGGGG GGGGGGGG Sbjct: 72 GGGGGGGDSGGGGGGYSSGGGGGGGGGGGGGGGGG 106 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/47 (55%), Positives = 28/47 (59%), Gaps = 12/47 (25%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGY------------HNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGGY +GGGGGGY +GGGGGGGG Sbjct: 30 GSGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGGGGG 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/47 (55%), Positives = 28/47 (59%), Gaps = 12/47 (25%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGY------------HNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGGY +GGGGGGY +GGGGGGGG Sbjct: 51 GGGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGGGGG 97 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 H +GGGG GGGG +GGGGGGY +GGGGGGGG Sbjct: 22 HSYSSGGGG---SGGGGGDSGGGGGGYSSGGGGGGGG 55 [58][TOP] >UniRef100_Q7V9D6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9313 RepID=Q7V9D6_PROMM Length = 199 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-GGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GG GGGGY GG GGGGG Sbjct: 108 GYGGGGGGYGGGGGGYGGGGYGGGGYGGGGYGGGGG 143 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGGGGY GGGG GGG Sbjct: 94 GGGGGGGYGGGGGGGY--GGGGGGYGGGGGGYGGG 126 [59][TOP] >UniRef100_C1ZIK1 RRM domain-containing RNA-binding protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZIK1_PLALI Length = 146 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 99 NGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 +GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 109 SGGGGGYGGGGGGYGGGGGGGGYGGGGGGYGGG 141 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 7/42 (16%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG-------GGGGGYHNGGGGGGGG 1 G GGGGY GGGGGY G GGGGGY GGGG GGG Sbjct: 84 GGGGGGGYGGGGGGGYGGGGGGRPRSGGGGGYGGGGGGYGGG 125 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYH--NGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG +GGGGGY GGGGGGY GGGGGG G Sbjct: 98 GYGGGGGGRPRSGGGGGY--GGGGGGYGGGGGGGGYG 132 [60][TOP] >UniRef100_Q9ZRI2 Environmental stress-induced protein (Fragment) n=1 Tax=Medicago sativa RepID=Q9ZRI2_MEDSA Length = 133 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GYNGGGG+ GGGGY+ GGG GGY GG GGGG Sbjct: 1 GYNGGGGHGGHGGGGYNGGGGHGGYGGGGYNGGGG 35 [61][TOP] >UniRef100_Q8VX74 Glycine-rich RNA-binding protein n=1 Tax=Ricinus communis RepID=Q8VX74_RICCO Length = 165 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG------GGGGGYHNGGGGGGGG 1 G GGGGY NGGGGGY G GGGGGY GGGG GGG Sbjct: 90 GGGGGGGYRNGGGGGYGGGRREGGYGGGGGYSRGGGGYGGG 130 [62][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPP PPPPPP PPPPP PPPPL PS Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPP PPPPL PPPPPP PPPPP PPPP Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPPL PPP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPPL PPPP PPPP Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPPL PPPPP PPPPP PPPP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 [63][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGGY GGGGG + GGGGGGY GGGGG GG Sbjct: 41 GGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGG 72 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGG GGGGGY GGGGGGY GGGGG GG Sbjct: 30 GGGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYGG 64 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGGG GGG GGGG Sbjct: 47 GGGGGGGYGGGGGGGYGGGGGGGRGGGGGGFGGGG 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG + GGGGGG + GGGGGG G Sbjct: 29 GGGGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYG 63 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG + GGGGG + GGGGGG GGGG GGG Sbjct: 46 GGGGGGGGYGGGGGGGYGGGGGGGRGGGGGGFGGG 80 [64][TOP] >UniRef100_B9SLQ3 Glycine-rich RNA-binding protein, putative n=1 Tax=Ricinus communis RepID=B9SLQ3_RICCO Length = 166 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG------GGGGGYHNGGGGGGGG 1 G GGGGY NGGGGGY G GGGGGY GGGG GGG Sbjct: 90 GGGGGGGYRNGGGGGYGGGRREGGYGGGGGYSRGGGGYGGG 130 [65][TOP] >UniRef100_B7QJ84 Glycine-rich RNA-binding protein GRP1A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJ84_IXOSC Length = 105 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGGG H GGGGG H GGGGGG+ GGGG GGG Sbjct: 45 GHGGGGGGHGGGGGG-HGGGGGGGHGGGGGGHGGG 78 [66][TOP] >UniRef100_B4PLK3 GE24060 n=1 Tax=Drosophila yakuba RepID=B4PLK3_DROYA Length = 116 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 13/45 (28%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGG-------------YHNGGGGGGGG 1 GGGG +NGGGGGY+ GGGGGG Y NGGGGGGGG Sbjct: 52 GGGGGYNGGGGGYNGGGGGGGGRRPVYSGNFGPGYSNGGGGGGGG 96 [67][TOP] >UniRef100_Q0UIP7 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0UIP7_PHANO Length = 668 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 ++ Y GGGG + GGGGGY +GGGGGGY GG GGGGG Sbjct: 255 YKSYGGGGGGYGGGGGGY-SGGGGGGYGGGGYGGGGG 290 [68][TOP] >UniRef100_Q07202 Cold and drought-regulated protein CORA n=1 Tax=Medicago sativa RepID=CORA_MEDSA Length = 204 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 4/38 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG----GGGYHNGGGGGGG 4 GYN GGGY N GGGGYHNGGG GGG +NGGGG GG Sbjct: 64 GYNHGGGY-NHGGGGYHNGGGGYNHGGGGYNGGGGHGG 100 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/41 (68%), Positives = 31/41 (75%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGG---GGGYHNGGGGGGYHNGGGG---GGGG 1 GYN GGGY+ GG GGGY++ GGGGYHNGGGG GGGG Sbjct: 53 GYNHGGGYNGGGYNHGGGYNH--GGGGYHNGGGGYNHGGGG 91 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 7/42 (16%) Frame = -3 Query: 105 GYN-GGGGYHNGGGG------GYHNGGGGGGYHNGGGGGGGG 1 GYN GGGGYHNGGGG GY+ GGG GG+ GG GGGG Sbjct: 70 GYNHGGGGYHNGGGGYNHGGGGYNGGGGHGGHGGGGYNGGGG 111 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GYNGGGG+ GGGGY+ GGG GG+ GG GGGG Sbjct: 91 GYNGGGGHGGHGGGGYNGGGGHGGHGGGGYNGGGG 125 [69][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G GGGGY GGGGG + GGGGGG + GGGGGGG Sbjct: 95 GGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGG 128 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GGGGY GGGGG + GGGGGG + GGGGGGG Sbjct: 89 GGGGYGGGGGGGGYGGGGGGGGYGGGGGGGG 119 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYH----NGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG GGGGGY GGGGGGY GGGGGG G Sbjct: 92 GYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYG 130 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 G GGGGY GGGGG + GGGGGG + GGGGGG Sbjct: 104 GGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGG 136 [70][TOP] >UniRef100_A1UCC3 Putative uncharacterized protein n=2 Tax=Mycobacterium RepID=A1UCC3_MYCSK Length = 135 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP PPPPPP PPPPP++ PPPP+ Sbjct: 87 PPPPPPPPPGAPPPPPP---PPPPPVYVPPPPV 116 [71][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPPPP PPPPP PPPP P+C Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTC 117 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPPPP PPPPP PPPP P C Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCC 120 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 [72][TOP] >UniRef100_B4FTV4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FTV4_MAIZE Length = 196 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGG GGGGGGY GGGGGGGG Sbjct: 40 GYGGGGGYGGYGGGG---GGGGGGYGGGGGGGGGG 71 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = -3 Query: 96 GGGGYHNGGG-GGYHNGGGGGGYHNGGGGGGGG 1 GGGGY GGG GGY GGGGGG GGGGGGGG Sbjct: 37 GGGGYGGGGGYGGYGGGGGGGGGGYGGGGGGGG 69 [73][TOP] >UniRef100_O96853 ORF 1 n=1 Tax=Schistosoma haematobium RepID=O96853_SCHHA Length = 194 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNG--GGGGGYHNGGGGGGGG 1 +G GGGGY GGGGGY G GGGGGY GG GGGGG Sbjct: 44 DGGYGGGGYGGGGGGGYEGGGNGGGGGYEGGGYGGGGG 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/36 (66%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGG-GGGYHNGGGGGGYHNGGGGGGGG 1 G + GGGY +GG GGG + GGGGGGY GG GGGGG Sbjct: 35 GSDCGGGYGDGGYGGGGYGGGGGGGYEGGGNGGGGG 70 [74][TOP] >UniRef100_B4M7I0 GJ16994 n=1 Tax=Drosophila virilis RepID=B4M7I0_DROVI Length = 205 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY GGGGGYH GGG GGGG Sbjct: 46 GYGGGGGY--GGGGGY---GGGGGYHGGGGYGGGG 75 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGG-GGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG+ GGG GGYH GGGGGG GGGGGG G Sbjct: 139 GYQGGGGHQGGGGIGGYHGGGGGGG---GGGGGGAG 171 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 13/50 (26%) Frame = -3 Query: 111 HEGYNGGGGYHNGG------------GGGYHNGGGG-GGYHNGGGGGGGG 1 + G GGGGY GG GGG H GGGG GGYH GGGGGGGG Sbjct: 116 YHGGGGGGGYQGGGYQSGGYQGGGYQGGGGHQGGGGIGGYHGGGGGGGGG 165 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 2/36 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG--GGGGYHNGGGGGGG 4 GY GGGGY GGGGGYH GG GGGGY GG GGG Sbjct: 52 GYGGGGGY--GGGGGYHGGGGYGGGGYQGGGYQGGG 85 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNG---GGGGYHNGG-GGGGYHNGGGGGGGG 1 GY GGGGYH G GGGGY GG GGGY GG GGGG Sbjct: 58 GYGGGGGYHGGGGYGGGGYQGGGYQGGGYQGGGYQGGGG 96 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 9/46 (19%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGG---------YHNGGGGGGGG 1 H+G G GGYH GGGGG GGGG G Y GGGGGGGG Sbjct: 146 HQGGGGIGGYHGGGGGGGGGGGGGAGSYASSSANSYSYGGGGGGGG 191 Score = 53.1 bits (126), Expect = 9e-06 Identities = 29/43 (67%), Positives = 29/43 (67%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGG----GYHNGG--GGGYHNGGGG-GGYHNGGG-GGGGG 1 GY GGG GY GG GGG H GGGG GGYH GGG GGGGG Sbjct: 124 GYQGGGYQSGGYQGGGYQGGGGHQGGGGIGGYHGGGGGGGGGG 166 [75][TOP] >UniRef100_B4JKF1 GH12063 n=1 Tax=Drosophila grimshawi RepID=B4JKF1_DROGR Length = 143 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 2/38 (5%) Frame = -3 Query: 108 EGYNGGGGYH--NGGGGGYHNGGGGGGYHNGGGGGGGG 1 +G NGGGG H GGGGGY GGGGGG H GG GGGG Sbjct: 105 QGSNGGGGKHGGGGGGGGYGGGGGGGGKHGGGKHGGGG 142 [76][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPPL PPPPPPL PPPP PPPPL P Sbjct: 274 PPPPPPPPLPPPPPPPPLPPQPPPP---PPPPLQP 305 [77][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPPPP PPPPP PPPP P C Sbjct: 295 PPPPPPPPPCPPPPPPP---PPPPPPCPPPPPPPPPC 328 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPP P PPPPP PPPP P C Sbjct: 268 PPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPC 304 [78][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPPL PPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPP 458 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPP 457 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP PPPPPP PPPPP PPPPL P Sbjct: 425 PPPPPPPPP--PPPPPP---PPPPPPPPPPPPLLP 454 [79][TOP] >UniRef100_UPI0000E125D3 Os05g0552600 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E125D3 Length = 510 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/36 (63%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +2 Query: 2 PPPP---PPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPP PPPP++ PPPPPP PPPPP++ PPPP+ Sbjct: 77 PPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPV 112 [80][TOP] >UniRef100_UPI0000D9E82E PREDICTED: similar to additional sex combs like 1 isoform 4 n=1 Tax=Macaca mulatta RepID=UPI0000D9E82E Length = 2250 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP PPPPPPL PPPPP PPPPL P Sbjct: 2017 PPPPPPPP---PPPPPPLALPPPPP---PPPPLPP 2045 [81][TOP] >UniRef100_UPI0000D9E82D PREDICTED: similar to additional sex combs like 1 isoform 2 n=3 Tax=Macaca mulatta RepID=UPI0000D9E82D Length = 2249 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP PPPPPPL PPPPP PPPPL P Sbjct: 2016 PPPPPPPP---PPPPPPLALPPPPP---PPPPLPP 2044 [82][TOP] >UniRef100_C0Z2P2 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2P2_ARATH Length = 137 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/41 (63%), Positives = 29/41 (70%), Gaps = 4/41 (9%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGG----GGGGYHNGGGGGGGG 1 H G+ GGGG H GGGGG++ GG GGGG H GGGGGG G Sbjct: 61 HGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHG 101 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG---GGGYHNGGGGGGGG 1 G+ GGGG H GGGGG++ GGG GGG H GGGGGG G Sbjct: 77 GHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 114 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGGG H GGGGG++ GGGGG++ GGGGG GG Sbjct: 70 GHYGGGGGHYGGGGGHY--GGGGGHYGGGGGGHGG 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/42 (61%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = -3 Query: 111 HEGYNGGGGYHNGG---GGGYHNGGGGGGYHNGGG--GGGGG 1 H G+ GGGG+ +GG GGG H GGGGG Y GGG GGGGG Sbjct: 50 HGGHGGGGGHGHGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 91 [83][TOP] >UniRef100_B9FLI1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FLI1_ORYSJ Length = 518 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/36 (63%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +2 Query: 2 PPPP---PPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPP PPPP++ PPPPPP PPPPP++ PPPP+ Sbjct: 108 PPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPV 143 [84][TOP] >UniRef100_A9U2M5 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9U2M5_PHYPA Length = 219 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GY-NGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY +G GGYH GGGGG GGGGGG GGGGGGGG Sbjct: 167 GYGHGPGGYHRGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 H G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 176 HRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 212 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY+ GGG GGGGG GGGGGG GGGGGGGG Sbjct: 174 GYHRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 213 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 214 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 217 [85][TOP] >UniRef100_A9NNT8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NNT8_PICSI Length = 205 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG--GGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY G GGGGG++ GGGGG GG Sbjct: 98 GYGGGGGGYGGGGGGYGGGGYGGGGGWNGGGGGGRGG 134 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG + GGGGGY GGGGGGY GG GGGGG Sbjct: 91 GRGGGGGGYGGGGGGY--GGGGGGYGGGGYGGGGG 123 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG+ NGGGGG GG GGG G GGGGGG Sbjct: 117 GYGGGGGW-NGGGGGGRGGGRGGGRGGGAGGGGGG 150 [86][TOP] >UniRef100_A2Y786 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2Y786_ORYSI Length = 493 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/36 (63%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +2 Query: 2 PPPP---PPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPP PPPP++ PPPPPP PPPPP++ PPPP+ Sbjct: 83 PPPPRASPPPPVYSPPPPPPRSSPPPPPVYSPPPPV 118 [87][TOP] >UniRef100_Q5TTW0 AGAP002621-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=Q5TTW0_ANOGA Length = 150 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGG--GGGGYHNGGGGGG 7 H G GGGGY +GGGGGY GG GGGY +GGGGGG Sbjct: 34 HGGSGGGGGYSHGGGGGYSQGGYSSGGGYSSGGGGGG 70 [88][TOP] >UniRef100_B4R7C9 GD16486 n=1 Tax=Drosophila simulans RepID=B4R7C9_DROSI Length = 197 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G +GGGG H GGGGG+ +GGGGGG+ +GGGGG G Sbjct: 120 GGHGGGGGHGGGGGGWSSGGGGGGWSSGGGGGHG 153 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/39 (61%), Positives = 28/39 (71%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG----YHNGGGGGGYHNGGGGGGGG 1 G GGGG+ +GGGGG GGGGGG+ +GGGGGGGG Sbjct: 51 GGGGGGGWSSGGGGGGGGWSSGGGGGGGWSSGGGGGGGG 89 [89][TOP] >UniRef100_B4IUI7 GE19717 n=1 Tax=Drosophila yakuba RepID=B4IUI7_DROYA Length = 110 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGG--GGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG H GG GGG H GGGGGG +GGGGGGGG Sbjct: 67 GGGGGGGKHGGGNGGGGKHGGGGGGGGKHGGGGGGGG 103 [90][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPPL PPPPPP PPPPP PPPP Sbjct: 308 PPPPPPPPLPSPPPPPPTPPPPPPPPPPPPPP 339 [91][TOP] >UniRef100_Q9SVM8 Glycine-rich RNA-binding protein 2, mitochondrial n=1 Tax=Arabidopsis thaliana RepID=GRP2_ARATH Length = 158 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY+GGGG + GGGGGY GGGGGGY GG GGGG Sbjct: 126 GYSGGGGGYGGGGGGY--GGGGGGYGGGGDGGGG 157 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 102 YNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 Y GGGGY +GGGGGY GGGGGGY GGGG GGG Sbjct: 121 YGGGGGY-SGGGGGY--GGGGGGYGGGGGGYGGG 151 [92][TOP] >UniRef100_UPI0001984704 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984704 Length = 462 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGGY GGGGGGY GGGGGG Sbjct: 20 GYGGGGGY---GGGGYGGGGGGGGYGGNSGGGGGG 51 [93][TOP] >UniRef100_Q9Q5L3 EBNA-2 n=1 Tax=Macacine herpesvirus 4 RepID=Q9Q5L3_9GAMA Length = 605 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPP 94 PPPPPPPP PPPPPPL PPPPP+ PPP Sbjct: 65 PPPPPPPPPLPPPPPPPLPPPPPPPVQPPPP 95 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPPL PPPPPP PPPPP PPPP Sbjct: 66 PPPPPPPPL--PPPPPPPLPPPPPPPVQPPPP 95 [94][TOP] >UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia MC0-3 RepID=B1JXE0_BURCC Length = 505 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 99 NGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 NGGGG GGGGG NGGGGGG GGGGGGGG Sbjct: 328 NGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGG 360 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = -3 Query: 99 NGGGGYHNGG----GGGYHNGGGGGGYHNGGGGGGGG 1 NGGGG NGG GGG GGGGGG NGGGGGGGG Sbjct: 315 NGGGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGG 351 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG NGG GGGGG Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGG 403 [95][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP+ PPPPPP+ PPPPP PPPP+ Sbjct: 1288 PPPPPPPPVSPPPPPPPVSPPPPPP---PPPPV 1317 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 1287 PPPPPPPPPVSPPPPPPPVSPPPPP---PPPP 1315 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/34 (67%), Positives = 25/34 (73%), Gaps = 2/34 (5%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPP--LW*PPPPPLW*PPPP 97 PPPPPPPP+ PPPPPP + PPPPP PPPP Sbjct: 1277 PPPPPPPPVSPPPPPPPPPVSPPPPPPPVSPPPP 1310 [96][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP PPPPPP PPPPP PPPPL P Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLP 282 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPPL P PP Sbjct: 255 PPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 [97][TOP] >UniRef100_C1EIE9 Dead-box ATP-dependent RNA helicase n=1 Tax=Micromonas sp. RCC299 RepID=C1EIE9_9CHLO Length = 576 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY GGGGY GGGGGY GGGGGGY NGGG GGG Sbjct: 546 GYGGGGGY--GGGGGY--GGGGGGYSNGGGYGGG 575 [98][TOP] >UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO Length = 510 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGY GGG G GG Sbjct: 352 GYGGGGGGYGGGGGGYGGYGGGGGYGGGGGFGSGG 386 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGG-GGYHNGGGGGGGG 1 GY GG G + GGGGGY GGGG GGY GGG GGGG Sbjct: 345 GYGGGNGGYGGGGGGYGGGGGGYGGYGGGGGYGGGG 380 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-GGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY GG GGGGY G GG GGG Sbjct: 303 GYGGGGGY--GGGGGYGGGGYGGGGYGGGNGGYGGG 336 [99][TOP] >UniRef100_B9PW07 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii GT1 RepID=B9PW07_TOXGO Length = 508 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGY GGG G GG Sbjct: 350 GYGGGGGGYGGGGGGYGGYGGGGGYGGGGGFGSGG 384 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGG-GGYHNGGGGGGGG 1 GY GG G + GGGGGY GGGG GGY GGG GGGG Sbjct: 343 GYGGGNGGYGGGGGGYGGGGGGYGGYGGGGGYGGGG 378 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-GGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY GG GGGGY G GG GGG Sbjct: 301 GYGGGGGY--GGGGGYGGGGYGGGGYGGGNGGYGGG 334 [100][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPPPP PPPPP PPPP P C Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPC 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 [101][TOP] >UniRef100_B4PWJ8 GE16594 n=1 Tax=Drosophila yakuba RepID=B4PWJ8_DROYA Length = 195 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G GGGG H GGGGG+ +GGGGGG+ +GGGGG G Sbjct: 117 GGGGGGGGHGGGGGGWSSGGGGGGWSSGGGGGHG 150 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G++ GGG GGGGG+ +GGGGGG+ +GGGGG GG Sbjct: 73 GWSSGGG--GGGGGGWSSGGGGGGWSSGGGGGSGG 105 [102][TOP] >UniRef100_B4NC76 GK25807 n=1 Tax=Drosophila willistoni RepID=B4NC76_DROWI Length = 234 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = -3 Query: 111 HEGYNGGGGYHNGG----GGGYHNGGGGGGYHNGGGGGGGG 1 H G GGGGY GG GGG H GGGGGGY GG GGGG Sbjct: 124 HGGGGGGGGYGGGGSGGFGGGKHGGGGGGGYGGNGGNGGGG 164 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/36 (72%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYH-NGGGGGYHNGGGGGGYHNGGGGGGGG 1 G NGGGGY NGGGGG +GGGGGG + G GGGGGG Sbjct: 177 GGNGGGGYGGNGGGGGGKHGGGGGGGYGGNGGGGGG 212 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 2/36 (5%) Frame = -3 Query: 105 GYNGGGGY--HNGGGGGYHNGGGGGGYHNGGGGGGG 4 G NGGGGY + GGGGG H G GGGGY GGGGGG Sbjct: 158 GGNGGGGYGGNGGGGGGKHGGNGGGGYGGNGGGGGG 193 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 96 GGGGYHNGGGGGYH--NGGGGGGYHNGGGGGGGG 1 GGGG H GGGGG + NGGGGGG H GGGGGG G Sbjct: 190 GGGGKHGGGGGGGYGGNGGGGGGKHGGGGGGGYG 223 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG-GGGGGYHNGGGGGGGG 1 GY GGGG H GGGG G GGGGG H GGGGGG G Sbjct: 43 GYGGGGGSHGGGGGNGGGGYGGGGGSHGGGGGGGYG 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGY--HNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY + GGGGG H GGGGGGY GGGG GG Sbjct: 196 GGGGGGGYGGNGGGGGGKHGGGGGGGYGGGGGGKHGG 232 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 96 GGGGYHNG-GGGGY-HNGGGGGGYHNGGGGGGGG 1 GGGG H G GGGGY NGGGGGG H GGGGGG G Sbjct: 171 GGGGKHGGNGGGGYGGNGGGGGGKHGGGGGGGYG 204 [103][TOP] >UniRef100_B4JLJ8 GH12877 n=1 Tax=Drosophila grimshawi RepID=B4JLJ8_DROGR Length = 96 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNGGGGY----HNGGG-GGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY H GGG GG H GG GGG+ GGGGGGGG Sbjct: 30 GYGGGGGYGGGGHGGGGYGGGHGGGHGGGHGGGGGGGGGG 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G +GGGGY G GGG+ G GGGG GGGGGGGG Sbjct: 40 GGHGGGGYGGGHGGGHGGGHGGGGGGGGGGGGGGG 74 [104][TOP] >UniRef100_B3P7N4 GG12540 n=1 Tax=Drosophila erecta RepID=B3P7N4_DROER Length = 115 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/41 (63%), Positives = 29/41 (70%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG------YHNGGGGGGYHNGGGGGGGG 1 GYNGGGG +NGGGGG ++G G GY NGGGGGGGG Sbjct: 55 GYNGGGGGYNGGGGGGGGRRPVYSGNFGPGYSNGGGGGGGG 95 [105][TOP] >UniRef100_UPI0001867639 hypothetical protein BRAFLDRAFT_237268 n=1 Tax=Branchiostoma floridae RepID=UPI0001867639 Length = 360 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG ++GGGGGY GGGGG Y GGGG GGG Sbjct: 266 GYGGGGGGYSGGGGGY--GGGGGSYGGGGGGYGGG 298 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG--GGGGGYHNGGGGGGGG 1 GY GGGGY GGGY+NG GGGGGY GG GG GG Sbjct: 222 GYGGGGGYGGDRGGGYNNGNYGGGGGYGGGGYGGSGG 258 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY G GG GGGGGY GGGGGGY GGGG GGG Sbjct: 252 GYGGSGGGGYGGGGGY--GGGGGGYSGGGGGYGGG 284 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/39 (66%), Positives = 27/39 (69%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG----GGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY G GGGGG + GGGGG GG Sbjct: 260 GYGGGGGY-GGGGGGYSGGGGGYGGGGGSYGGGGGGYGG 297 [106][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP PPPPPP PPPPP PPPPL P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPPL PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPPL PPPPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP PPPPPP PPPPP PPPPL P Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPP---PPPPLPP 284 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 [107][TOP] >UniRef100_Q3ANN6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. CC9605 RepID=Q3ANN6_SYNSC Length = 173 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGGY GGGGGY GGGGGGY GGGGG GG Sbjct: 87 GGGGYGGGGGGGY--GGGGGGYRGGGGGGYGG 116 [108][TOP] >UniRef100_Q127H7 Putative uncharacterized protein n=1 Tax=Polaromonas sp. JS666 RepID=Q127H7_POLSJ Length = 261 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G NGGGG + GGGGG GGGGGG GGGGGGGG Sbjct: 215 GGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGG 249 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G NGGGG GGGGG GGGGGG GGGGGGGG Sbjct: 221 GGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 255 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 216 GNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGG 250 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 222 GNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 256 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GG G NGGGGG GGGGGG GGGGGGGG Sbjct: 208 GNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGG 242 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 224 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 258 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 225 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 259 [109][TOP] >UniRef100_A2SMG9 RNA-binding region RNP-1 n=1 Tax=Methylibium petroleiphilum PM1 RepID=A2SMG9_METPP Length = 162 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/37 (72%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG--GGGG 1 GY GGGG +GGGGGY GGGGGGY GGGG GGGG Sbjct: 103 GYGGGGGGRSGGGGGY--GGGGGGYGGGGGGRSGGGG 137 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG---GGGGYHNGGGGGGGG 1 GY GGGG +GGGGGY GG GGGG + GGGGG GG Sbjct: 124 GYGGGGGGRSGGGGGYGGGGGRSGGGGGYGGGGGGRGG 161 [110][TOP] >UniRef100_D0CMI9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. WH 8109 RepID=D0CMI9_9SYNE Length = 190 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 GY GGGGY GGGGG GGGGGGY GGGGGG Sbjct: 102 GYRGGGGYGGGGGGG-GGGGGGGGYAGGGGGGG 133 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGG + GGGGGY GGG GG GGGGGGGG Sbjct: 90 GYGGGG--YGGGGGGYRGGGGYGGGGGGGGGGGGG 122 [111][TOP] >UniRef100_A3ZRX9 RNA-binding protein n=1 Tax=Blastopirellula marina DSM 3645 RepID=A3ZRX9_9PLAN Length = 149 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG----GGGGYHNGGGGGGGG 1 GY GGGG GGGGY GG GGGGY GGGGGGGG Sbjct: 93 GYGGGGGGGRSGGGGYGGGGGGRSGGGGYGGGGGGGGGG 131 [112][TOP] >UniRef100_Q8S8J7 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8S8J7_ARATH Length = 127 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/41 (60%), Positives = 28/41 (68%), Gaps = 5/41 (12%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGY-----HNGGGGGGYHNGGGGGGGG 1 +GY GGGG++ GGGG Y H GGGGGGY GGG GGG Sbjct: 73 DGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 [113][TOP] >UniRef100_Q8LGC0 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8LGC0_ARATH Length = 127 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/41 (60%), Positives = 28/41 (68%), Gaps = 5/41 (12%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGY-----HNGGGGGGYHNGGGGGGGG 1 +GY GGGG++ GGGG Y H GGGGGGY GGG GGG Sbjct: 73 DGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 [114][TOP] >UniRef100_Q2V4A1 Putative uncharacterized protein At2g05440.4 n=1 Tax=Arabidopsis thaliana RepID=Q2V4A1_ARATH Length = 147 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGG---GGGGYHNGGGGGGGG 1 +GY GGGG++ GGGG Y GG GGGG H GGGGGG G Sbjct: 73 DGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHG 111 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG---GGGYHNGGGGGGGG 1 G+ GGGG H GGGGG++ GGG GGG H GGGGGG G Sbjct: 87 GHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 124 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGGG H GGGGG++ GGGGG++ GGGGG GG Sbjct: 80 GHYGGGGGHYGGGGGHY--GGGGGHYGGGGGGHGG 112 [115][TOP] >UniRef100_Q2V498 Putative uncharacterized protein At2g05440.7 n=1 Tax=Arabidopsis thaliana RepID=Q2V498_ARATH Length = 133 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGG--GGGYHNGGGGGGGG 1 +GY GGGG++ GGGG Y GGG GGG H GGGGGG G Sbjct: 73 DGYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 110 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -3 Query: 111 HEGYNGGGGY--HNGGGGGYHNGGGGGGYHNGGGGGGGG 1 H G+NGGGG+ GGGG H GGGGG Y GGGG GGG Sbjct: 61 HGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGGHGGG 99 [116][TOP] >UniRef100_Q2QQ97 Os12g0502200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QQ97_ORYSJ Length = 258 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY+GGGGY GGGGY GGGGGG + GGGGG GG Sbjct: 137 GYSGGGGY---GGGGYSGGGGGGGGYQGGGGGYGG 168 [117][TOP] >UniRef100_O04070 SGRP-1 protein n=1 Tax=Solanum commersonii RepID=O04070_SOLCO Length = 162 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 7/41 (17%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGY----HNGGGGGGYHNG---GGGGGG 4 GY GGGGY GGGGGY GGGGGGY G GGGGGG Sbjct: 110 GYGGGGGYRGGGGGGYGGGRREGGGGGGYGGGRREGGGGGG 150 [118][TOP] >UniRef100_B9RS81 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RS81_RICCO Length = 516 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = +2 Query: 2 PPPPPPPPL---W*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPPPP + PPPPP + PPP P C Sbjct: 436 PPPPPPPPSPSPLPPPPPPPFYSPPPPPTYQSPPPSPPPC 475 [119][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPPL PPPPPP PPPPP PPPP Sbjct: 23 PPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPP PPPPPP PPPPP PPPP P+ Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 70 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 [120][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP PPPPPP PPPPP PPPPL P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPPL PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 [121][TOP] >UniRef100_B9QIA3 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii VEG RepID=B9QIA3_TOXGO Length = 481 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGGG Sbjct: 64 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGAGGGG 99 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGGG Sbjct: 71 GYGGGGGGYGGGGGGY--GGGGGGYGAGGGGYGAGGGG 106 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY G GGGGY GGGG GGGG Sbjct: 78 GYGGGGGGYGGGGGGY--GAGGGGYGAGGGGYGAGGGG 113 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY GGG + GGGGY GGGGGGY GGG GG Sbjct: 99 GYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSGG 132 [122][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPPPP PPPPP PPPP P C Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLC 49 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 [123][TOP] >UniRef100_B6KPI0 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KPI0_TOXGO Length = 538 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGGG Sbjct: 121 GYGGGGGGYGGGGGGY--GGGGGGYGGGGGGYGAGGGG 156 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY GGGGGGY GGGG GGGG Sbjct: 128 GYGGGGGGYGGGGGGY--GGGGGGYGAGGGGYGAGGGG 163 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 GY GGGG + GGGGGY G GGGGY GGGG GGGG Sbjct: 135 GYGGGGGGYGGGGGGY--GAGGGGYGAGGGGYGAGGGG 170 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY GGG + GGGGY GGGGGGY GGG GG Sbjct: 156 GYGAGGGGYGAGGGGYGAGGGGGGYGAGGGNSGG 189 [124][TOP] >UniRef100_B4LUJ0 GJ17322 n=1 Tax=Drosophila virilis RepID=B4LUJ0_DROVI Length = 418 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG H GGGGG+ GG GGG H GGG GGGG Sbjct: 354 GY-GGGGKHGGGGGGFGGGGHGGGGHGGGGHGGGG 387 [125][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP PPPPPP PPPPP PPPPL P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 100 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPPL PPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPL--PPPP 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 [126][TOP] >UniRef100_P17816 Glycine-rich cell wall structural protein n=1 Tax=Hordeum vulgare RepID=GRP1_HORVU Length = 200 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGYH GG G GGGGGYH GG GGGG Sbjct: 116 GYGGGGGYHGHGGEGGGGYGGGGGYHGHGGEGGGG 150 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYH-NGGGGGYHNGGGGGGY--HNGGGGGGGG 1 GY GGGGYH +GG GG GGGGGGY H GGGG GGG Sbjct: 133 GYGGGGGYHGHGGEGGGGYGGGGGGYPGHGGGGGHGGG 170 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GG GGGG Sbjct: 67 GYGGGGGGYPGGGGGY--GGGGGGYPGHGGEGGGG 99 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGY--HNG-GGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY H G GGGGY GGGGGYH GG GGGG Sbjct: 99 GYGGGGGYPGHGGEGGGGY---GGGGGYHGHGGEGGGG 133 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G +GGGGY GGGGGY GGGGGGY GGGG GGG Sbjct: 55 GGHGGGGY--GGGGGY--GGGGGGYPGGGGGYGGG 85 [127][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = +2 Query: 2 PPP---PPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPP PPPPP++ PPPPPP++ PPPPP PPPP Sbjct: 449 PPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPP 483 [128][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPPP+ PPPPPP PPP PL PPPP P Sbjct: 183 PPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCPP 217 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPPPP PPPP PPPP P+C Sbjct: 198 PPPPPPPPCPLPPPPPPC---PPPPAPCPPPPPPPAC 231 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPP ++ PPPP Sbjct: 142 PPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPP 173 [129][TOP] >UniRef100_Q7UA83 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 8102 RepID=Q7UA83_SYNPX Length = 214 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGG--GGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGG GG GGGGGGY GGGG GGG Sbjct: 97 GYGGGGGYGGGGGRDGGGGYGGGGGGYRGGGGGYGGG 133 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGG +GGGG GGG Sbjct: 115 GYGGGGGGYRGGGGGY--GGGGGGGRDGGGGYGGG 147 [130][TOP] >UniRef100_A6G232 RNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G232_9DELT Length = 136 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGG GGGGGGY GGGGG GG Sbjct: 70 GYGGGGGGYGGGGGG--RGGGGGGYGGGGGGGRGG 102 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY GGGG GGGGGY GGGGG GGGGGGG Sbjct: 77 GYGGGGGGRGGGGGGYGGGGGGGRGGRGGGGGGG 110 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGGY GGGGGGY GGGG GGG Sbjct: 56 GRGGGGGGRGGGGGGY--GGGGGGYGGGGGGRGGG 88 [131][TOP] >UniRef100_A4CWS8 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 7805 RepID=A4CWS8_SYNPV Length = 197 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 G GGGGY GGGGGY GGGGGGY GGGG GGGG Sbjct: 94 GGGGGGGYGGGGGGGY-GGGGGGGYRGGGGGYNDGGGG 130 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGGGY++GGGG GGG Sbjct: 102 GGGGGGGYGGGGGGGYR--GGGGGYNDGGGGYGGG 134 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 GGGGY GGGGGY GGGGGGY GGGGG GGG Sbjct: 89 GGGGYGGGGGGGY-GGGGGGGYGGGGGGGYRGGG 121 [132][TOP] >UniRef100_Q8W157 Glycine-rich protein n=1 Tax=Brassica oleracea RepID=Q8W157_BRAOL Length = 124 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = -3 Query: 105 GYNGGGGYHNG---GGGGYHNGGG--GGGYHNGGGGGGG 4 GYNG GGY+ G GGGGY+ GGG GGG+H GGG GGG Sbjct: 55 GYNGRGGYNGGGHHGGGGYNGGGGYNGGGHHGGGGRGGG 93 [133][TOP] >UniRef100_Q8RW11 Putative glycine rich protein n=1 Tax=Rumex obtusifolius RepID=Q8RW11_RUMOB Length = 168 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYN-GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GYN GGGG + GGGGGY GGGGGGY GGGG GGG Sbjct: 110 GYNRGGGGGYGGGGGGY--GGGGGGYGGGGGGYGGG 143 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG--GGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGG GGG GG GGGGG Sbjct: 118 GYGGGGGGYGGGGGGYGGGGGGYGGGRREGGYGGGGG 154 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 7/39 (17%) Frame = -3 Query: 96 GGGGYHNGGGGGY-------HNGGGGGGYHNGGGGGGGG 1 GGGGY GGGGGY +N GGGGGY GGGG GGG Sbjct: 91 GGGGYRGGGGGGYGGRREGGYNRGGGGGYGGGGGGYGGG 129 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGG--GGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY G GGY+ GGGGGY GGGGGGY GGGG GGG Sbjct: 102 GYGGRREGGYNRGGGGGY--GGGGGGYGGGGGGYGGG 136 [134][TOP] >UniRef100_Q75QN9 Cold shock domain protein 2 n=1 Tax=Triticum aestivum RepID=Q75QN9_WHEAT Length = 205 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGG Y GGG GGGG Sbjct: 101 GYGGGGGGYGGGGGGY--GGGGGSYGGGGGYGGGG 133 [135][TOP] >UniRef100_Q6Z498 Os07g0511100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z498_ORYSJ Length = 359 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGG-GGYHNGGGGGGGG 1 EG+ GGGG+ GGGGG GGGG GG H GG GGGGG Sbjct: 50 EGFGGGGGFGGGGGGGLGGGGGGLGGGHGGGFGGGGG 86 [136][TOP] >UniRef100_Q2V4A2 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=Q2V4A2_ARATH Length = 131 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGG---GGGGYHNGGGGGGGG 1 +GY GGGG++ GGGG Y GG GGGG H GGG GGGG Sbjct: 73 DGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGYGGGG 111 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGGG H GGGGG++ GGGGG++ GG GGGGG Sbjct: 80 GHYGGGGGHYGGGGGHY--GGGGGHYGGGYGGGGG 112 [137][TOP] >UniRef100_C0Z2B7 AT2G05440 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2B7_ARATH Length = 101 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -3 Query: 111 HEGYNGGGGY-HNGGGGGYHNGGGGGGYHNGGGGGGGG 1 H G+ GGGG+ H G GGG H GGGGGGY GGG GGG Sbjct: 50 HGGHGGGGGHGHGGHGGGGHYGGGGGGYGGGGGHHGGG 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = -3 Query: 108 EGYNGGGGYH--NGGGGGY-HNGGGGGGYHNGGGGGGGG 1 EGY GG G H +GGGGG+ H G GGGG++ GGGGG GG Sbjct: 41 EGYGGGHGGHGGHGGGGGHGHGGHGGGGHYGGGGGGYGG 79 [138][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = +2 Query: 2 PPP---PPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPP PPPPP++ PPPPPP++ PPPPP PPPP Sbjct: 449 PPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPP 483 [139][TOP] >UniRef100_A3BK83 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BK83_ORYSJ Length = 268 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGG-GGYHNGGGGGGGG 1 EG+ GGGG+ GGGGG GGGG GG H GG GGGGG Sbjct: 50 EGFGGGGGFGGGGGGGLGGGGGGLGGGHGGGFGGGGG 86 [140][TOP] >UniRef100_Q9VP98 CG11458 n=1 Tax=Drosophila melanogaster RepID=Q9VP98_DROME Length = 98 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG--YHNGG-GGGGYHNGGGGGGGG 1 G GGGG H GGGGG H GG GGGG H GGGGGGGG Sbjct: 52 GGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGG 89 [141][TOP] >UniRef100_C3Z6D8 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3Z6D8_BRAFL Length = 325 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 + GY GG G GGGGGY GGGGGGY GG GGGGG Sbjct: 24 NRGYGGGRG---GGGGGYRQGGGGGGYGGGGRGGGGG 57 [142][TOP] >UniRef100_B6IDH9 RH62628p (Fragment) n=2 Tax=Drosophila melanogaster RepID=B6IDH9_DROME Length = 114 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG--YHNGG-GGGGYHNGGGGGGGG 1 G GGGG H GGGGG H GG GGGG H GGGGGGGG Sbjct: 68 GGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGG 105 [143][TOP] >UniRef100_B4QJ87 GD14918 n=1 Tax=Drosophila simulans RepID=B4QJ87_DROSI Length = 98 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG--YHNGG-GGGGYHNGGGGGGGG 1 G GGGG H GGGGG H GG GGGG H GGGGGGGG Sbjct: 52 GGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGG 89 [144][TOP] >UniRef100_B4NCH1 GK25855 n=1 Tax=Drosophila willistoni RepID=B4NCH1_DROWI Length = 193 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGGG H GGGG GGGGGG+ +GGGGGG G Sbjct: 114 GHGGGGGGHGGGGGWSSGGGGGGGWSSGGGGGGHG 148 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/39 (61%), Positives = 28/39 (71%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG----YHNGGGGGGYHNGGGGGGGG 1 G GGGG+ +GGGGG GGGGGG+ +GGGGGGGG Sbjct: 57 GGGGGGGWSSGGGGGGGGWSSGGGGGGGWSSGGGGGGGG 95 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/36 (66%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = -3 Query: 105 GYNGGGGYHN--GGGGGYHNGGGGGGYHNGGGGGGG 4 G+ GGGG+ + GGGGG+ +GGGGGG H GGGGGGG Sbjct: 121 GHGGGGGWSSGGGGGGGWSSGGGGGG-HGGGGGGGG 155 [145][TOP] >UniRef100_B4M8D6 GJ16790 n=1 Tax=Drosophila virilis RepID=B4M8D6_DROVI Length = 143 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/34 (70%), Positives = 28/34 (82%), Gaps = 2/34 (5%) Frame = -3 Query: 96 GGGGYHNGGGGG--YHNGGGGGGYHNGGGGGGGG 1 GGGG H GGGGG + +GGGGGG+ +GGGGGGGG Sbjct: 71 GGGGGHGGGGGGGGWSSGGGGGGWSSGGGGGGGG 104 [146][TOP] >UniRef100_B4HM88 GM23669 n=1 Tax=Drosophila sechellia RepID=B4HM88_DROSE Length = 114 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/53 (54%), Positives = 32/53 (60%), Gaps = 16/53 (30%) Frame = -3 Query: 111 HEGYNGG--GGYHNGGGGGYHNGGGGGG--------------YHNGGGGGGGG 1 + G NGG GGY+ GGGGG +NGGGGGG Y NGGGGGGGG Sbjct: 42 YTGGNGGRGGGYNGGGGGGGYNGGGGGGGGRRPVYTGNFGPGYGNGGGGGGGG 94 [147][TOP] >UniRef100_UPI0001982DB4 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982DB4 Length = 214 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGG-GYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGG GY+ GGG GG G GGGGGG Sbjct: 92 GYGGGGGYGGGGGGYGYNGGGGRGGGRGGRGGGGGG 127 [148][TOP] >UniRef100_UPI0001862007 hypothetical protein BRAFLDRAFT_58365 n=1 Tax=Branchiostoma floridae RepID=UPI0001862007 Length = 178 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG-GGGGGYHNGGGGGGGG 1 GY GGGGY GGGGY GGGGGY GGGG GGG Sbjct: 103 GYGGGGGYRGRGGGGYGGSYGGGGGYGGGGGGYGGG 138 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGG--GGGG 1 GY GGGG + GGGG Y GG GGG + GGGG GGGG Sbjct: 127 GYGGGGGGYGGGGGSYGGGGYGGGSYGGGGGSYGGGG 163 [149][TOP] >UniRef100_UPI000185F332 hypothetical protein BRAFLDRAFT_199348 n=1 Tax=Branchiostoma floridae RepID=UPI000185F332 Length = 260 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G+ GGGG+ GGGGG+ GGGGGG+ GGGGGGG Sbjct: 15 GFGGGGGFGAGGGGGF-GGGGGGGFSKGGGGGGG 47 [150][TOP] >UniRef100_UPI000185F331 hypothetical protein BRAFLDRAFT_64022 n=1 Tax=Branchiostoma floridae RepID=UPI000185F331 Length = 449 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G+ GGGG+ GGGGG+ GGGGGG+ GGGGGGG Sbjct: 394 GFGGGGGFGAGGGGGF-GGGGGGGFSKGGGGGGG 426 [151][TOP] >UniRef100_UPI00017C3792 PREDICTED: similar to additional sex combs like 3 isoform 3 n=1 Tax=Bos taurus RepID=UPI00017C3792 Length = 2356 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPPL PPPPPP PPPP PPPPL PS Sbjct: 2124 PPPPPPPPLALPPPPPP---PPPP----PPPPLPPS 2152 [152][TOP] >UniRef100_UPI0001757FBF PREDICTED: similar to T19B10.5 n=1 Tax=Tribolium castaneum RepID=UPI0001757FBF Length = 1588 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/43 (55%), Positives = 30/43 (69%), Gaps = 6/43 (13%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGY------HNGGGGGGYHNGGGGGGGG 1 H+ ++GGGGY GGGGG+ H+GGGGGG+ G GGG GG Sbjct: 1448 HDDHHGGGGYGGGGGGGFGGGHDDHHGGGGGGFGGGFGGGFGG 1490 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 9/46 (19%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNG---------GGGGGYHNGGGGGGGG 1 H+ ++GGGGY GGGGG+ G GGGGGY GGGGG GG Sbjct: 1372 HDDHHGGGGYGGGGGGGFGGGFGGGHDDHHGGGGGYGGGGGGGFGG 1417 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G++GGGG+ GGGGG+H GGG GG + GG GGGGG Sbjct: 1535 GHHGGGGF--GGGGGHHGGGGFGGGYGGGHGGGGG 1567 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/39 (58%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGG--GYHNGGGGGGGG 1 H+ ++GGGGY GGGGG+ G GGG +H GGG GGGG Sbjct: 1423 HDDHHGGGGYGGGGGGGFGGGFGGGHDDHHGGGGYGGGG 1461 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/34 (67%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGG--GGGGYHNGGGGGGGG 1 GG G+ GGGGG+H GG GGGG H+GGGG GGG Sbjct: 1524 GGAGFLGGGGGGHHGGGGFGGGGGHHGGGGFGGG 1557 [153][TOP] >UniRef100_UPI0000222BCC Hypothetical protein CBG04553 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000222BCC Length = 723 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG------GGGGGYHNGGGGGGGG 1 G GGGGY +GGGGG G GGGGGY +GGGGGGGG Sbjct: 75 GGGGGGGYASGGGGGSSGGYAKPPGGGGGGYASGGGGGGGG 115 [154][TOP] >UniRef100_UPI000179D3E7 UPI000179D3E7 related cluster n=1 Tax=Bos taurus RepID=UPI000179D3E7 Length = 868 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPPL PPPPPP PPPP PPPPL PS Sbjct: 722 PPPPPPPPLALPPPPPP---PPPP----PPPPLPPS 750 [155][TOP] >UniRef100_Q4TB22 Chromosome 15 SCAF7210, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4TB22_TETNG Length = 1021 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGY----HNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY NGGGGGY GGGGGY GGG GGGG Sbjct: 984 GYRGGGGYGGGRGNGGGGGY---GGGGGYGGGGGNGGGG 1019 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGG-GGYHNGGGGGGYHNGGGGGGGG 1 GY G GGY GGG GG GGGGGY GGG GGGG Sbjct: 978 GYRGSGGYRGGGGYGGGRGNGGGGGYGGGGGYGGGG 1013 [156][TOP] >UniRef100_B6IMJ6 Putative uncharacterized protein n=1 Tax=Rhodospirillum centenum SW RepID=B6IMJ6_RHOCS Length = 202 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP PPPPPP PPPPP+ PPPP+ Sbjct: 40 PPPPPPPPAPLPPPPPP---PPPPPMPEPPPPV 69 [157][TOP] >UniRef100_A9FZR5 Single-stranded DNA-binding protein n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9FZR5_SORC5 Length = 203 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G + GGGY GGGGG ++GGGGGG GGGGGGGG Sbjct: 125 GADPGGGYGGGGGGGGYSGGGGGGGGYGGGGGGGG 159 [158][TOP] >UniRef100_A9EYW0 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9EYW0_SORC5 Length = 139 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G GGGGY GGGGGY GGGGGG GGGGGG Sbjct: 86 GGGGGGGYGGGGGGGYGGGGGGGGRGGRGGGGGG 119 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYH--NGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGG GGGGGGY GGGGG GG Sbjct: 94 GGGGGGGYGGGGGGGGRGGRGGGGGGYGGGGGGGRGG 130 [159][TOP] >UniRef100_A4TEZ3 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4TEZ3_MYCGI Length = 177 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPP 94 PPPPPPPP PPPPPP PPPPP++ PPP Sbjct: 127 PPPPPPPPPGAPPPPPPPPPPPPPPVYIPPP 157 [160][TOP] >UniRef100_C1ZD11 Putative uncharacterized protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZD11_PLALI Length = 548 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/37 (62%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 G+ GGGG+ GGGGG+ GGGGGG+ G GGG GGG Sbjct: 34 GFRGGGGFGGGGGGGFDRGGGGGGFDRGSGGGSFGGG 70 [161][TOP] >UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana RepID=Q9LJ64_ARATH Length = 956 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 28/36 (77%), Gaps = 3/36 (8%) Frame = +2 Query: 2 PPP---PPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPP PPPPP++ PPPP P++ PPPPP+ PPPP+ Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPV 763 [162][TOP] >UniRef100_Q2V4A0 Putative uncharacterized protein At2g05440.5 n=1 Tax=Arabidopsis thaliana RepID=Q2V4A0_ARATH Length = 140 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 +GY GGGG++ GGGG H GGGGG Y GGGG GGG Sbjct: 73 DGYGGGGGHYGGGGG--HYGGGGGHYGGGGGGHGGG 106 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG---GGGYHNGGGGGGGG 1 G+ GGGG H GGGGG++ GGG GGG H GGGGGG G Sbjct: 80 GHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 117 [163][TOP] >UniRef100_C0P680 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0P680_MAIZE Length = 457 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 3/37 (8%) Frame = -3 Query: 105 GY-NGGG--GYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY NG G GY NG GGGY NG GGGGY NG GGGGG Sbjct: 373 GYPNGRGVRGYQNGRGGGYQNGRGGGGYQNGRGGGGG 409 [164][TOP] >UniRef100_B3H6I3 Uncharacterized protein At2g05510.6 n=1 Tax=Arabidopsis thaliana RepID=B3H6I3_ARATH Length = 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 4/40 (10%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGG--GGGYHNGGGG--GGGG 1 EGY+GG G H GGGGG++ GGG GGG H GGGG GGGG Sbjct: 41 EGYHGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGG 80 [165][TOP] >UniRef100_A5BQ96 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BQ96_VITVI Length = 219 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGG + GGGGG +NGGGG GGG Sbjct: 86 GGRGGGGYGGGGGGGGYGGGGGGYGYNGGGGRGGG 120 [166][TOP] >UniRef100_C3ZP43 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3ZP43_BRAFL Length = 445 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G+ GGGG+ GGGGG+ GGGGGG+ GGGGGGG Sbjct: 390 GFGGGGGFGAGGGGGF-GGGGGGGFSKGGGGGGG 422 [167][TOP] >UniRef100_C0H6D7 Putative cuticle protein n=1 Tax=Bombyx mori RepID=C0H6D7_BOMMO Length = 224 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGG---GGGYHNGGGGGGGG 1 H GY+ GGGY GGGGGY GGG GGGY GGG GGGG Sbjct: 121 HHGYDRGGGY--GGGGGYGGGGGYGGGGGYGGGGGYGGGG 158 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHN----GGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY GGG GG + GGGG GGG Sbjct: 153 GYGGGGGYGGGSGYGGGGGYGGGGGHGGGYGGGGGHGGG 191 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG---GGGGGYHNGGGGGGG 4 GY GGGGY GGGGGY G GGGGGY GGG GGG Sbjct: 147 GYGGGGGY--GGGGGYGGGSGYGGGGGYGGGGGHGGG 181 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG---GGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY G GGGGGY G G GGGG Sbjct: 135 GYGGGGGY--GGGGGYGGGGGYGGGGGYGGGSGYGGGG 170 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG---GGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY G GGG GY GGG GGGG Sbjct: 141 GYGGGGGY--GGGGGYGGGGGYGGGSGYGGGGGYGGGG 176 [168][TOP] >UniRef100_B7PFH2 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PFH2_IXOSC Length = 120 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGG + GGGGY + GGGG GG Sbjct: 76 GYGGGGGSYGGGGGGSYGSSGGGGYGSSGGGGSGG 110 [169][TOP] >UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KME4_TOXGO Length = 513 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGG-GGYHNGGGGGYHNGGGG-GGYHNGGGGGGGG 1 GY GG GGY GGGGGY GGGG GGY GGG GGGG Sbjct: 347 GYGGGNGGYGGGGGGGYGGGGGGYGGYGGGGGYGGGG 383 [170][TOP] >UniRef100_B4MDY4 GJ18398 n=1 Tax=Drosophila virilis RepID=B4MDY4_DROVI Length = 1362 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-----GGGGYHNGGGGGGGG 1 GYN GGG +N GGGGY++GG GGGG+++GG G GGG Sbjct: 1305 GYNSGGGGYNSGGGGYNSGGGGFNSGGGGFNSGGAGFGGG 1344 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-----GGGGYHNGGGG---GGGG 1 G+N GGG N GGGGY++GG GGGGY++GGGG GGGG Sbjct: 1291 GFNNGGGGFNSGGGGYNSGGGGYNSGGGGYNSGGGGFNSGGGG 1333 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 5/41 (12%) Frame = -3 Query: 108 EGYNGGGGY--HNGGGGGYHNGGGGGGYHNGGGG---GGGG 1 +GYN GGG +N GG GY NGGG GG++NGGGG GGGG Sbjct: 1258 DGYNNGGGDGGYNEGGDGYTNGGGFGGFNNGGGGFNNGGGG 1298 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG-----GGGGYHNGGGG---GGGG 1 G+N GGG N GGGG+++GG GGGGY++GGGG GGGG Sbjct: 1284 GFNNGGGGFNNGGGGFNSGGGGYNSGGGGYNSGGGGYNSGGGG 1326 [171][TOP] >UniRef100_B4JFF7 GH18272 n=1 Tax=Drosophila grimshawi RepID=B4JFF7_DROGR Length = 622 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/40 (65%), Positives = 33/40 (82%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNGGGG---YHNGG-GGGYHNGGG-GGGYHNGGGGGGGG 1 G+N GGG ++NGG GGG++NGGG GG++NGGGGGGGG Sbjct: 402 GFNNGGGSGGFNNGGNGGGFNNGGGNSGGFNNGGGGGGGG 441 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -3 Query: 111 HEGYNGGGGYHNGGG-GGYHNGGGGGGYHNGGGGGGG 4 + G GG G++NGGG GG++NGG GGG++NGGG GG Sbjct: 394 NSGGGGGSGFNNGGGSGGFNNGGNGGGFNNGGGNSGG 430 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 31/43 (72%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG------GGGGYHNGGG--GGGGG 1 G+N GGG++NGGGGG++NGG GG G++NGGG G GG Sbjct: 461 GFNNGGGFNNGGGGGFNNGGNSGFNNGGSGFNNGGGNFGSAGG 503 [172][TOP] >UniRef100_B4I903 GM19047 n=1 Tax=Drosophila sechellia RepID=B4I903_DROSE Length = 204 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GGGG H GGGGG+ +GGGGGG+ +GGGGG G Sbjct: 130 GGGGGHGGGGGGWSSGGGGGGWSSGGGGGHG 160 [173][TOP] >UniRef100_B3MSC9 GF20819 n=1 Tax=Drosophila ananassae RepID=B3MSC9_DROAN Length = 200 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 G GGGG+ GGGGG+ +GGGGGG +GGGGGGG Sbjct: 121 GGGGGGGHGGGGGGGWSSGGGGGGGWSGGGGGGG 154 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/43 (58%), Positives = 27/43 (62%), Gaps = 11/43 (25%) Frame = -3 Query: 96 GGGGYHNGGG-----------GGYHNGGGGGGYHNGGGGGGGG 1 GGGG H GGG GG H GGGGGG+ +GGGGGGGG Sbjct: 150 GGGGGHGGGGTKVIKIIKLSSGGGHGGGGGGGWSSGGGGGGGG 192 [174][TOP] >UniRef100_A8WXW9 Putative uncharacterized protein n=1 Tax=Caenorhabditis briggsae RepID=A8WXW9_CAEBR Length = 1075 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG------GGGGGYHNGGGGGGGG 1 G GGGGY +GGGGG G GGGGGY +GGGGGGGG Sbjct: 75 GGGGGGGYASGGGGGSSGGYAKPPGGGGGGYASGGGGGGGG 115 [175][TOP] >UniRef100_Q7SBD3 Pre-mRNA processing splicing factor 8 n=1 Tax=Neurospora crassa RepID=Q7SBD3_NEUCR Length = 2374 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPP W PPPP PPPPP PPPP P+ Sbjct: 4 PPPPPPPPGWGAPPPPSAPPPPPPPSSLPPPPALPA 39 [176][TOP] >UniRef100_C9SP10 ATP-dependent RNA helicase DBP2 n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SP10_9PEZI Length = 577 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGGGGGY GG GG GG Sbjct: 9 GYGGGGGGYGGGGGGY-GGGGGGGYGGGGRGGYGG 42 [177][TOP] >UniRef100_UPI000194C22E PREDICTED: similar to formin 2 n=1 Tax=Taeniopygia guttata RepID=UPI000194C22E Length = 1673 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 3/36 (8%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPL---W*PPPPPLW*PPPPL 100 PPPPPPPPL PPPPPPL PPPPP PPPPL Sbjct: 1089 PPPPPPPPLRLPPPPPPLPGGGIPPPPP---PPPPL 1121 [178][TOP] >UniRef100_UPI0000DB7202 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB7202 Length = 344 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGG--GGYHNGGGGGYHNGGGGGGYHNGG----GGGGGG 1 GY+GG GGY GGGGGY +GGGGGGY GG GGGGGG Sbjct: 265 GYSGGNGGGYSGGGGGGY-SGGGGGGYSGGGNGYSGGGGGG 304 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/37 (67%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 GY+GGGG ++GGG GY +GGGGGGY G GGG GGG Sbjct: 226 GYSGGGGGYSGGGNGY-SGGGGGGYSGGNGGGYSGGG 261 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 GY+GGG ++GGGGG ++GG GGGY GG GGG Sbjct: 233 GYSGGGNGYSGGGGGGYSGGNGGGYSGGGNGGG 265 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 5/40 (12%) Frame = -3 Query: 105 GYNGGG---GYHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 GY+GGG GY G GGGY +GGGGGGY GGGGG GGG Sbjct: 256 GYSGGGNGGGYSGGNGGGY-SGGGGGGYSGGGGGGYSGGG 294 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGG--YHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 GY+GGGG Y G GGGY GG GGGY G GGG GGG Sbjct: 240 GYSGGGGGGYSGGNGGGYSGGGNGGGYSGGNGGGYSGGG 278 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGG--GGYHNGGGGGYHNGGGGGGYHNGGGGG--GGG 1 GY+GG GGY GG GG ++GG GGGY GGGGG GGG Sbjct: 248 GYSGGNGGGYSGGGNGGGYSGGNGGGYSGGGGGGYSGGG 286 [179][TOP] >UniRef100_UPI0000DB6C07 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6C07 Length = 431 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/47 (55%), Positives = 30/47 (63%), Gaps = 12/47 (25%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGY--HNGGGGGGY----------HNGGGGGGGG 1 GY GGGG+ GGGG H+GGGGGG+ H+GGGGGGGG Sbjct: 182 GYGGGGGFGGGGGGSIIEHHGGGGGGFGGGGGGAIIEHHGGGGGGGG 228 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGG--GYHNGGGGGGGG 1 G+ GGGG + GGGGGY GGGGG +H GGGG GGG Sbjct: 243 GFGGGGGGYGGGGGGYGGGGGGGIIEHHGGGGGFGGG 279 [180][TOP] >UniRef100_UPI0001B7A53E UPI0001B7A53E related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7A53E Length = 1391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGG GGGGG+ GGGGGG+ G GGGGGG Sbjct: 1230 GFGSGGGGFGGGGGGFSGGGGGGGFGGGRGGGGGG 1264 [181][TOP] >UniRef100_UPI0000DBF1EE UPI0000DBF1EE related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DBF1EE Length = 101 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG + GGGGGG GGGGGGGG Sbjct: 13 GGGGGGGGGGGGGGGRYGGGGGGGGDGGGGGGGGG 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGG Y GGGGGG GGGGGGGG Sbjct: 14 GGGGGGGGGGGGGGRYGGGGGGGGDGGGGGGGGGG 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG +GGGGGGGG Sbjct: 12 GGGGGGGGGGGGGGGGRYGGGGGGGGDGGGGGGGG 46 [182][TOP] >UniRef100_B0V1I6 Novel protein similar to vertebrate heterogeneous nuclear ribonucleoprotein family (Zgc:153703) n=1 Tax=Danio rerio RepID=B0V1I6_DANRE Length = 234 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGG--GGGYHNGGGGGGGG 1 +GYNG GG + GG GGY G G GGGY +GGGGGGGG Sbjct: 191 DGYNGFGGNYGGGPGGYGGGRGGYGGGYGSGGGGGGGG 228 [183][TOP] >UniRef100_Q1BU84 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia AU 1054 RepID=Q1BU84_BURCA Length = 517 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 99 NGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 NGGGG NG GGG+ NGGGGGG GGGGGGGG Sbjct: 307 NGGGG--NGNGGGHGNGGGGGGGGGGGGGGGGG 337 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGG+ NGGGGG GGGGGG GGGGGGGG Sbjct: 311 GNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGG 345 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G NG GG H GGGG GGGGGG GGGGGGGG Sbjct: 310 GGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGG 344 [184][TOP] >UniRef100_A0K9V3 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia HI2424 RepID=A0K9V3_BURCH Length = 509 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 99 NGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 NGGGG NG GGG+ NGGGGGG GGGGGGGG Sbjct: 307 NGGGG--NGNGGGHGNGGGGGGGGGGGGGGGGG 337 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGG+ NGGGGG GGGGGG GGGGGGGG Sbjct: 311 GNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGG 345 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G NG GG H GGGG GGGGGG GGGGGGGG Sbjct: 310 GGNGNGGGHGNGGGGGGGGGGGGGGGGGGGGGGGG 344 [185][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPP PPPPPP PPPPP PPPP PS Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [186][TOP] >UniRef100_C5YSY6 Putative uncharacterized protein Sb08g022740 n=1 Tax=Sorghum bicolor RepID=C5YSY6_SORBI Length = 165 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GG GGY GGGGGGY GGGG GGG Sbjct: 117 GYGGGGGGYGGGRGGY--GGGGGGYGGGGGGYGGG 149 [187][TOP] >UniRef100_B9PEE7 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9PEE7_POPTR Length = 109 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 102 YNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 Y GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 49 YGGGGGGGGGGGGGSGGGGGGGGSGGGGGGGGGG 82 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 47 GSYGGGGGGGGGGGGGSGGGGGGGGSGGGGGGGGG 81 [188][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP PPPPPP PPPPP PPPPL Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [189][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPP PPPPPP PPPPP PPPP PS Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPS 530 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 [190][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP PPPPPP PPPPP PPPPL Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 39 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [191][TOP] >UniRef100_B4KSC4 GI19596 n=1 Tax=Drosophila mojavensis RepID=B4KSC4_DROMO Length = 1351 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -3 Query: 96 GGGGYHNGGG-GGYHNGGGGGGYHNGGGGGG 7 GGGG++NGGG GG+++GGGGGG++NGGG GG Sbjct: 1202 GGGGFNNGGGSGGFNSGGGGGGFNNGGGDGG 1232 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 5/38 (13%) Frame = -3 Query: 105 GYNGGGG----YHN-GGGGGYHNGGGGGGYHNGGGGGG 7 GYN GG Y N GGGGG++NGGG GG+++GGGGGG Sbjct: 1186 GYNSGGRFNGRYRNGGGGGGFNNGGGSGGFNSGGGGGG 1223 [192][TOP] >UniRef100_B4J9U8 GH20409 n=1 Tax=Drosophila grimshawi RepID=B4J9U8_DROGR Length = 1335 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/37 (67%), Positives = 30/37 (81%), Gaps = 6/37 (16%) Frame = -3 Query: 99 NGGGGYHN---GGGGGYHNGGGGG---GYHNGGGGGG 7 NGGGG++N GGG G++NGGGGG GY+NGGGGGG Sbjct: 1259 NGGGGFNNIGGGGGSGFNNGGGGGGGRGYNNGGGGGG 1295 [193][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PP PPPPPL PPPPPP PPPPP PPPP P Sbjct: 132 PPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPP 166 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPL-W*PPPPPLW*PPPPL*P 106 P PPPPPPL PPPPPPL PPPPP PPPPL P Sbjct: 93 PSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSP 128 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPP PPPPPP PPPP PPPP PS Sbjct: 7 PPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPS 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPP PPPP PPPPPP PPPPPL PPPP Sbjct: 117 PPPSPPPPPLSPPPPPPS--PPPPPLLSPPPP 146 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPL-W*PPPPPLW*PPPPL*PS 109 PPP PPPPL PPPPPPL PPPPPL PPP PS Sbjct: 84 PPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPS 120 [194][TOP] >UniRef100_P10496 Glycine-rich cell wall structural protein 1.8 n=1 Tax=Phaseolus vulgaris RepID=GRP2_PHAVU Length = 465 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG-GGGYHNGGGGGGGG 1 GY GGGG GGGGGY+ GG GGGY GGG GGGG Sbjct: 140 GYGGGGGSGAGGGGGYNAGGAQGGGYGTGGGAGGGG 175 [195][TOP] >UniRef100_UPI000186773D hypothetical protein BRAFLDRAFT_237208 n=1 Tax=Branchiostoma floridae RepID=UPI000186773D Length = 378 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGG--GGGGG 1 GY GGGG ++GGGGGY GGGGG Y GGG GGGGG Sbjct: 270 GYGGGGGGYSGGGGGY--GGGGGSYGGGGGSYGGGGG 304 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY G GG GGGGGY GGGGGGY GGGG GGG Sbjct: 256 GYGGSGGGGYGGGGGY--GGGGGGYSGGGGGYGGG 288 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGG--GGGGG 1 GY GGGGY GGGGGY GGGGGY GGG GGGGG Sbjct: 264 GYGGGGGY-GGGGGGY--SGGGGGYGGGGGSYGGGGG 297 [196][TOP] >UniRef100_UPI00016C4C95 RNA-binding protein n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C4C95 Length = 129 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG--GGGYHNGGGGGGGG 1 GY GGGG + GGGGGY GGG GGGY GGGGG G Sbjct: 91 GYGGGGGGYGGGGGGYGGGGGRSGGGYGGGGGGGRRG 127 [197][TOP] >UniRef100_UPI00016C4475 putative RNA-binding protein n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C4475 Length = 113 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGG + GGGGG GGGGGGY GGGG GGG Sbjct: 71 GGGGGYGGGGGGRRGGGGGGGYGGGGGGYGGG 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG GGGGG GGGGGGY GGG GGGG Sbjct: 75 GYGGGGGGRRGGGGGGGYGGGGGGY--GGGYGGGG 107 [198][TOP] >UniRef100_UPI0000DC1359 UPI0000DC1359 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DC1359 Length = 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 EG G GG H GGGGG GGGGGG+ G GGGGGG Sbjct: 9 EGGRGDGGGHGGGGGGGGGGGGGGGHGGGRGGGGGG 44 [199][TOP] >UniRef100_UPI0000DC1358 UPI0000DC1358 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DC1358 Length = 74 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 EG G GG H GGGGG GGGGGG+ G GGGGGG Sbjct: 13 EGGRGDGGGHGGGGGGGGGGGGGGGHGGGRGGGGGG 48 [200][TOP] >UniRef100_B4YB56 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB56_BURPS Length = 374 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPP PPPPPP PPPPP PPPP PS Sbjct: 85 PPPPPPPSTTTPPPPPPPPPPPPPPSTTPPPPPPPS 120 [201][TOP] >UniRef100_Q9SL23 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9SL23_ARATH Length = 154 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGG----GGGGYHNGGGGGGGG 1 G+ GGGG H GGGGG++ GG GGGG H GGGGGG G Sbjct: 80 GHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHG 118 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGG---GGGYHNGGGGGGGG 1 G+ GGGG H GGGGG++ GGG GGG H GGGGGG G Sbjct: 94 GHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 131 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/41 (63%), Positives = 29/41 (70%), Gaps = 5/41 (12%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGG---GGGGYHNGGGGG--GGG 1 +GY GGGG++ GGGG Y GG GGGG H GGGGG GGG Sbjct: 73 DGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG 113 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G+ GGGG H GGGGG H GGGGG Y GGGG GGG Sbjct: 87 GHYGGGGGHYGGGGG-HYGGGGGHYGGGGGGHGGG 120 [202][TOP] >UniRef100_O24187 OsGRP1 n=1 Tax=Oryza sativa RepID=O24187_ORYSA Length = 160 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGY---HNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY G GGGG + GG GGGGG Sbjct: 105 GYGGGGGYGGGGGGGYASREGGYGGGGGYGGGRGGGGG 142 [203][TOP] >UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR Length = 207 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY GG GGG GGGGG GG Sbjct: 100 GYGGGGGY-GGGGGGYGGGGYGGGRRGGGGGGYGG 133 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNGGG-GGYHNGGGGGGYHNGGGGGGGG 1 GY GGGG + GGG GG GGGGGGY GGG GGGG Sbjct: 106 GYGGGGGGYGGGGYGGGRRGGGGGGYGGGGGYGGGG 141 [204][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP PPPPPP PPPPP PPPP+ Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPPPPPPV 1247 [205][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*P--PPPL*PSC 112 PPPPPPPP PPPPPP PPPPP W P PP P C Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPQWEPADPPSKWPFC 112 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [206][TOP] >UniRef100_B7PZ39 E3 ubiquitin ligase, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PZ39_IXOSC Length = 88 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 EG GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 48 EGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 [207][TOP] >UniRef100_B7PVB4 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PVB4_IXOSC Length = 226 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 ++ YN GGG GGGGG GGGGGG GGGGGGGG Sbjct: 154 YKAYNKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 ++G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 158 NKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 35 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 36 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 37 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 38 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 6 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 41 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 8 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 42 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 10 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 11 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 45 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 12 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 46 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 13 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 14 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 48 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 15 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 49 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 16 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 50 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 17 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 18 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 52 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 19 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 53 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 20 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 21 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 22 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 25 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 163 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 164 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 165 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 172 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 209 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 176 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 210 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 177 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 211 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 212 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 213 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 214 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 215 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 217 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 218 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 219 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 222 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 223 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 224 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 225 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 192 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226 [208][TOP] >UniRef100_B4R5S1 GD17272 n=1 Tax=Drosophila simulans RepID=B4R5S1_DROSI Length = 406 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGG + GGGGG + GGGGG Y GGGGGGGG Sbjct: 237 GGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGG 271 [209][TOP] >UniRef100_B4K646 GI24079 n=1 Tax=Drosophila mojavensis RepID=B4K646_DROMO Length = 605 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -3 Query: 111 HEGYNGGGGYHNGGG-GGYHNGGGGGGYHNGGGGGGG 4 + G GGGG+++GGG GG++NGG GGG++NGG GGG Sbjct: 369 NSGGGGGGGFNSGGGVGGFNNGGSGGGFNNGGNSGGG 405 [210][TOP] >UniRef100_B4IF47 GM13418 n=1 Tax=Drosophila sechellia RepID=B4IF47_DROSE Length = 400 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGG + GGGGG + GGGGG Y GGGGGGGG Sbjct: 235 GGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGG 269 [211][TOP] >UniRef100_B4HLB7 GM25724 n=1 Tax=Drosophila sechellia RepID=B4HLB7_DROSE Length = 332 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG +GGGGG +GGGGGG GGGGGGGG Sbjct: 296 GGGGGGGGDDGGGGGGDDGGGGGGDDGGGGGGGGG 330 [212][TOP] >UniRef100_Q03251-2 Isoform 2 of Glycine-rich RNA-binding protein 8 n=1 Tax=Arabidopsis thaliana RepID=Q03251-2 Length = 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGG------GGYHNGGGGGGGG 1 GGGGY GGGGGY GGGG GGY +GGGGGG G Sbjct: 46 GGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRG 83 [213][TOP] >UniRef100_Q03251 Glycine-rich RNA-binding protein 8 n=2 Tax=Arabidopsis thaliana RepID=GRP8_ARATH Length = 169 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGG------GGYHNGGGGGGGG 1 GGGGY GGGGGY GGGG GGY +GGGGGG G Sbjct: 105 GGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRG 142 [214][TOP] >UniRef100_B4NYJ9 GE18286 n=1 Tax=Drosophila yakuba RepID=B4NYJ9_DROYA Length = 622 Score = 49.7 bits (117), Expect(2) = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 5 PPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPP PPPPPP PPPPP PPPP Sbjct: 504 PPPPPPP---PPPPPP---PPPPPPTEPPPP 528 Score = 25.0 bits (53), Expect(2) = 3e-06 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 3 HHHHHHHH 26 HHHHH HH Sbjct: 496 HHHHHVHH 503 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPTEPPPPP---PPPP 533 [215][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 937 PPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 938 PPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPP 969 [216][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 118 GVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 152 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG +GGGGGGGG Sbjct: 64 GGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGG 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 65 GGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGG 99 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG +GGGGGG GGGGGGGG Sbjct: 73 GGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGG 107 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 124 GVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGG 175 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 150 GGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGGGGG 184 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 158 GGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 192 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 164 GVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 219 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 228 GRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGG 262 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 +G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 244 DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 279 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG +GGGGGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGG 88 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGG 89 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG +GGGGG GGGGGG GGGGGGGG Sbjct: 81 GGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 82 GGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 83 GGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 220 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG +GGGGGG GGGGGGGG Sbjct: 227 GGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGG 261 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG +GGGGG GGGGGG GGGGGGGG Sbjct: 235 GGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGG 269 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 236 GGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGG 270 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G +GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 242 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 276 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG +GGGGGGGG Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGG 355 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGG 356 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGG 357 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG +GGGGGG GGGGGGGG Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGG 364 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGG 365 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 366 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG +GGGGG GGGGGG GGGGGGGG Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGG 372 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 339 GGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 373 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 340 GGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 374 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G +GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 345 GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 379 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 346 GSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 380 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 172 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 173 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 174 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 175 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 209 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 218 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 237 GGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 271 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 243 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 277 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 246 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 280 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 281 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 248 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 282 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 283 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 284 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 251 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 285 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 252 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 286 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 253 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 254 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 288 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 255 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 289 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 290 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 291 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 258 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 292 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 293 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 260 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 294 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 295 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 296 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 297 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 298 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 299 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 300 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 301 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 302 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 303 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 306 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 308 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 309 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 311 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 312 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 313 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 280 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 314 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 281 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 283 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 284 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 285 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 289 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 290 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 291 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 292 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 293 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 295 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 296 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 303 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 338 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 339 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 340 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 341 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 342 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 309 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 343 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 344 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 345 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 312 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 346 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 382 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 383 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 384 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 385 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 386 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 387 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 388 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 389 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 390 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 391 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 358 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 392 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 359 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 393 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 394 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 361 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 395 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 396 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 363 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 397 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 364 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 398 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 365 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 399 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 366 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 367 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 401 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 368 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 402 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 403 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 404 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 371 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 405 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 406 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 373 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 407 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 408 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 375 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 409 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 376 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 410 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 377 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 411 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 412 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 379 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 413 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 380 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 414 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 381 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 415 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 382 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 416 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 383 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 417 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 384 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 418 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 419 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 386 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 420 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 387 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 421 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 388 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 422 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 389 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 423 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 390 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 424 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 391 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 425 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 392 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 426 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 393 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 427 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 394 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 428 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 395 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 429 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 396 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 430 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 397 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 431 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 398 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 432 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 399 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 433 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 400 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 434 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 401 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 435 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 402 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 436 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 403 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 437 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 404 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 438 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 405 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 439 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 406 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 440 [217][TOP] >UniRef100_UPI0001553827 PREDICTED: additional sex combs like 3 n=1 Tax=Mus musculus RepID=UPI0001553827 Length = 1791 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = +2 Query: 5 PPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*P 106 PPPPPPP PPPPPPL PPPPP PPPPL P Sbjct: 1557 PPPPPPP---PPPPPPLALPPPPP---PPPPLPP 1584 [218][TOP] >UniRef100_UPI0000DA3D7B PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3D7B Length = 211 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 +G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 106 DGRGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGG 141 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 70 GGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGGG 104 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG +GGGGGGGG Sbjct: 21 GSGGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGG 55 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG +GGGGG GGGGGG +GGGGGGGG Sbjct: 38 GGGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGG 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 39 GGGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGG 73 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG +GGGGGGGG Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGGRGDGGGGGGGG 177 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG +GGGGGG GGGGGGGG Sbjct: 115 GGGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGG 149 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 116 GGGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGG 150 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG +GGGGG GGGGGG GGGGGGGG Sbjct: 123 GGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 124 GGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G +GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 130 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGDGGGGGGGGGG 57 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 40 GGGGGGGDGGGGGGGGGGGGGGGGDGGGGGGGGGG 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG +GGGGG GGGGGG +GGGGGGGG Sbjct: 69 GGGGGGGGGDGGGGGGAAGGGGGGGGSGGGGGGGG 103 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 117 GGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGG 151 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 125 GGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 131 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 [219][TOP] >UniRef100_UPI0000DA1CBA PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1CBA Length = 200 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG +GGGGG GGGGGG GGGGGGGG Sbjct: 39 GGGGGGGGDDGGGGGGGGGGGGGGCDGGGGGGGGG 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGG GGGGG GGGGGG +GGGGGGGG Sbjct: 51 GGGGGGGGGGGGCDGGGGGGGGGDGGGGGGGG 82 [220][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PS 109 PPPPPPPP PPPPPP PPP P W PPP PS Sbjct: 37 PPPPPPPPPSPPPPPPPPPSPPPLPPWGPPPSPPPS 72 [221][TOP] >UniRef100_B0S6Z1 Novel protein similar to vertebrate DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DHX9) n=1 Tax=Danio rerio RepID=B0S6Z1_DANRE Length = 1271 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 8/43 (18%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNG----GGGGGYHNGGGGG----GGG 1 GY GGGGY GGGGGY G GGGGGY GGGGG GGG Sbjct: 1186 GYRGGGGYR-GGGGGYRGGGGYQGGGGGYRGGGGGGYRGYGGG 1227 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 GY GGGGY GGGGGY GGGGGGY GGGGG Sbjct: 1199 GYRGGGGYQ-GGGGGY-RGGGGGGYRGYGGGGG 1229 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/42 (57%), Positives = 26/42 (61%), Gaps = 5/42 (11%) Frame = -3 Query: 111 HEGYNGGGGYHNGGG-----GGYHNGGGGGGYHNGGGGGGGG 1 + GY GGGGY GG GG GGGG G+ GGGGGGGG Sbjct: 1221 YRGYGGGGGYRGSGGYRGSSGGGGYGGGGRGFRGGGGGGGGG 1262 [222][TOP] >UniRef100_Q7NHK5 RNA-binding protein n=1 Tax=Gloeobacter violaceus RepID=Q7NHK5_GLOVI Length = 123 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG + GGG G GGGGGGY GG GGGGG Sbjct: 84 GGGGGGGGYRGGGAGGGGGGGGGGYRGGGAGGGGG 118 [223][TOP] >UniRef100_Q13DU8 Putative uncharacterized protein n=1 Tax=Rhodopseudomonas palustris BisB5 RepID=Q13DU8_RHOPS Length = 233 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGG--GGGYHNGGGGGGGG 1 H G GGGG+H GGGG+H GGG GGG+H+GGG GGG Sbjct: 76 HIGGGGGGGHH--GGGGFHGGGGFRGGGFHHGGGFRGGG 112 [224][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL*PSC 112 PPPPPPPP PPPPPP PPPPP PPPP P+C Sbjct: 216 PPPPPPPPP--PPPPPP---PPPPPPPPPPPPPPPAC 247 [225][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 [226][TOP] >UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis thaliana RepID=Q9XIL9_ARATH Length = 727 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 6/38 (15%) Frame = +2 Query: 2 PPP-----PPPPPLW*PPPPPPLW-*PPPPPLW*PPPP 97 PPP PPPPP++ PPPPPP++ PPPPP++ PPPP Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPP 539 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/32 (65%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = +2 Query: 8 PPPPPPLW*PPPPPPLW-*PPPPPLW*PPPPL 100 PPPPPP++ PPPPPP++ PPPPP+ PPPP+ Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPV 549 [227][TOP] >UniRef100_Q9SWA8 Glycine-rich RNA-binding protein n=1 Tax=Glycine max RepID=Q9SWA8_SOYBN Length = 160 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGG GGGGGY+ GGGG G +GGGGGGGG Sbjct: 88 GGGGGGGGGGGGYNRGGGGYGGRSGGGGGGGG 119 [228][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP+ PPPPPP PPPPP PPPP Sbjct: 87 PPPPPPPPVPPPPPPPP---PPPPPPSPPPPP 115 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 101 PPPPPPPPPSPPPPPPP---PPPPPPSPPPPP 129 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 102 PPPPPPPPSPPPPPPPP---PPPPPSPPPPPP 130 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 115 PPPPPPPPPSPPPPPPP---PPPPPPNPPPPP 143 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPP 97 PPPPPPPP PPPPPP PPPPP PPPP Sbjct: 116 PPPPPPPPSPPPPPPPP---PPPPPNPPPPPP 144 [229][TOP] >UniRef100_Q3E9N7 Putative uncharacterized protein At4g39260.2 n=1 Tax=Arabidopsis thaliana RepID=Q3E9N7_ARATH Length = 126 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -3 Query: 93 GGGYHNGGGGGYHNGGGGGGYHNGGGGGG 7 GGGY +GGGGGY +GGGGGGY GGGGGG Sbjct: 98 GGGYRSGGGGGY-SGGGGGGYSGGGGGGG 125 [230][TOP] >UniRef100_Q2QLR2 Os12g0632000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QLR2_ORYSJ Length = 162 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGY----HNGGGGGGYHNGGGGGGGG 1 GY GGGGY GGGGGY G GGGG + GG GGGGG Sbjct: 105 GYGGGGGYGGGGGGGYGQRREGGYGGGGGYGGGRGGGGG 143 [231][TOP] >UniRef100_C0Z304 AT2G21660 protein n=2 Tax=Arabidopsis thaliana RepID=C0Z304_ARATH Length = 115 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = -3 Query: 99 NGGGGYHNGGGGGYHNGGGGGGYHNGGG--GGGGG 1 +GGGG H GGGGG + GGGGGY GGG GGGGG Sbjct: 28 SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG 62 [232][TOP] >UniRef100_C0Z2N6 AT2G21660 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2N6_ARATH Length = 153 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = -3 Query: 99 NGGGGYHNGGGGGYHNGGGGGGYHNGGG--GGGGG 1 +GGGG H GGGGG + GGGGGY GGG GGGGG Sbjct: 89 SGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG 123 [233][TOP] >UniRef100_B9MU37 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9MU37_POPTR Length = 372 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGG 4 GY GGGG GGGGG GGGGGG GGGGGGG Sbjct: 205 GYGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 238 [234][TOP] >UniRef100_B4F7T1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F7T1_MAIZE Length = 254 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGG---GGGYHNGGGGGGY---HNGGGGGGGG 1 G+ GGGGY GG GGGY GGGGGY H GGGGG GG Sbjct: 112 GFRGGGGYGGGGYGGGGGYGGAGGGGGYGGGHYGGGGGSGG 152 [235][TOP] >UniRef100_A9P8Z7 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8Z7_POPTR Length = 165 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGY--HNGGGGGGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGGGY GGGG GGG Sbjct: 90 GGGGGGGYSRGGGGGYGGRREGGGGGYSRGGGGYGGG 126 [236][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +2 Query: 2 PPPPPPPPLW*PPPPPPLW*PPPPPLW*PPPPL 100 PPPPPPPP PPPPPP PPPPP PPPP+ Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPI 75 [237][TOP] >UniRef100_A2YCD6 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YCD6_ORYSI Length = 229 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G +GGGG +GGGGG GGGGGG GGGGGGGG Sbjct: 90 GTDGGGGGSSGGGGGGGGGGGGGGGGGGGGGGGGG 124 [238][TOP] >UniRef100_Q9VX67 CG5172, isoform D n=1 Tax=Drosophila melanogaster RepID=Q9VX67_DROME Length = 172 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGG------GGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGG GG NGGGG GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 65 [239][TOP] >UniRef100_Q8MYW0 RH06401p n=1 Tax=Drosophila melanogaster RepID=Q8MYW0_DROME Length = 93 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGG------GGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGG GG NGGGG GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 65 [240][TOP] >UniRef100_Q7KUW8 CG5172, isoform C n=1 Tax=Drosophila melanogaster RepID=Q7KUW8_DROME Length = 106 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGG------GGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGG GG NGGGG GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 65 [241][TOP] >UniRef100_B7QC03 Secreted salivary gland peptide, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC03_IXOSC Length = 117 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 H + GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 59 HRLFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 74 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 76 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 77 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 78 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 79 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 80 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 81 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 [242][TOP] >UniRef100_B7PE98 Glycine rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PE98_IXOSC Length = 156 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -3 Query: 108 EGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 +G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 34 QGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 61 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 74 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 76 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 77 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 78 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 79 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 80 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 81 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 125 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 126 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 127 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 128 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 129 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 130 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 131 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 132 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 133 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 134 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 135 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 136 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 137 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 138 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 139 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 140 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 141 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 142 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 143 [243][TOP] >UniRef100_B7P671 Cement protein, putative n=1 Tax=Ixodes scapularis RepID=B7P671_IXOSC Length = 324 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 102 YNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 Y GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 32 YKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 111 HEGYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 ++G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 32 YKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 61 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 101 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 103 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 104 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 105 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 106 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 107 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 74 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 108 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 75 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 76 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 77 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 78 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 79 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 80 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 81 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 125 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 126 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 127 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 128 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 129 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 130 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 131 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 132 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 133 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 134 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 135 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 136 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 137 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 138 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 139 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 140 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 107 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 141 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 142 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 143 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 148 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 149 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 150 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 151 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 152 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 153 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 120 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 154 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 121 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 155 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 156 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 129 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 130 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 131 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 167 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 168 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 169 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 170 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGG GGGGG GGGGGG GGGGGGGG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 171 [244][TOP] >UniRef100_B5DMI7 GA26754 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DMI7_DROPS Length = 328 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 9/44 (20%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG---------YHNGGGGGGYHNGGGGGGGG 1 G GGGG H GGGGG +GGGGGG H GGGGGGGG Sbjct: 265 GGGGGGGGHGGGGGGSTKVIKIIKLSSGGGGGGGHGGGGGGGGG 308 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG----YHNGGGGGGYHNGGGGGGGG 1 G GGGG H GGGGG GGGGGG+ +GGGGGGGG Sbjct: 234 GGGGGGGGHGGGGGGGGWSSGGGGGGGGWSSGGGGGGGG 272 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGG GGGGG+ GGGGGG+ +GGGGGGGG Sbjct: 233 GGGG---GGGGGHGGGGGGGGWSSGGGGGGGG 261 [245][TOP] >UniRef100_B4IC29 GM10360 n=1 Tax=Drosophila sechellia RepID=B4IC29_DROSE Length = 281 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 G +GGGG+ +GGGGG+ +GGGGGG GG GGG G Sbjct: 59 GSSGGGGFSSGGGGGFSSGGGGGGGFGGGFGGGSG 93 [246][TOP] >UniRef100_B4HWT9 GM11532 n=1 Tax=Drosophila sechellia RepID=B4HWT9_DROSE Length = 299 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 7/44 (15%) Frame = -3 Query: 111 HEGYNGGGGYHNG-GGGGYHNGGGGGGY------HNGGGGGGGG 1 H+G+ GGGG+ G GGGG GGGGGGY H GG GGGGG Sbjct: 231 HKGHGGGGGFKGGYGGGGGGGGGGGGGYGIQPVPHGGGPGGGGG 274 [247][TOP] >UniRef100_B4GXX8 GL20180 n=1 Tax=Drosophila persimilis RepID=B4GXX8_DROPE Length = 322 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 9/44 (20%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG---------YHNGGGGGGYHNGGGGGGGG 1 G GGGG H GGGGG +GGGGGG H GGGGGGGG Sbjct: 259 GGGGGGGGHGGGGGGSTKVIKIIKLSSGGGGGGGHGGGGGGGGG 302 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GYNGGGGYHNGGGGG----YHNGGGGGGYHNGGGGGGGG 1 G GGGG H GGGGG GGGGGG+ +GGGGGGGG Sbjct: 228 GGGGGGGGHGGGGGGGGWSSGGGGGGGGWSSGGGGGGGG 266 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -3 Query: 96 GGGGYHNGGGGGYHNGGGGGGYHNGGGGGGGG 1 GGGG GGGGG+ GGGGGG+ +GGGGGGGG Sbjct: 227 GGGG---GGGGGHGGGGGGGGWSSGGGGGGGG 255 [248][TOP] >UniRef100_B1X5L4 RNA-binding protein RbpD n=1 Tax=Paulinella chromatophora RepID=B1X5L4_PAUCH Length = 132 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -3 Query: 105 GYNGGGGYHNG-GGGGYHNGGGGGGYHNGGGGGGGG 1 G GGGGY G GGGG + GGGGGGY +GGGG GGG Sbjct: 93 GGGGGGGYGGGRGGGGGYGGGGGGGYGSGGGGYGGG 128 [249][TOP] >UniRef100_A9YI01 CG5172-PA (Fragment) n=1 Tax=Drosophila melanogaster RepID=A9YI01_DROME Length = 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGG------GGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGG GG NGGGG GGG Sbjct: 6 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 46 [250][TOP] >UniRef100_A9YHZ8 CG5172-PA (Fragment) n=2 Tax=Drosophila melanogaster RepID=A9YHZ8_DROME Length = 63 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 6/41 (14%) Frame = -3 Query: 105 GYNGGGGYHNGGGGGYHNGGGG------GGYHNGGGGGGGG 1 G GGGGY GGGGGY GGGG GG NGGGG GGG Sbjct: 6 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 46