[UP]
[1][TOP] >UniRef100_B6ECZ5 LacZ alpha n=1 Tax=Cloning vector pMAK28 RepID=B6ECZ5_9ZZZZ Length = 121 Score = 117 bits (293), Expect = 3e-24 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +1 Query: 616 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWKL 783 NSLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWKL Sbjct: 66 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWKL 121 [2][TOP] >UniRef100_Q47522 LacZ protein (Fragment) n=1 Tax=Escherichia coli RepID=Q47522_ECOLX Length = 81 Score = 114 bits (286), Expect = 2e-23 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +1 Query: 616 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 NSLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 4 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 58 [3][TOP] >UniRef100_Q8VNN2 Beta-galactosidase n=1 Tax=Escherichia coli RepID=BGAL_ECOLX Length = 1029 Score = 114 bits (286), Expect = 2e-23 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +1 Query: 616 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 NSLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 11 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 65 [4][TOP] >UniRef100_C5A125 Tryptophan synthase alpha chain n=1 Tax=Escherichia coli BW2952 RepID=C5A125_ECOBW Length = 1080 Score = 114 bits (285), Expect = 2e-23 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +1 Query: 592 SDPRVPSSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 771 SDP + ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG Sbjct: 55 SDP-LAITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 113 Query: 772 EWK 780 EW+ Sbjct: 114 EWR 116 [5][TOP] >UniRef100_UPI0001B5303F beta-D-galactosidase n=1 Tax=Shigella sp. D9 RepID=UPI0001B5303F Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [6][TOP] >UniRef100_UPI0001B525AD beta-D-galactosidase n=1 Tax=Escherichia sp. 4_1_40B RepID=UPI0001B525AD Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [7][TOP] >UniRef100_B7NK11 Beta-D-galactosidase n=1 Tax=Escherichia coli IAI39 RepID=B7NK11_ECO7I Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [8][TOP] >UniRef100_B7MPB1 Beta-D-galactosidase n=1 Tax=Escherichia coli ED1a RepID=B7MPB1_ECO81 Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [9][TOP] >UniRef100_B7L500 Beta-D-galactosidase n=1 Tax=Escherichia coli 55989 RepID=B7L500_ECO55 Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [10][TOP] >UniRef100_B6HZX0 Beta-D-galactosidase LacZ n=1 Tax=Escherichia coli SE11 RepID=B6HZX0_ECOSE Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [11][TOP] >UniRef100_C8UID7 Beta-D-galactosidase LacZ n=1 Tax=Escherichia coli O111:H- str. 11128 RepID=C8UID7_ECO11 Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [12][TOP] >UniRef100_C8TIU3 Beta-D-galactosidase LacZ n=1 Tax=Escherichia coli O26:H11 str. 11368 RepID=C8TIU3_ECOLX Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [13][TOP] >UniRef100_Q47340 LacZ 5'-region (Fragment) n=2 Tax=Escherichia coli RepID=Q47340_ECOLX Length = 147 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [14][TOP] >UniRef100_B2NAF2 Beta-galactosidase n=1 Tax=Escherichia coli 53638 RepID=B2NAF2_ECOLX Length = 1048 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [15][TOP] >UniRef100_Q3Z583 Beta-galactosidase n=1 Tax=Shigella sonnei Ss046 RepID=BGAL_SHISS Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [16][TOP] >UniRef100_Q1RFJ2 Beta-galactosidase n=2 Tax=Escherichia coli RepID=BGAL_ECOUT Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [17][TOP] >UniRef100_B7N8Q1 Beta-galactosidase n=1 Tax=Escherichia coli UMN026 RepID=BGAL_ECOLU Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [18][TOP] >UniRef100_P00722 Beta-galactosidase n=6 Tax=Escherichia coli RepID=BGAL_ECOLI Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [19][TOP] >UniRef100_B1J0T5 Beta-galactosidase n=1 Tax=Escherichia coli ATCC 8739 RepID=BGAL_ECOLC Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [20][TOP] >UniRef100_Q8FKG6 Beta-galactosidase n=2 Tax=Escherichia coli RepID=BGAL_ECOL6 Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [21][TOP] >UniRef100_Q0TKT1 Beta-galactosidase n=1 Tax=Escherichia coli 536 RepID=BGAL_ECOL5 Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [22][TOP] >UniRef100_A1A831 Beta-galactosidase n=1 Tax=Escherichia coli APEC O1 RepID=BGAL_ECOK1 Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [23][TOP] >UniRef100_A7ZWZ1 Beta-galactosidase n=1 Tax=Escherichia coli HS RepID=BGAL_ECOHS Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [24][TOP] >UniRef100_A7ZI91 Beta-galactosidase n=1 Tax=Escherichia coli E24377A RepID=BGAL_ECO24 Length = 1024 Score = 113 bits (282), Expect = 5e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [25][TOP] >UniRef100_B7UJI9 Beta-galactosidase n=1 Tax=Escherichia coli O127:H6 str. E2348/69 RepID=BGAL_ECO27 Length = 1024 Score = 112 bits (281), Expect = 6e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 60 [26][TOP] >UniRef100_Q37953 LacZ protein (Fragment) n=1 Tax=Phage M13mp18 RepID=Q37953_BPM13 Length = 102 Score = 112 bits (279), Expect = 1e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 +S +LAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 22 ASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78 [27][TOP] >UniRef100_O21999 LacZ-alpha n=1 Tax=Cloning vector pAL-Z RepID=O21999_9ZZZZ Length = 154 Score = 112 bits (279), Expect = 1e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 +S +LAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 37 TSLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 93 [28][TOP] >UniRef100_C8U237 Beta-D-galactosidase LacZ n=1 Tax=Escherichia coli O103:H2 str. 12009 RepID=C8U237_ECOLX Length = 1024 Score = 111 bits (278), Expect = 1e-22 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SL VVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLVVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 [29][TOP] >UniRef100_C3TMY5 Beta-D-galactosidase n=1 Tax=Escherichia coli RepID=C3TMY5_ECOLX Length = 1024 Score = 110 bits (276), Expect = 2e-22 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [30][TOP] >UniRef100_Q32JB6 Beta-galactosidase n=1 Tax=Shigella dysenteriae Sd197 RepID=BGAL_SHIDS Length = 1024 Score = 110 bits (276), Expect = 2e-22 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [31][TOP] >UniRef100_B5Z2P7 Beta-galactosidase n=3 Tax=Escherichia coli RepID=BGAL_ECO5E Length = 1024 Score = 110 bits (276), Expect = 2e-22 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [32][TOP] >UniRef100_Q8X685 Beta-galactosidase n=3 Tax=Escherichia coli RepID=BGAL_ECO57 Length = 1024 Score = 110 bits (276), Expect = 2e-22 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [33][TOP] >UniRef100_B3A811 Beta-galactosidase n=1 Tax=Escherichia coli O157:H7 str. EC4401 RepID=B3A811_ECO57 Length = 1024 Score = 109 bits (273), Expect = 5e-22 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEART+RPSQQLRS+NGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTNRPSQQLRSVNGEWQ 60 [34][TOP] >UniRef100_B1LIM9 Beta-galactosidase n=1 Tax=Escherichia coli SMS-3-5 RepID=BGAL_ECOSM Length = 1024 Score = 109 bits (273), Expect = 5e-22 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHP FASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPHFASWRNSEEARTDRPSQQLRSLNGEWR 60 [35][TOP] >UniRef100_A7KGA5 Beta-galactosidase n=1 Tax=Klebsiella pneumoniae RepID=BGAL2_KLEPN Length = 1024 Score = 109 bits (273), Expect = 5e-22 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ+ RSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQESRSLNGEWR 60 [36][TOP] >UniRef100_A6TI29 Beta-galactosidase 2 n=1 Tax=Klebsiella pneumoniae subsp. pneumoniae MGH 78578 RepID=BGAL2_KLEP7 Length = 1024 Score = 109 bits (273), Expect = 5e-22 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ+ RSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQESRSLNGEWR 60 [37][TOP] >UniRef100_Q8GEG0 Putative uncharacterized protein n=1 Tax=Erwinia amylovora RepID=Q8GEG0_ERWAM Length = 123 Score = 108 bits (271), Expect = 9e-22 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = +1 Query: 622 LAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 LAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR LNGEW+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWR 120 [38][TOP] >UniRef100_B9U1H7 Beta-D-galactosidase n=1 Tax=Vaccinia virus GLV-1h68 RepID=B9U1H7_9POXV Length = 1019 Score = 107 bits (268), Expect = 2e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +1 Query: 628 VVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 VVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 5 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 55 [39][TOP] >UniRef100_C7LLM9 Beta-galactosidase, chain D n=1 Tax=Mycoplasma mycoides subsp. capri str. GM12 RepID=C7LLM9_MYCML Length = 1027 Score = 107 bits (268), Expect = 2e-21 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +1 Query: 628 VVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 VVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 13 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 63 [40][TOP] >UniRef100_B7M2Z2 Beta-D-galactosidase n=1 Tax=Escherichia coli IAI1 RepID=B7M2Z2_ECO8A Length = 1024 Score = 107 bits (266), Expect = 4e-21 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEART RPS QLRSLNGEW+ Sbjct: 5 TDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTVRPSPQLRSLNGEWQ 60 [41][TOP] >UniRef100_Q47336 LacZ-alpha peptide n=1 Tax=Escherichia coli RepID=Q47336_ECOLX Length = 90 Score = 103 bits (256), Expect = 5e-20 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 616 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 765 NSLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL Sbjct: 20 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 [42][TOP] >UniRef100_B6FNW7 Putative uncharacterized protein n=1 Tax=Clostridium nexile DSM 1787 RepID=B6FNW7_9CLOT Length = 173 Score = 103 bits (256), Expect = 5e-20 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +1 Query: 616 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 765 NSLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL Sbjct: 21 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 70 [43][TOP] >UniRef100_B2G3R5 Putative puroindoline b protein n=1 Tax=Triticum aestivum subsp. macha RepID=B2G3R5_WHEAT Length = 228 Score = 102 bits (255), Expect = 7e-20 Identities = 49/52 (94%), Positives = 49/52 (94%) Frame = +2 Query: 608 RARIHWPSFYNVVTGXTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 763 R IHWPSFYNVVTG TLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA Sbjct: 177 RITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 228 [44][TOP] >UniRef100_B3B2R7 Beta-galactosidase n=1 Tax=Escherichia coli O157:H7 str. EC4501 RepID=B3B2R7_ECO57 Length = 1024 Score = 102 bits (253), Expect = 1e-19 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++S AVVLQRRD NPGVTQ+NRLAAHPPFASWRNSEEART+RPSQQLRSLNGEW+ Sbjct: 5 TDSSAVVLQRRDRENPGVTQVNRLAAHPPFASWRNSEEARTNRPSQQLRSLNGEWQ 60 [45][TOP] >UniRef100_C7WM90 LacZ alpha protein (Fragment) n=1 Tax=Enterococcus faecalis AR01/DG RepID=C7WM90_ENTFA Length = 52 Score = 101 bits (252), Expect = 1e-19 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = +1 Query: 616 NSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 762 NSLAVVLQRRDW NPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS Sbjct: 4 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRS 52 [46][TOP] >UniRef100_UPI0000ECC20B UPI0000ECC20B related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECC20B Length = 89 Score = 100 bits (250), Expect = 3e-19 Identities = 53/66 (80%), Positives = 53/66 (80%), Gaps = 9/66 (13%) Frame = +1 Query: 595 DPRVPSSNS---------LAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPS 747 DPRVPSSNS LAVVLQRRDW NPGVTQLNRLAAH FASWRNSEEARTDRPS Sbjct: 3 DPRVPSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHLSFASWRNSEEARTDRPS 62 Query: 748 QQLRSL 765 QQLR L Sbjct: 63 QQLRRL 68 [47][TOP] >UniRef100_B1EKX4 Beta-galactosidase (Lactase) n=1 Tax=Escherichia albertii TW07627 RepID=B1EKX4_9ESCH Length = 1020 Score = 93.2 bits (230), Expect = 5e-17 Identities = 42/56 (75%), Positives = 47/56 (83%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 ++SLAVVL RRDW NP VTQLNRL AHPPF+SWRNSEEAR + PS LRSLNG W+ Sbjct: 3 TDSLAVVLARRDWENPDVTQLNRLTAHPPFSSWRNSEEARDNHPSHSLRSLNGNWQ 58 [48][TOP] >UniRef100_A8AKB8 Beta-galactosidase n=1 Tax=Citrobacter koseri ATCC BAA-895 RepID=BGAL_CITK8 Length = 1025 Score = 89.7 bits (221), Expect = 6e-16 Identities = 40/56 (71%), Positives = 48/56 (85%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +++SLAVVL+ RDW NPGVTQLNRL AHPPF SWRN+++AR +R S Q RSLNGEW Sbjct: 4 NADSLAVVLKCRDWENPGVTQLNRLEAHPPFCSWRNADDARVNRDSAQKRSLNGEW 59 [49][TOP] >UniRef100_C1M7F7 Beta-D-galactosidase n=1 Tax=Citrobacter sp. 30_2 RepID=C1M7F7_9ENTR Length = 1029 Score = 89.4 bits (220), Expect = 8e-16 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 +++SL+ VL RRDW NPGVTQLNRL AHPPF SWR++++ART++ S QLRSLNG+W+ Sbjct: 4 NTDSLSAVLARRDWENPGVTQLNRLEAHPPFCSWRSADDARTNQRSSQLRSLNGQWQ 60 [50][TOP] >UniRef100_UPI0000ECBAF8 UPI0000ECBAF8 related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECBAF8 Length = 85 Score = 87.0 bits (214), Expect = 4e-15 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 617 IHWPSFYNVVTGXTLALPNLIALQHIPLSPAGVIAKRPAPIA 742 IHWPSFYNVVTG TLALPNLIALQHIPLSPAGVIAKRPAPIA Sbjct: 2 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIA 43 [51][TOP] >UniRef100_C2B186 Putative uncharacterized protein n=1 Tax=Citrobacter youngae ATCC 29220 RepID=C2B186_9ENTR Length = 1025 Score = 87.0 bits (214), Expect = 4e-15 Identities = 37/57 (64%), Positives = 48/57 (84%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 +++SL+ VL RRDW NPGVTQLNRL AHPPF SWR+++EAR ++PS RSLNG+W+ Sbjct: 4 NTDSLSAVLARRDWENPGVTQLNRLEAHPPFCSWRSADEARQNQPSPHQRSLNGKWR 60 [52][TOP] >UniRef100_A9MQ82 Beta-galactosidase n=1 Tax=Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- RepID=BGAL_SALAR Length = 1025 Score = 81.6 bits (200), Expect = 2e-13 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = +1 Query: 607 PSSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 P +SLA VL RRDW NP VTQ NRL AHPPF SWR +++A+ ++ + Q+RSLNG WK Sbjct: 3 PERDSLAAVLARRDWENPAVTQFNRLTAHPPFCSWRKADDAQRNQYAAQIRSLNGVWK 60 [53][TOP] >UniRef100_C8Q3J9 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Pantoea sp. At-9b RepID=C8Q3J9_9ENTR Length = 1022 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 S SL+ +L RRDW NP +T LNRL AHPPFASWR+ + AR DRPS RSLNG+W Sbjct: 5 SVSLSEILARRDWENPVITSLNRLDAHPPFASWRDEQAARDDRPSPSRRSLNGQW 59 [54][TOP] >UniRef100_B7LML8 Beta-galactosidase (Lactase) n=1 Tax=Escherichia fergusonii ATCC 35469 RepID=B7LML8_ESCF3 Length = 1077 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/57 (57%), Positives = 46/57 (80%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 +++SLA VL RRDW NP ++QLNRLAAHP F+SWR++E+AR + S + +LNGEW+ Sbjct: 59 NTDSLAAVLHRRDWENPAISQLNRLAAHPSFSSWRSAEDARNNLTSGSVLNLNGEWR 115 [55][TOP] >UniRef100_C6CD22 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Dickeya dadantii Ech703 RepID=C6CD22_DICDC Length = 1032 Score = 76.6 bits (187), Expect = 5e-12 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +LA +L RRDW NP +Q+NRL AHPPF+SWRN + AR D PS++ + LNGEW Sbjct: 9 TLAQILARRDWENPACSQVNRLDAHPPFSSWRNLQHARDDEPSRRRQPLNGEW 61 [56][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 62.4 bits (150), Expect(2) = 7e-12 Identities = 36/78 (46%), Positives = 38/78 (48%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW 123 G P PP + P P P G P P A G PPPPPPPPPPPP + Sbjct: 199 GPPPPPAYGP------PPPPPPPPPPPAYGPPP-----PPAYG---PPPPPPPPPPPPAY 244 Query: 122 *PPPPPPLW*PPPPPLRY 69 PPPPPP PPPPP Y Sbjct: 245 SPPPPPP---PPPPPAAY 259 Score = 33.9 bits (76), Expect(2) = 7e-12 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 441 PSFVPPPPPPPPLLYTIYRIQPLPLYQP 358 P++ PPPPPPPP Y P P Y P Sbjct: 135 PAYGPPPPPPPPPPPPAYGPPPPPAYGP 162 Score = 60.1 bits (144), Expect(2) = 2e-11 Identities = 34/75 (45%), Positives = 36/75 (48%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW 123 G P PP + P P P G P P A G PPPPPPPPPPPP + Sbjct: 153 GPPPPPAYGP------PPPPPPPPPPPAYGPPP-----PPAYG---PPPPPPPPPPPPAY 198 Query: 122 *PPPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 199 GPPPPPAYGPPPPPP 213 Score = 34.7 bits (78), Expect(2) = 2e-11 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 441 PSFVPPPPPPPPLLYTIYRIQPLPLYQP 358 P++ PPPPPPPP Y P P Y P Sbjct: 112 PAYAPPPPPPPPPPPPSYGPPPPPAYGP 139 Score = 60.1 bits (144), Expect(2) = 1e-09 Identities = 34/75 (45%), Positives = 36/75 (48%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW 123 G P PP + P P P G P P A G PPPPPPPPPPPP + Sbjct: 130 GPPPPPAYGP------PPPPPPPPPPPAYGPPP-----PPAYG---PPPPPPPPPPPPAY 175 Query: 122 *PPPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 176 GPPPPPAYGPPPPPP 190 Score = 28.5 bits (62), Expect(2) = 1e-09 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = -3 Query: 522 CNRVCLLPCGGSSPMYVGFSSYFTILLP--SFVPPPPPPPPLLYTIYRIQPLPLYQP 358 C+ + L+P + P Y + P ++ PPPPPP Y P P Y P Sbjct: 66 CDEIVLVPGKPAPPAYAPPPPVYAPPPPPPAYAPPPPPP------AYAPPPPPAYAP 116 Score = 63.9 bits (154), Expect(2) = 4e-09 Identities = 37/94 (39%), Positives = 46/94 (48%) Frame = -1 Query: 359 PPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRA 180 PP ++ D I V + G PAPP + P + P P + P + P Sbjct: 57 PPPPPAYDDCDEI--VLVPGKPAPPAYAPPPPVYAPP----PPPPAYAPPPPPPAYAPPP 110 Query: 179 AGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 +PPPPPPPPPPPP + PPPPP PPPPP Sbjct: 111 PPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPP 144 Score = 23.1 bits (48), Expect(2) = 4e-09 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 429 PPPPPPPP 406 P PPPPPP Sbjct: 54 PQPPPPPP 61 Score = 60.1 bits (144), Expect(2) = 3e-08 Identities = 34/75 (45%), Positives = 36/75 (48%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW 123 G P PP + P P P G P P A G PPPPPPPPPPPP + Sbjct: 176 GPPPPPAYGP------PPPPPPPPPPPAYGPPP-----PPAYG---PPPPPPPPPPPPAY 221 Query: 122 *PPPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 222 GPPPPPAYGPPPPPP 236 Score = 23.9 bits (50), Expect(2) = 3e-08 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P PPPPPPP Sbjct: 134 PPAYGPPPPPPP 145 Score = 63.9 bits (154), Expect = 3e-08 Identities = 27/46 (58%), Positives = 31/46 (67%), Gaps = 6/46 (13%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPP------PPPLW*PPPPPPLW*PPPPPLRY 69 P A G +PPPPPPPPP PPP + PPPPPP + PPPPP +Y Sbjct: 323 PPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKY 368 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 7/47 (14%) Frame = -1 Query: 188 PRAAGYASPPPP-------PPPPPPPPLW*PPPPPPLW*PPPPPLRY 69 P YA PPPP PPPPPPPP + PPPPPP + PPPPP Y Sbjct: 313 PPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAY 359 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 188 PRAAGYA-SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 P A YA PPPPPPPPPPPP + PPPPP PPPPP Sbjct: 277 PPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPP 314 Score = 60.1 bits (144), Expect = 5e-07 Identities = 30/58 (51%), Positives = 32/58 (55%), Gaps = 7/58 (12%) Frame = -1 Query: 188 PRAAGYASPPPPPPP-------PPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 P Y+ PPPPPPP PPPPP + PPPPPP PPPPP AY Y P P Sbjct: 239 PPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPP---PPPPP---AAYAYGPPPPP 290 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 5/45 (11%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPP-----PPPLW*PPPPPPLW*PPPPPLRY 69 P A G PPPPPPPPP PPP + PPPPPP PPPPP Y Sbjct: 134 PPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPP---PPPPPPAY 175 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 7/44 (15%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPP-------PPPLW*PPPPPPLW*PPPPP 78 P Y PPPPPPPPP PPP PPPPPP + PPPPP Sbjct: 262 PPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPP 305 [57][TOP] >UniRef100_UPI000198522B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI000198522B Length = 1426 Score = 55.5 bits (132), Expect(3) = 2e-11 Identities = 36/81 (44%), Positives = 38/81 (46%), Gaps = 6/81 (7%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPP----PPPPP 135 GGP PP PL P PRS P P G PPPPP PPPPP Sbjct: 864 GGPPPPPPPPLHG--APPPPPPPPRSGVPPPPP-----PPMRGAPPPPPPPMRGAPPPPP 916 Query: 134 PPLW*--PPPPPPLW*PPPPP 78 PP+ PPPPPP+ PPPP Sbjct: 917 PPMGRAPPPPPPPMRGAPPPP 937 Score = 29.6 bits (65), Expect(3) = 2e-11 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 450 ILLPSFVPPPPPPPP 406 I LP PPPPPPPP Sbjct: 775 IALPPSPPPPPPPPP 789 Score = 29.3 bits (64), Expect(3) = 2e-11 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 432 VPPPPPPPPL 403 VPPPPPPPPL Sbjct: 829 VPPPPPPPPL 838 [58][TOP] >UniRef100_Q6D736 Beta-galactosidase n=1 Tax=Pectobacterium atrosepticum RepID=BGAL_ERWCT Length = 1040 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/54 (61%), Positives = 36/54 (66%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 +L +L RRDW NP T RL AHPPF SWRN A D PSQ+LR LNGEWK Sbjct: 15 TLREILARRDWENPACTNYQRLPAHPPFNSWRNVAAAHQDEPSQRLRRLNGEWK 68 [59][TOP] >UniRef100_A9ZAC4 Beta-galactosidase (Lactase) n=2 Tax=Yersinia pestis RepID=A9ZAC4_YERPE Length = 585 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 SL +L RRDW NP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W Sbjct: 4 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 56 [60][TOP] >UniRef100_A9R0J8 Beta-galactosidase n=6 Tax=Yersinia pestis RepID=BGAL_YERPG Length = 1050 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 SL +L RRDW NP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W Sbjct: 4 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 56 [61][TOP] >UniRef100_B2K6E6 Beta-galactosidase n=3 Tax=Yersinia pseudotuberculosis RepID=BGAL_YERPB Length = 1066 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 SL +L RRDW NP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W Sbjct: 14 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 [62][TOP] >UniRef100_Q1C6T8 Beta-galactosidase n=8 Tax=Yersinia pestis RepID=BGAL_YERPA Length = 1060 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 SL +L RRDW NP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W Sbjct: 14 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 [63][TOP] >UniRef100_A7FH78 Beta-galactosidase n=1 Tax=Yersinia pseudotuberculosis IP 31758 RepID=BGAL_YERP3 Length = 1066 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 SL +L RRDW NP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W Sbjct: 14 SLPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 [64][TOP] >UniRef100_Q6QI34 LRRGT00174 n=1 Tax=Rattus norvegicus RepID=Q6QI34_RAT Length = 419 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 783 QFPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARV 655 Q PFAIQ A +LGRAIGAGLFAITPAGERGMCCKAIKL +++ Sbjct: 324 QAPFAIQDAHMLGRAIGAGLFAITPAGERGMCCKAIKLVESQI 366 [65][TOP] >UniRef100_C6CN33 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Dickeya zeae Ech1591 RepID=C6CN33_DICZE Length = 1036 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/56 (57%), Positives = 38/56 (67%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 S SLA +L RRDW NP + RL AHPPF+SWRN AR D+PS + + LNGEW Sbjct: 11 SGLSLADILARRDWENPACPHIRRLDAHPPFSSWRNLNAARDDQPSDRRQMLNGEW 66 [66][TOP] >UniRef100_C6NAI9 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Pectobacterium wasabiae WPP163 RepID=C6NAI9_9ENTR Length = 1043 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 +L +L RRDW NP T RL AHPPF SWR+ A+ D PSQ+LR +NGEWK Sbjct: 15 TLQEILARRDWENPACTNYQRLPAHPPFNSWRSITAAQQDEPSQRLRRMNGEWK 68 [67][TOP] >UniRef100_C4T763 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Yersinia intermedia ATCC 29909 RepID=C4T763_YERIN Length = 1053 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 622 LAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 LA +L RRDW NP VTQ +RL AHPPF SWR+S+ A+ D PS Q LNG+W Sbjct: 15 LAQILSRRDWENPQVTQYHRLEAHPPFYSWRDSDSAKNDIPSPQRCLLNGQW 66 [68][TOP] >UniRef100_UPI0000ECAFAB UPI0000ECAFAB related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECAFAB Length = 81 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 617 IHWPSFYNVVTGXTLALPNLIALQHIPLSPAGVI 718 IHWPSFYNVVTG TLALPNLIALQHIPLSPAGVI Sbjct: 2 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI 35 [69][TOP] >UniRef100_UPI0001826C8D hypothetical protein ENTCAN_01162 n=1 Tax=Enterobacter cancerogenus ATCC 35316 RepID=UPI0001826C8D Length = 1030 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/54 (61%), Positives = 38/54 (70%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 +L+ +L RRDW NPGVTQ NRLAAH P SWR+ AR D S RSLNGEW+ Sbjct: 8 TLSALLARRDWENPGVTQWNRLAAHAPLHSWRDERCAREDEHSPGRRSLNGEWR 61 [70][TOP] >UniRef100_UPI0001A43550 beta-D-galactosidase n=1 Tax=Pectobacterium carotovorum subsp. brasiliensis PBR1692 RepID=UPI0001A43550 Length = 1043 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L +L RRDW NP T RL AHPPF SWR+ A+ D PSQ+LR LNGEW Sbjct: 15 TLQEILARRDWENPACTHYQRLPAHPPFNSWRSVAAAQQDEPSQRLRRLNGEW 67 [71][TOP] >UniRef100_A1JTC4 Beta-galactosidase n=1 Tax=Yersinia enterocolitica subsp. enterocolitica 8081 RepID=BGAL_YERE8 Length = 1050 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L+ +L RRDW NP +TQ NRL AHPPF SWR+ + A+ D PS Q + LNG+W Sbjct: 14 ALSQILFRRDWENPQITQYNRLEAHPPFYSWRHLDAAQNDTPSPQRQLLNGQW 66 [72][TOP] >UniRef100_A3FEW8 Beta-galactosidase n=1 Tax=Pantoea agglomerans RepID=BGAL_ENTAG Length = 1028 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 S SL+ +L RRDW NPGVTQ +RL AH PF SWR+ AR D + + RSLNG+W+ Sbjct: 5 SPMSLSKILARRDWENPGVTQWHRLPAHAPFNSWRDEASARADDNASRKRSLNGDWQ 61 [73][TOP] >UniRef100_A4W7D2 Beta-galactosidase n=1 Tax=Enterobacter sp. 638 RepID=BGAL_ENT38 Length = 1028 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +1 Query: 610 SSNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 S SL+ +L RRDW NPGVTQ +RL AH PF SWR+ AR D + + RSLNG+W+ Sbjct: 5 SPMSLSKILARRDWENPGVTQWHRLPAHAPFNSWRDEASARADDNASRKRSLNGDWQ 61 [74][TOP] >UniRef100_C6DD29 Beta-galactosidase n=1 Tax=Pectobacterium carotovorum subsp. carotovorum PC1 RepID=C6DD29_PECCP Length = 1043 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L +L RRDW NP T RL AHPPF SWR+ A+ D PSQ+LR LNGEW Sbjct: 15 TLQEILSRRDWENPTCTHYQRLPAHPPFNSWRSVATAQQDEPSQRLRRLNGEW 67 [75][TOP] >UniRef100_C8QMV2 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Dickeya dadantii Ech586 RepID=C8QMV2_DICDA Length = 1036 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/59 (55%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = +1 Query: 604 VPSSN-SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 VP S+ SLA +L RRDW NP + RL AHPPF+SWR+ AR D+PS + + LNGEW Sbjct: 8 VPLSDISLADILARRDWENPACPHIRRLDAHPPFSSWRDLNAARDDKPSDRRQLLNGEW 66 [76][TOP] >UniRef100_B4G4K5 GL24546 n=1 Tax=Drosophila persimilis RepID=B4G4K5_DROPE Length = 314 Score = 40.4 bits (93), Expect(3) = 4e-10 Identities = 22/67 (32%), Positives = 26/67 (38%) Frame = -2 Query: 343 VFPISSLSIPSTSRGGQLHRGGGRSRTSGSPL*N*WIPALELVDPRSRTSGSPGLQGTHH 164 + PI SL +P +GG H G G P P + G PG G H Sbjct: 71 IIPIPSLPLPPPHKGGHHHHHKGSKGPPGPP-----------GPPGTGPPGPPGPPGNSH 119 Query: 163 HHHHHHH 143 HHH H H Sbjct: 120 HHHPHPH 126 Score = 39.7 bits (91), Expect(3) = 4e-10 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNPY 33 PPPPPP P PP + P PP W P P P+ + + ++ + Y Sbjct: 130 PPPPPPYPYPPTVPYPTPPQIPWFPVPVPVPWPSKGHKGDKGHY 173 Score = 29.6 bits (65), Expect(3) = 4e-10 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 450 ILLPSFVPPPPPPPP 406 +LLP PPPPPPPP Sbjct: 38 LLLPPPHPPPPPPPP 52 [77][TOP] >UniRef100_C4UNI8 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Yersinia ruckeri ATCC 29473 RepID=C4UNI8_YERRU Length = 1031 Score = 69.7 bits (169), Expect = 6e-10 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = +1 Query: 631 VLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L RRDW N G+TQ NRL HPPF SWR+ +AR D S +LR+LNG W Sbjct: 1 MLARRDWENSGITQYNRLDTHPPFQSWRDINQARNDMASSRLRTLNGNW 49 [78][TOP] >UniRef100_C4S827 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Yersinia mollaretii ATCC 43969 RepID=C4S827_YERMO Length = 1048 Score = 69.7 bits (169), Expect = 6e-10 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L+ +L RRDW NP VTQ +RL AHPPF SWR+ + A++D PS Q + LNG W Sbjct: 14 TLSQILSRRDWENPQVTQYHRLEAHPPFQSWRDVDAAQSDSPSSQRQLLNGLW 66 [79][TOP] >UniRef100_B5DWM1 GA26446 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DWM1_DROPS Length = 580 Score = 42.7 bits (99), Expect(3) = 8e-10 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PP------PPPPLW*PPPPPLRYQAYRYRRPRNPY 33 P PPPPPPPPPP PP PP W P P P+ + + ++ + Y Sbjct: 234 PHPPPPPPPPPPYPYPPTVPYPTPPQIPWFPVPVPVPWPSKGHKGDKGHY 283 Score = 39.3 bits (90), Expect(3) = 8e-10 Identities = 21/67 (31%), Positives = 26/67 (38%) Frame = -2 Query: 343 VFPISSLSIPSTSRGGQLHRGGGRSRTSGSPL*N*WIPALELVDPRSRTSGSPGLQGTHH 164 + PI +L +P +GG H G G P P + G PG G H Sbjct: 180 IIPIPTLPLPPPHKGGHHHHHKGSKGPPGPP-----------GPPGTGPPGPPGPPGNSH 228 Query: 163 HHHHHHH 143 HHH H H Sbjct: 229 HHHPHPH 235 Score = 26.6 bits (57), Expect(3) = 8e-10 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P PPPPPPPP Sbjct: 142 PPGPPPPPPPPP 153 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPP PPPPPPPP PPPPPP PPPPP Sbjct: 141 PPPGPPPPPPPP---PPPPPP---PPPPP 163 Score = 28.9 bits (63), Expect(2) = 2e-07 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 193 GSPGLQGTHHHHHHHHHHH 137 G PG H HHHHHH Sbjct: 122 GPPGPSKYRGDHDHHHHHH 140 [80][TOP] >UniRef100_A8GGN3 Beta-galactosidase n=1 Tax=Serratia proteamaculans 568 RepID=BGAL_SERP5 Length = 1029 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/54 (55%), Positives = 37/54 (68%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 SL +L RRDW NP T RLAAHPPF+SWRN AR D+ S+ + LNG+W+ Sbjct: 8 SLKDLLARRDWQNPACTHYQRLAAHPPFSSWRNLNAARDDKSSESRQILNGDWQ 61 [81][TOP] >UniRef100_C4UWA9 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Yersinia rohdei ATCC 43380 RepID=C4UWA9_YERRO Length = 1048 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L +L RRDW NP VTQ +RL AHPPF SWR+ + A++D S Q SLNG+W Sbjct: 14 TLTQILSRRDWENPQVTQYHRLEAHPPFHSWRDLDAAKSDSYSPQRLSLNGQW 66 [82][TOP] >UniRef100_A0R4Q4 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis str. MC2 155 RepID=A0R4Q4_MYCS2 Length = 93 Score = 67.4 bits (163), Expect = 3e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 158 PPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPP W PPPPPP+W PPPPP Sbjct: 49 PPPPPPPPPPFWRPPPPPPIWLPPPPP 75 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 5/34 (14%) Frame = -1 Query: 164 PPPPPP---PPPPPPLW*PPPPPP--LW*PPPPP 78 PPPPPP PPPPPP+W PPPPPP W PPPPP Sbjct: 53 PPPPPPFWRPPPPPPIWLPPPPPPPPFWGPPPPP 86 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPP----LW*PPPPP 78 P PPPPPPPPP W PPPPPP W PPPPP Sbjct: 34 PAFPPPPPPPPPFWGPPPPPPPPPPFWRPPPPP 66 [83][TOP] >UniRef100_C4SNG6 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Yersinia frederiksenii ATCC 33641 RepID=C4SNG6_YERFR Length = 1049 Score = 67.4 bits (163), Expect = 3e-09 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L+ +L RRDW NP VTQ +RL +HPPF SWR+ A+ D S Q R LNG+W Sbjct: 14 TLSQILSRRDWENPQVTQYHRLESHPPFHSWRDINSAQNDTASPQRRLLNGQW 66 [84][TOP] >UniRef100_B4MHE7 GJ14580 n=1 Tax=Drosophila virilis RepID=B4MHE7_DROVI Length = 62 Score = 67.0 bits (162), Expect = 4e-09 Identities = 33/52 (63%), Positives = 37/52 (71%) Frame = -2 Query: 778 SIRHSGCATVGKGDRCGPLRYYASWRKGDVLQGD*VG*RQGXPSHDVVKRRP 623 +IRHS CA V KGDRC PLRYYA+ RKGDVL+ + Q PS DVV RRP Sbjct: 11 AIRHSACAPVTKGDRCAPLRYYATRRKGDVLRAEKSRYHQVFPSQDVVDRRP 62 [85][TOP] >UniRef100_C4LCJ5 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Tolumonas auensis DSM 9187 RepID=C4LCJ5_TOLAT Length = 1025 Score = 66.6 bits (161), Expect = 5e-09 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +1 Query: 622 LAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 LA L RRDW NP VT L+RLAAH P +SWR+ + AR + PS + SLNG+W+ Sbjct: 3 LAQCLARRDWENPAVTSLHRLAAHTPQSSWRDLDAARKELPSDSVVSLNGDWQ 55 [86][TOP] >UniRef100_C4TZY5 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Yersinia kristensenii ATCC 33638 RepID=C4TZY5_YERKR Length = 552 Score = 66.6 bits (161), Expect = 5e-09 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L+ +L RRDW +P +TQ NRL AHPPF SWRN + A+ D S Q + LNG+W Sbjct: 14 ALSQILFRRDWESPQITQYNRLEAHPPFYSWRNIDAAQDDTYSPQRQLLNGQW 66 [87][TOP] >UniRef100_C4S4I9 Glycoside hydrolase family 2 TIM barrel n=1 Tax=Yersinia bercovieri ATCC 43970 RepID=C4S4I9_YERBE Length = 1058 Score = 66.6 bits (161), Expect = 5e-09 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L+ +L RRDW NP VTQ +RL AHPPF SWR+ A++D S Q + LNG W Sbjct: 24 TLSQILSRRDWENPQVTQYHRLEAHPPFQSWRDVNAAQSDSASAQRQLLNGSW 76 [88][TOP] >UniRef100_UPI000175F21B PREDICTED: similar to Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein) n=1 Tax=Danio rerio RepID=UPI000175F21B Length = 1565 Score = 51.6 bits (122), Expect(3) = 6e-09 Identities = 39/124 (31%), Positives = 53/124 (42%), Gaps = 11/124 (8%) Frame = -1 Query: 413 HHRYYIQYTESNLYPCINPPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVD 234 HH+ Q + P + PPS ++I + P PP P + L+L Sbjct: 775 HHKPQPQIQQQ--VPPVPPPSKPQSNNIPSGANIPPPPPPPPPASMPPPGSAMAVLKLGP 832 Query: 233 PRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW-----*PPPPPPLW------*PP 87 P + IP+ + SPP PPPPPPPPP+ PPPPP+ PP Sbjct: 833 PAAAV---------IPQIS--PSPPSPPPPPPPPPIMPVQSQPQPPPPPIMPMQSQPLPP 881 Query: 86 PPPL 75 PPP+ Sbjct: 882 PPPI 885 Score = 26.9 bits (58), Expect(3) = 6e-09 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P+ PPPPPPPP Sbjct: 728 PAPPPPPPPPPP 739 Score = 26.9 bits (58), Expect(3) = 6e-09 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 429 PPPPPPPPLLYTI 391 PPPPPPPP + +I Sbjct: 736 PPPPPPPPPISSI 748 [89][TOP] >UniRef100_UPI00015A6C38 UPI00015A6C38 related cluster n=1 Tax=Danio rerio RepID=UPI00015A6C38 Length = 1486 Score = 51.6 bits (122), Expect(3) = 6e-09 Identities = 39/124 (31%), Positives = 53/124 (42%), Gaps = 11/124 (8%) Frame = -1 Query: 413 HHRYYIQYTESNLYPCINPPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVD 234 HH+ Q + P + PPS ++I + P PP P + L+L Sbjct: 721 HHKPQPQIQQQ--VPPVPPPSKPQSNNIPSGANIPPPPPPPPPASMPPPGSAMAVLKLGP 778 Query: 233 PRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW-----*PPPPPPLW------*PP 87 P + IP+ + SPP PPPPPPPPP+ PPPPP+ PP Sbjct: 779 PAAAV---------IPQIS--PSPPSPPPPPPPPPIMPVQSQPQPPPPPIMPMQSQPLPP 827 Query: 86 PPPL 75 PPP+ Sbjct: 828 PPPI 831 Score = 26.9 bits (58), Expect(3) = 6e-09 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P+ PPPPPPPP Sbjct: 674 PAPPPPPPPPPP 685 Score = 26.9 bits (58), Expect(3) = 6e-09 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 429 PPPPPPPPLLYTI 391 PPPPPPPP + +I Sbjct: 682 PPPPPPPPPISSI 694 [90][TOP] >UniRef100_B0R0R1 Novel protein similar to human Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 (RAPH1) n=1 Tax=Danio rerio RepID=B0R0R1_DANRE Length = 1486 Score = 51.6 bits (122), Expect(3) = 6e-09 Identities = 39/124 (31%), Positives = 53/124 (42%), Gaps = 11/124 (8%) Frame = -1 Query: 413 HHRYYIQYTESNLYPCINPPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVD 234 HH+ Q + P + PPS ++I + P PP P + L+L Sbjct: 721 HHKPQPQIQQQ--VPPVPPPSKPQSNNIPSGANIPPPPPPPPPASMPPPGSAMAVLKLGP 778 Query: 233 PRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW-----*PPPPPPLW------*PP 87 P + IP+ + SPP PPPPPPPPP+ PPPPP+ PP Sbjct: 779 PAAAV---------IPQIS--PSPPSPPPPPPPPPIMPVQSQPQPPPPPIMPIQSQPLPP 827 Query: 86 PPPL 75 PPP+ Sbjct: 828 PPPI 831 Score = 26.9 bits (58), Expect(3) = 6e-09 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P+ PPPPPPPP Sbjct: 674 PAPPPPPPPPPP 685 Score = 26.9 bits (58), Expect(3) = 6e-09 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 429 PPPPPPPPLLYTI 391 PPPPPPPP + +I Sbjct: 682 PPPPPPPPPISSI 694 [91][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 66.2 bits (160), Expect = 7e-09 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -1 Query: 182 AAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLR 72 AAG+A PPPPPPPPPPPP PPPPPP PPPPP + Sbjct: 227 AAGFAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQ 263 [92][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 66.2 bits (160), Expect = 7e-09 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -1 Query: 173 YASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 +ASPPPPPPPPPPPP PPPPPP PPPPP Y+A + Sbjct: 256 FASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAYEAREF 295 [93][TOP] >UniRef100_Q2XQU3 Beta-galactosidase 2 n=1 Tax=Enterobacter cloacae RepID=BGAL2_ENTCL Length = 1029 Score = 66.2 bits (160), Expect = 7e-09 Identities = 31/56 (55%), Positives = 36/56 (64%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 S +L+ +L RRDW NPGVTQ NRL AH P SWR + A D S RSLNG W+ Sbjct: 6 SLTLSAILARRDWENPGVTQWNRLEAHAPLHSWRLEQPALDDAASASRRSLNGVWR 61 [94][TOP] >UniRef100_Q47077 Beta-galactosidase n=1 Tax=Enterobacter cloacae RepID=BGAL1_ENTCL Length = 1028 Score = 66.2 bits (160), Expect = 7e-09 Identities = 31/56 (55%), Positives = 38/56 (67%) Frame = +1 Query: 613 SNSLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 S +L+ +L RRDW NP VTQ NRLAAH P SWRN AR D S + ++LNG W+ Sbjct: 6 SLTLSALLARRDWENPVVTQWNRLAAHAPLHSWRNEPSARDDAGSARRQTLNGLWR 61 [95][TOP] >UniRef100_B4PWJ8 GE16594 n=1 Tax=Drosophila yakuba RepID=B4PWJ8_DROYA Length = 195 Score = 58.2 bits (139), Expect(3) = 9e-09 Identities = 33/74 (44%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGG-GGGGDAYPAARGIH*F*SGDPLVLERGSTSSRAG 255 GGGGG+ +GGGGGG+ +GGGGGGGG GGGGD ++ E GS+ G Sbjct: 22 GGGGGWSSGGGGGGWSSGGGGGGGGHGGGGDVQII-----------KVITESGSSGGGGG 70 Query: 256 IH*F*SGRHRGGAG 297 + SG GG G Sbjct: 71 GGGWSSGGGGGGGG 84 Score = 25.4 bits (54), Expect(3) = 9e-09 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 371 GRGWILYIVYSSGGGGGGGG 430 G GW SSGGGGG GG Sbjct: 92 GGGW------SSGGGGGSGG 105 Score = 21.6 bits (44), Expect(3) = 9e-09 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 407 GGGGGGGGTKEG 442 G GGGGGG G Sbjct: 124 GHGGGGGGWSSG 135 Score = 53.9 bits (128), Expect(2) = 3e-06 Identities = 31/73 (42%), Positives = 39/73 (53%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGSTSSRAGI 258 GGGGG +GGGGGG+ +GGGGGG GGG + ++ G G V++ SS G Sbjct: 118 GGGGGGGHGGGGGGWSSGGGGGGWSSGGGGGHGSSGG------GGTKVIKIIKLSSGGG- 170 Query: 259 H*F*SGRHRGGAG 297 G H GG G Sbjct: 171 -----GGHGGGGG 178 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 407 GGGGGGGG 430 GGGGGGGG Sbjct: 174 GGGGGGGG 181 [96][TOP] >UniRef100_B4NYJ9 GE18286 n=1 Tax=Drosophila yakuba RepID=B4NYJ9_DROYA Length = 622 Score = 58.2 bits (139), Expect(2) = 1e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 505 PPPPPPPPPPPP---PPPPPPTEPPPPPP 530 Score = 27.3 bits (59), Expect(2) = 1e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 169 HHHHHHHHHH 140 H HHHHH HH Sbjct: 494 HPHHHHHVHH 503 Score = 57.8 bits (138), Expect(2) = 1e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 504 PPPPPPPPPPPP---PPPPPPPTEPPPPP 529 Score = 27.3 bits (59), Expect(2) = 1e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 166 HHHHHHHHHH 137 H HHHHH HH Sbjct: 494 HPHHHHHVHH 503 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPP PPPP R + Y Y Sbjct: 509 PPPPPPPPPPPPPPTEPPPPP---PPPPEPRVKKYSY 542 [97][TOP] >UniRef100_B3N3R7 GG25000 n=1 Tax=Drosophila erecta RepID=B3N3R7_DROER Length = 613 Score = 58.2 bits (139), Expect(2) = 1e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 496 PPPPPPPPPPPP---PPPPPPTEPPPPPP 521 Score = 27.3 bits (59), Expect(2) = 1e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 169 HHHHHHHHHH 140 H HHHHH HH Sbjct: 486 HPHHHHHVHH 495 Score = 56.2 bits (134), Expect(2) = 4e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPP PPPP R + Y Y Sbjct: 500 PPPPPPPPPPPPPPTEPPPPP---PPPPEPRVKKYSY 533 Score = 27.3 bits (59), Expect(2) = 4e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 166 HHHHHHHHHH 137 H HHHHH HH Sbjct: 486 HPHHHHHVHH 495 [98][TOP] >UniRef100_B4LT77 GJ19953 n=1 Tax=Drosophila virilis RepID=B4LT77_DROVI Length = 609 Score = 56.2 bits (134), Expect(2) = 1e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPP PPPP R + Y Y Sbjct: 497 PPPPPPPPPPPPPPTEPPPPP---PPPPEPRVKKYSY 530 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -2 Query: 187 PGLQGTHHHHHHHHHH 140 P L HH HHHHHH Sbjct: 478 PELIYDDHHPHHHHHH 493 Score = 50.1 bits (118), Expect(2) = 1e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -1 Query: 155 PPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPP PPPPPP PPPPP Sbjct: 496 PPPPPPPPP---PPPPPPTEPPPPPP 518 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -2 Query: 163 HHHHHHHHH 137 HH HHHHHH Sbjct: 485 HHPHHHHHH 493 [99][TOP] >UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY Length = 311 Score = 55.8 bits (133), Expect(2) = 1e-08 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 5/56 (8%) Frame = -1 Query: 188 PRAAGYASPPPPPP--PPPPPPLW*---PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 P Y SPPPPPP PPPP++ PPPPPP++ PPPP+ Y+Y+ P P Sbjct: 229 PPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVYKSPPPPV----YKYKSPPPP 280 Score = 29.3 bits (64), Expect(2) = 1e-08 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 8/47 (17%) Frame = -3 Query: 423 PPPPPPLLYTIYRIQPLPLYQ---PTKQSKFFRYQA-----YRYRRP 307 PPPPPP+ Y+ P P+Y+ P ++Y++ Y+Y+ P Sbjct: 195 PPPPPPM----YKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSP 237 Score = 54.3 bits (129), Expect(2) = 1e-07 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 5/56 (8%) Frame = -1 Query: 188 PRAAGYASPPPPPP--PPPPPPLW*---PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 P Y SPPPPPP PPPP++ PPPPPP+ PPPP+ Y+Y+ P P Sbjct: 137 PPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPI----YKYKSPPPP 188 Score = 53.5 bits (127), Expect(2) = 1e-07 Identities = 29/78 (37%), Positives = 36/78 (46%), Gaps = 27/78 (34%) Frame = -1 Query: 188 PRAAGYASPPPPPP--------------PPPPPPLW*-------------PPPPPPLW*P 90 P Y SPPPPPP PPPPPP++ PPPPPP++ Sbjct: 187 PPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKS 246 Query: 89 PPPPLRYQAYRYRRPRNP 36 PPPP+ Y+Y+ P P Sbjct: 247 PPPPI----YKYKSPPPP 260 Score = 28.1 bits (61), Expect(2) = 1e-07 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 10/51 (19%) Frame = -3 Query: 429 PPPPP-----PPPLLYTIYRIQPLPLYQPTKQSKFFRYQA-----YRYRRP 307 PPPPP PPP +Y P P + ++Y++ Y+Y+ P Sbjct: 145 PPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSP 195 Score = 27.3 bits (59), Expect(2) = 1e-07 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 11/52 (21%) Frame = -3 Query: 429 PPPPP-----PPPLLYTIYRIQPLPLYQ------PTKQSKFFRYQAYRYRRP 307 PPPPP PPP +Y Y+ P P+Y+ P K Y+Y+ P Sbjct: 85 PPPPPPVYKSPPPPVYK-YKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSP 135 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 28/66 (42%), Positives = 36/66 (54%), Gaps = 15/66 (22%) Frame = -1 Query: 188 PRAAGYASPPPPPP------PP------PPPPLW*---PPPPPPLW*PPPPPLRYQAYRY 54 P Y SPPPPPP PP PPPP++ PPPPPP++ PPPP+ Y++ Sbjct: 157 PPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPV----YKH 212 Query: 53 RRPRNP 36 + P P Sbjct: 213 KSPPPP 218 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 423 PPPPPPLLYTIYRIQPLPLYQPTKQSKFFRYQAYRYRRP 307 PPPPPP +Y+ P P+Y+ Y+Y+ P Sbjct: 115 PPPPPP----VYKSPPPPVYKYKSPPP----PVYKYKSP 145 Score = 53.9 bits (128), Expect(2) = 3e-06 Identities = 31/75 (41%), Positives = 38/75 (50%), Gaps = 15/75 (20%) Frame = -1 Query: 188 PRAAGYASPPPPPP------PP------PPPPLW*---PPPPPPLW*PPPPPLRYQAYRY 54 P Y SPPPPPP PP PPPP++ PPPPPP++ PPPP+ Y+Y Sbjct: 107 PPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPV----YKY 162 Query: 53 RRPRNPYD*RSSESP 9 + P P S P Sbjct: 163 KSPPPPPPVHKSPPP 177 Score = 23.5 bits (49), Expect(2) = 3e-06 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -3 Query: 417 PPPPLLYTIYRIQPLPLYQ---PTKQSKFFRY---QAYRYRRP 307 PPPP +Y P P+Y+ P +R Y+Y+ P Sbjct: 33 PPPPTKKYVYSSPPPPVYKYKSPPPPLPIYRSPPPPVYKYKSP 75 [100][TOP] >UniRef100_B4MZM3 GK24347 n=1 Tax=Drosophila willistoni RepID=B4MZM3_DROWI Length = 608 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPP PPP R + Y Y Sbjct: 496 PPPPPPPPPPPPPTEPPPPP----PPPQEPRVKKYSY 528 Score = 30.8 bits (68), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 169 HHHHHHHHHHH 137 H HHHHHHH H Sbjct: 481 HPHHHHHHHPH 491 [101][TOP] >UniRef100_Q2L049 Filamentous hemagglutinin/adhesin n=1 Tax=Bordetella avium 197N RepID=Q2L049_BORA1 Length = 2621 Score = 50.8 bits (120), Expect(3) = 2e-08 Identities = 30/73 (41%), Positives = 33/73 (45%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP P P ++ VDP P P+ PPPPPPPPP P Sbjct: 2390 PPPPPPPP------PKVKKVDPPPPPPPPP------PKVKKVDPPPPPPPPPPKVKKVDP 2437 Query: 116 PPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 2438 PPPPP---PPPPP 2447 Score = 31.6 bits (70), Expect(3) = 2e-08 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLPLYQPTKQSK 343 PPPPPPPP + ++ P P P K K Sbjct: 2325 PPPPPPPPPPPKVKKVDPPPPPPPPKVKK 2353 Score = 21.2 bits (43), Expect(3) = 2e-08 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -3 Query: 432 VPPPPPPPP 406 + P PPPPP Sbjct: 2317 IDPSPPPPP 2325 Score = 50.8 bits (120), Expect(2) = 4e-07 Identities = 30/73 (41%), Positives = 33/73 (45%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP P P ++ VDP P P+ PPPPPPPPPP Sbjct: 2406 PPPPPPPP------PKVKKVDPPPPPPPPP------PKVKKVDPPPPPPPPPPPKVKKVD 2453 Query: 116 PPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 2454 PPPPP---PPPPP 2463 Score = 29.3 bits (64), Expect(2) = 4e-07 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLPLYQPTKQSK 343 PPPPPPPP + + P P P K K Sbjct: 2374 PPPPPPPPKVKKVDPPPPPPPPPPPKVKK 2402 Score = 50.1 bits (118), Expect(2) = 9e-07 Identities = 30/73 (41%), Positives = 32/73 (43%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP P P ++ VDP P P PPPPPPPPPP Sbjct: 2422 PPPPPPPP------PKVKKVDPPPPPPPPP------PPKVKKVDPPPPPPPPPPKVKKVD 2469 Query: 116 PPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 2470 PPPPP---PPPPP 2479 Score = 28.9 bits (63), Expect(2) = 9e-07 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLP 370 PPPPPPPP + ++ P P Sbjct: 2388 PPPPPPPPPPPKVKKVDPPP 2407 Score = 52.4 bits (124), Expect(2) = 1e-06 Identities = 34/96 (35%), Positives = 41/96 (42%) Frame = -1 Query: 365 INPPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIP 186 ++PP +K +D P PP P P ++ VDP P P Sbjct: 2340 VDPPPPPPPPKVKKVDP------PPPPPPPP------PKVKKVDPPPPPPPPP------P 2381 Query: 185 RAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 + PPPPPPPPPP PPPPP PPPPP Sbjct: 2382 KVKKVDPPPPPPPPPPPKVKKVDPPPPP---PPPPP 2414 Score = 26.2 bits (56), Expect(2) = 1e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 429 PPPPPPPP 406 PPPPPPPP Sbjct: 2321 PPPPPPPP 2328 [102][TOP] >UniRef100_Q8GD27 Adhesin FhaB n=1 Tax=Bordetella avium RepID=Q8GD27_BORAV Length = 2621 Score = 50.8 bits (120), Expect(3) = 2e-08 Identities = 30/73 (41%), Positives = 33/73 (45%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP P P ++ VDP P P+ PPPPPPPPP P Sbjct: 2390 PPPPPPPP------PKVKKVDPPPPPPPPP------PKVKKVDPPPPPPPPPPKVKKVDP 2437 Query: 116 PPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 2438 PPPPP---PPPPP 2447 Score = 31.6 bits (70), Expect(3) = 2e-08 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLPLYQPTKQSK 343 PPPPPPPP + ++ P P P K K Sbjct: 2325 PPPPPPPPPPPKVKKVDPPPPPPPPKVKK 2353 Score = 21.2 bits (43), Expect(3) = 2e-08 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -3 Query: 432 VPPPPPPPP 406 + P PPPPP Sbjct: 2317 IDPSPPPPP 2325 Score = 50.8 bits (120), Expect(2) = 4e-07 Identities = 30/73 (41%), Positives = 33/73 (45%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP P P ++ VDP P P+ PPPPPPPPPP Sbjct: 2406 PPPPPPPP------PKVKKVDPPPPPPPPP------PKVKKVDPPPPPPPPPPPKVKKVD 2453 Query: 116 PPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 2454 PPPPP---PPPPP 2463 Score = 29.3 bits (64), Expect(2) = 4e-07 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLPLYQPTKQSK 343 PPPPPPPP + + P P P K K Sbjct: 2374 PPPPPPPPKVKKVDPPPPPPPPPPPKVKK 2402 Score = 50.1 bits (118), Expect(2) = 9e-07 Identities = 30/73 (41%), Positives = 32/73 (43%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP P P ++ VDP P P PPPPPPPPPP Sbjct: 2422 PPPPPPPP------PKVKKVDPPPPPPPPP------PPKVKKVDPPPPPPPPPPKVKKVD 2469 Query: 116 PPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 2470 PPPPP---PPPPP 2479 Score = 28.9 bits (63), Expect(2) = 9e-07 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLP 370 PPPPPPPP + ++ P P Sbjct: 2388 PPPPPPPPPPPKVKKVDPPP 2407 Score = 52.4 bits (124), Expect(2) = 1e-06 Identities = 34/96 (35%), Positives = 41/96 (42%) Frame = -1 Query: 365 INPPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIP 186 ++PP +K +D P PP P P ++ VDP P P Sbjct: 2340 VDPPPPPPPPKVKKVDP------PPPPPPPP------PKVKKVDPPPPPPPPP------P 2381 Query: 185 RAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 + PPPPPPPPPP PPPPP PPPPP Sbjct: 2382 KVKKVDPPPPPPPPPPPKVKKVDPPPPP---PPPPP 2414 Score = 26.2 bits (56), Expect(2) = 1e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 429 PPPPPPPP 406 PPPPPPPP Sbjct: 2321 PPPPPPPP 2328 [103][TOP] >UniRef100_UPI0000EBDEB7 PREDICTED: similar to formin-like 1 n=1 Tax=Bos taurus RepID=UPI0000EBDEB7 Length = 1112 Score = 47.8 bits (112), Expect(3) = 2e-08 Identities = 34/80 (42%), Positives = 35/80 (43%), Gaps = 7/80 (8%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPP-----PPPPP 132 P PP PL P L S+ PL P G PPPPPP PPPPP Sbjct: 555 PPPPPLPPL-----PGLP-----SQQEAPPLAPPLAPPLPGSPEPPPPPPLPGDQPPPPP 604 Query: 131 PLW*PPPPPPL--W*PPPPP 78 P PPPPP PPPPP Sbjct: 605 P---PPPPPGADGQVPPPPP 621 Score = 28.1 bits (61), Expect(3) = 2e-08 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P PPPPPPPP Sbjct: 542 PGAAPPPPPPPP 553 Score = 27.7 bits (60), Expect(3) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 429 PPPPPPPPL 403 PPPPPPPPL Sbjct: 552 PPPPPPPPL 560 [104][TOP] >UniRef100_B4I903 GM19047 n=1 Tax=Drosophila sechellia RepID=B4I903_DROSE Length = 204 Score = 55.1 bits (131), Expect(2) = 2e-08 Identities = 30/73 (41%), Positives = 38/73 (52%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGSTSSRAGI 258 GGG G+ +GGGGG + +GGGGGGG GGGGD ++ E GS+ G Sbjct: 24 GGGSGWSSGGGGGSWSSGGGGGGGHGGGGDVQII-----------KVITESGSSGGGGGG 72 Query: 259 H*F*SGRHRGGAG 297 + SG GG G Sbjct: 73 GGWSSGGGGGGGG 85 Score = 29.3 bits (64), Expect(2) = 2e-08 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 371 GRGWILYIVYSSGGGGGGGGTKEG 442 G GW SSGGGGGGGG G Sbjct: 83 GGGW------SSGGGGGGGGWSSG 100 [105][TOP] >UniRef100_B4R7C9 GD16486 n=1 Tax=Drosophila simulans RepID=B4R7C9_DROSI Length = 197 Score = 55.1 bits (131), Expect(2) = 2e-08 Identities = 30/73 (41%), Positives = 38/73 (52%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGSTSSRAGI 258 GGG G+ +GGGGG + +GGGGGGG GGGGD ++ E GS+ G Sbjct: 7 GGGSGWSSGGGGGSWSSGGGGGGGHGGGGDVQII-----------KVITESGSSGGGGGG 55 Query: 259 H*F*SGRHRGGAG 297 + SG GG G Sbjct: 56 GGWSSGGGGGGGG 68 Score = 29.3 bits (64), Expect(2) = 2e-08 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 371 GRGWILYIVYSSGGGGGGGGTKEG 442 G GW SSGGGGGGGG G Sbjct: 76 GGGW------SSGGGGGGGGWSSG 93 [106][TOP] >UniRef100_B4NCX9 GK10119 n=1 Tax=Drosophila willistoni RepID=B4NCX9_DROWI Length = 201 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 10/43 (23%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGG----------GGGGGGDAYP 177 GGGGG+H GGGGGGYH GGGGGG GGGGGG YP Sbjct: 99 GGGGGHHGGGGGGGYHGGGGGGGYPGGGGGGYHGGGGGGGGYP 141 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +1 Query: 70 YRNGGGGGYH-NGGGGGGYHNGGGGGGGGGGGGDAYPAA 183 Y GGGGGYH GGGGGGY GGGGG GGGGG +Y ++ Sbjct: 122 YPGGGGGGYHGGGGGGGGYPQWGGGGGSGGGGGGSYASS 160 [107][TOP] >UniRef100_B3MU38 GF21178 n=1 Tax=Drosophila ananassae RepID=B3MU38_DROAN Length = 608 Score = 56.2 bits (134), Expect(2) = 3e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPP PPPP R + Y Y Sbjct: 494 PPPPPPPPPPPPPPTEPPPPP---PPPPEPRVKKYSY 527 Score = 27.7 bits (60), Expect(2) = 3e-08 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 187 PGLQGTHHHHHHHHHHH 137 P + H HHHHH HH Sbjct: 474 PDVYYDDHPHHHHHVHH 490 [108][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 56.6 bits (135), Expect(2) = 3e-08 Identities = 32/73 (43%), Positives = 36/73 (49%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP W+ P + P +S SP P + SPPPP PPPP PP P Sbjct: 166 PPPPWWQAPSASPSPPPPSISPSPPSSASPT----PPPPSASPSPPPPSPPPPSPP---P 218 Query: 116 PPPPPLW*PPPPP 78 PPPPP PPPPP Sbjct: 219 PPPPP---PPPPP 228 Score = 27.3 bits (59), Expect(2) = 3e-08 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 441 PSFVPPPPPPPPLLYTIYRIQPLP 370 PS P PPPPPP + P P Sbjct: 140 PSISPSPPPPPPPWWQAPSASPSP 163 [109][TOP] >UniRef100_UPI0000D99778 PREDICTED: hypothetical protein n=1 Tax=Macaca mulatta RepID=UPI0000D99778 Length = 394 Score = 63.9 bits (154), Expect = 3e-08 Identities = 41/122 (33%), Positives = 53/122 (43%), Gaps = 1/122 (0%) Frame = -2 Query: 442 TFLCTTTTTTTTATIYN-IQNPTSTPVSTHQAIKVFPISSLSIPSTSRGGQLHRGGGRSR 266 T TTTTTTTT TI I T+T ++T I I + +I T+ Sbjct: 28 TITITTTTTTTTITITTTILIITTTIITTTTTIITTTIITTTIIITTT------------ 75 Query: 265 TSGSPL*N*WIPALELVDPRSRTSGSPGLQGTHHHHHHHHHHHHHHYGNLRLLHHCGNHL 86 + + + T SP +HHHHHHHHHHHHHH+ HH +HL Sbjct: 76 ------------TITITTTITSTPPSPSPPPSHHHHHHHHHHHHHHHHLHHHYHHHHHHL 123 Query: 85 LH 80 H Sbjct: 124 HH 125 [110][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -1 Query: 194 WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 W+ +A+PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 206 WVGLRYSFAAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 215 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 [111][TOP] >UniRef100_C9XWJ2 Beta-galactosidase n=1 Tax=Cronobacter turicensis RepID=C9XWJ2_9ENTR Length = 1044 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/53 (47%), Positives = 36/53 (67%) Frame = +1 Query: 622 LAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 LA +L R DW NP +T +NRL +H P WR++++AR PS + SL+GEW+ Sbjct: 19 LATILARNDWQNPAITSVNRLPSHTPLHGWRDADQARRGEPSDAVLSLDGEWQ 71 [112][TOP] >UniRef100_B2VHN8 Beta-galactosidase n=1 Tax=Erwinia tasmaniensis RepID=BGAL_ERWT9 Length = 1026 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = +1 Query: 619 SLAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 777 +L +L +R W NP +TQLNRL AH P ASWRN++ AR D S R L+GEW Sbjct: 8 TLQQLLAQRHWENPALTQLNRLPAHTPLASWRNADAARGDLASPSQRLLDGEW 60 [113][TOP] >UniRef100_Q7G6K7 Formin-like protein 3 n=1 Tax=Oryza sativa Japonica Group RepID=FH3_ORYSJ Length = 1234 Score = 43.5 bits (101), Expect(3) = 4e-08 Identities = 37/106 (34%), Positives = 44/106 (41%), Gaps = 10/106 (9%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPP-----PPP 132 P PP PL N +P+ P P+ +P + PPPPPP P PPP Sbjct: 586 PPPPPPPPLPNCLVPS-----PPPPPPPPPI----LPNRSVPPPPPPPPPLPNHSVLPPP 636 Query: 131 PLW*PPPPPP-----LW*PPPPPLRYQAYRYRRPRNPYD*RSSESP 9 P PPPPPP L PPP P + P P SS +P Sbjct: 637 P---PPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSSRTP 679 Score = 30.8 bits (68), Expect(3) = 4e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P+F PPPPPPPP Sbjct: 559 PAFSPPPPPPPP 570 Score = 28.5 bits (62), Expect(3) = 4e-08 Identities = 13/21 (61%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -3 Query: 429 PPPPPPPPLLYTIY-RIQPLP 370 PPPPPPPPL + Y QP P Sbjct: 567 PPPPPPPPLPQSNYASSQPPP 587 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPP-----PLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 +P + A+ PPPPPPPPPP P + PPPPPP PPPPPL Y +P P Sbjct: 534 LPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPP--PPPPPLPQSNYASSQPPPP 588 [114][TOP] >UniRef100_B9G7A3 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9G7A3_ORYSJ Length = 1224 Score = 43.5 bits (101), Expect(3) = 4e-08 Identities = 37/106 (34%), Positives = 44/106 (41%), Gaps = 10/106 (9%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPP-----PPP 132 P PP PL N +P+ P P+ +P + PPPPPP P PPP Sbjct: 576 PPPPPPPPLPNCLVPS-----PPPPPPPPPI----LPNRSVPPPPPPPPPLPNHSVLPPP 626 Query: 131 PLW*PPPPPP-----LW*PPPPPLRYQAYRYRRPRNPYD*RSSESP 9 P PPPPPP L PPP P + P P SS +P Sbjct: 627 P---PPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSSRTP 669 Score = 30.8 bits (68), Expect(3) = 4e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P+F PPPPPPPP Sbjct: 549 PAFSPPPPPPPP 560 Score = 28.5 bits (62), Expect(3) = 4e-08 Identities = 13/21 (61%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -3 Query: 429 PPPPPPPPLLYTIY-RIQPLP 370 PPPPPPPPL + Y QP P Sbjct: 557 PPPPPPPPLPQSNYASSQPPP 577 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPP-----PLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 +P + A+ PPPPPPPPPP P + PPPPPP PPPPPL Y +P P Sbjct: 524 LPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPP--PPPPPLPQSNYASSQPPPP 578 [115][TOP] >UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLU7_RICCO Length = 1550 Score = 55.1 bits (131), Expect(2) = 4e-08 Identities = 44/135 (32%), Positives = 56/135 (41%), Gaps = 11/135 (8%) Frame = -1 Query: 407 RYYIQYTESNLYPCINPPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPA----LEL 240 R I+ + P PP S+ + I V L P P W+ + + +PA Sbjct: 736 RQNIEIIPYHASPPAPPPPPPPLSNRQNIGMV-LPPAPPPTPWKFVYSSSVPASVSSAPP 794 Query: 239 VDPRSRTSGSPL*N*-WIPRAAGYASPPPPPPPPPPPPLW------*PPPPPPLW*PPPP 81 + P PL N +P+ G P PPPPPPPPP+ PPPPPP PPPP Sbjct: 795 LPPPPPPPPPPLVNASTVPKVGGIKIPTAPPPPPPPPPMGGTMLPPRPPPPPP---PPPP 851 Query: 80 PLRYQAYRYRRPRNP 36 P Y P P Sbjct: 852 PPSYPYQGVHSPPPP 866 Score = 28.5 bits (62), Expect(2) = 4e-08 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -3 Query: 441 PSFVPPPPPPPPL 403 P PPPPPPPPL Sbjct: 696 PPSPPPPPPPPPL 708 Score = 55.8 bits (133), Expect = 9e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 P + PPPPPPPPPPPPL PPPP PPPPP Sbjct: 897 PPSRAAPPPPPPPPPPPPPPLRATPPPPLQGSPPPPP 933 [116][TOP] >UniRef100_B7Z017 CG33003, isoform B n=1 Tax=Drosophila melanogaster RepID=B7Z017_DROME Length = 604 Score = 56.2 bits (134), Expect(2) = 4e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPP PPPP R + Y Y Sbjct: 491 PPPPPPPPPPPPPPTEPPPPP---PPPPEPRVKKYSY 524 Score = 27.3 bits (59), Expect(2) = 4e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 169 HHHHHHHHHH 140 H HHHHH HH Sbjct: 478 HPHHHHHVHH 487 Score = 55.5 bits (132), Expect(2) = 7e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 161 PPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPP PPPPPP PPPPP Sbjct: 488 PPPPPPPPPPP---PPPPPPTEPPPPPP 512 Score = 27.3 bits (59), Expect(2) = 7e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 166 HHHHHHHHHH 137 H HHHHH HH Sbjct: 478 HPHHHHHVHH 487 [117][TOP] >UniRef100_Q86BM9 CG33003, isoform A n=1 Tax=Drosophila melanogaster RepID=Q86BM9_DROME Length = 579 Score = 56.2 bits (134), Expect(2) = 4e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPP PPPP R + Y Y Sbjct: 466 PPPPPPPPPPPPPPTEPPPPP---PPPPEPRVKKYSY 499 Score = 27.3 bits (59), Expect(2) = 4e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 169 HHHHHHHHHH 140 H HHHHH HH Sbjct: 453 HPHHHHHVHH 462 Score = 55.5 bits (132), Expect(2) = 7e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -1 Query: 161 PPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPP PPPPPP PPPPP Sbjct: 463 PPPPPPPPPPP---PPPPPPTEPPPPPP 487 Score = 27.3 bits (59), Expect(2) = 7e-08 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 166 HHHHHHHHHH 137 H HHHHH HH Sbjct: 453 HPHHHHHVHH 462 [118][TOP] >UniRef100_B5DMI7 GA26754 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DMI7_DROPS Length = 328 Score = 55.8 bits (133), Expect(2) = 4e-08 Identities = 34/78 (43%), Positives = 40/78 (51%), Gaps = 5/78 (6%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGG-----GGGGGGDAYPAARGIH*F*SGDPLVLERGSTS 243 GGGGG+ GGGGGG+ +GGGGGG GGGGGG + G G V++ S Sbjct: 237 GGGGGHGGGGGGGGWSSGGGGGGGGWSSGGGGGGGGHGGGGG------GSTKVIKIIKLS 290 Query: 244 SRAGIH*F*SGRHRGGAG 297 S G G H GG G Sbjct: 291 SGGG----GGGGHGGGGG 304 Score = 27.7 bits (60), Expect(2) = 4e-08 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 371 GRGWILYIVYSSGGGGGGGG 430 G GW SSGGGGGGGG Sbjct: 307 GGGW------SSGGGGGGGG 320 [119][TOP] >UniRef100_B4GXX8 GL20180 n=1 Tax=Drosophila persimilis RepID=B4GXX8_DROPE Length = 322 Score = 55.8 bits (133), Expect(2) = 4e-08 Identities = 34/78 (43%), Positives = 40/78 (51%), Gaps = 5/78 (6%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGG-----GGGGGGDAYPAARGIH*F*SGDPLVLERGSTS 243 GGGGG+ GGGGGG+ +GGGGGG GGGGGG + G G V++ S Sbjct: 231 GGGGGHGGGGGGGGWSSGGGGGGGGWSSGGGGGGGGHGGGGG------GSTKVIKIIKLS 284 Query: 244 SRAGIH*F*SGRHRGGAG 297 S G G H GG G Sbjct: 285 SGGG----GGGGHGGGGG 298 Score = 27.7 bits (60), Expect(2) = 4e-08 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 371 GRGWILYIVYSSGGGGGGGG 430 G GW SSGGGGGGGG Sbjct: 301 GGGW------SSGGGGGGGG 314 [120][TOP] >UniRef100_B4M7I0 GJ16994 n=1 Tax=Drosophila virilis RepID=B4M7I0_DROVI Length = 205 Score = 63.5 bits (153), Expect = 4e-08 Identities = 30/46 (65%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = +1 Query: 37 GFRGRRYR*A*YRNGG--GGGYHNGGGG-GGYHNGGGGGGGGGGGG 165 G++G Y+ Y+ GG GGG H GGGG GGYH GGGGGGGGGGGG Sbjct: 124 GYQGGGYQSGGYQGGGYQGGGGHQGGGGIGGYHGGGGGGGGGGGGG 169 [121][TOP] >UniRef100_A7MN76 Beta-galactosidase n=1 Tax=Cronobacter sakazakii ATCC BAA-894 RepID=BGAL_ENTS8 Length = 1043 Score = 63.2 bits (152), Expect = 6e-08 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = +1 Query: 622 LAVVLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 LA +L R DW NP +T +NRL +H P WR+++ AR PS + SL+GEW+ Sbjct: 18 LATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPSDAVLSLDGEWQ 70 [122][TOP] >UniRef100_A7QQ26 Chromosome chr2 scaffold_140, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QQ26_VITVI Length = 1163 Score = 44.3 bits (103), Expect(3) = 6e-08 Identities = 30/78 (38%), Positives = 33/78 (42%), Gaps = 5/78 (6%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP P P L + S TS R++ PPP PPPPPP L P Sbjct: 651 PPPPPPPPA-----PPLPMFSSSSSTS----------RSSSSHGVPPPHPPPPPPSLGLP 695 Query: 116 PPPPP-----LW*PPPPP 78 PPPP PPPPP Sbjct: 696 GPPPPPGAKGTNAPPPPP 713 Score = 30.0 bits (66), Expect(3) = 6e-08 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 495 GGSSPMYVGFSSYFTILLPSFVPPPPPPPP 406 G + M ++S +L PS PPPPPPP Sbjct: 540 GSALSMSQSYASNRNLLPPSTSTPPPPPPP 569 Score = 27.7 bits (60), Expect(3) = 6e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 429 PPPPPPPPL 403 PPPPPPPPL Sbjct: 609 PPPPPPPPL 617 [123][TOP] >UniRef100_UPI0000E4981C PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4981C Length = 451 Score = 51.2 bits (121), Expect(4) = 6e-08 Identities = 34/80 (42%), Positives = 36/80 (45%), Gaps = 7/80 (8%) Frame = +1 Query: 79 GGGGGYHNGGGGGG-------YHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGS 237 GGGGG GGGGGG NGGGGGG GG GG A G G+ Sbjct: 166 GGGGGRGEGGGGGGGVGPDGGTGNGGGGGGNGGSGGGGAGAGGG-------------SGT 212 Query: 238 TSSRAGIH*F*SGRHRGGAG 297 S AG H +G GGAG Sbjct: 213 ESGEAGGHGGGTGTWGGGAG 232 Score = 25.0 bits (53), Expect(4) = 6e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 407 GGGGGGGGT 433 GGGGGGGGT Sbjct: 238 GGGGGGGGT 246 Score = 23.5 bits (49), Expect(4) = 6e-08 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 401 SSGGGGGGGG 430 + GGGGGGGG Sbjct: 235 NGGGGGGGGG 244 Score = 21.2 bits (43), Expect(4) = 6e-08 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 410 GGGGGGGTKEG 442 GGGGGGG G Sbjct: 281 GGGGGGGGTGG 291 [124][TOP] >UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC Length = 620 Score = 56.2 bits (134), Expect(2) = 7e-08 Identities = 31/79 (39%), Positives = 40/79 (50%), Gaps = 4/79 (5%) Frame = -1 Query: 296 PAPPRWR---PL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPP-PPPPP 129 P PP + PL + P P + SP + P YA PPPPPP PPPP Sbjct: 418 PPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPPPPAYAQPPPPPPTYSPPPP 477 Query: 128 LW*PPPPPPLW*PPPPPLR 72 + PPPP P++ PPPP ++ Sbjct: 478 AYSPPPPSPIYSPPPPQVQ 496 Score = 26.6 bits (57), Expect(2) = 7e-08 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -3 Query: 441 PSFVPPPPP--PPPLLYTIYRIQPLPLYQ 361 P+++PPPPP PPP ++ P P Y+ Sbjct: 366 PTYLPPPPPSSPPPPSFS----PPPPTYE 390 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 33/79 (41%), Positives = 39/79 (49%), Gaps = 7/79 (8%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPP---PPPP---PP 135 PAPP + P P P + PL + P Y+ PPPP PPPP PP Sbjct: 404 PAPPTYSPP-----PPTYSPPPPTYAQPPPLPPTYSPPPPAYSPPPPPTYSPPPPTYSPP 458 Query: 134 PPLW-*PPPPPPLW*PPPP 81 PP + PPPPPP + PPPP Sbjct: 459 PPAYAQPPPPPPTYSPPPP 477 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 12/40 (30%) Frame = -3 Query: 441 PSFVPPPP------------PPPPLLYTIYRIQPLPLYQP 358 P++ PPPP PPPP +Y P P Y P Sbjct: 328 PTYSPPPPTYLPLPSSPIYSPPPP----VYSPPPPPSYSP 363 [125][TOP] >UniRef100_Q1A1A1 Forkhead box protein G1 n=1 Tax=Ceratotherium simum RepID=FOXG1_CERSI Length = 486 Score = 43.9 bits (102), Expect(2) = 7e-08 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 190 SPGLQGTHHHHHHHHHHHHHHY 125 S G +HH HHHHHHHHHH+ Sbjct: 36 SHGHHNSHHPQHHHHHHHHHHH 57 Score = 38.9 bits (89), Expect(2) = 7e-08 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -1 Query: 152 PPPPPPPPLW*PPPPPPLW*PPPPPLRYQA 63 PPPP P P PPPPPP PPP P QA Sbjct: 58 PPPPAPQP---PPPPPPPQQPPPAPQPSQA 84 [126][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 62.8 bits (151), Expect = 8e-08 Identities = 29/39 (74%), Positives = 29/39 (74%), Gaps = 2/39 (5%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGG--GGGGGGDAYPAARG 189 GGGGGY GGGGGGY GGGGGG GGGGGGD ARG Sbjct: 106 GGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGDRPSGARG 144 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 73 RNGGGGGYHNGGGGGGYHNGGGGGG-GGGGGGDAYPAARG 189 R GGGGGY GGGGGGY GGGGGG GGGGGG Y G Sbjct: 86 RGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGG 125 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = +1 Query: 70 YRNGGGGGYHNGGGGGGYHNGGGGGG--GGGGGGDAYPAARG 189 Y GGGGG + GGGGGG + GGGGGG GGGGGG Y G Sbjct: 93 YGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGG 134 [127][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 62.8 bits (151), Expect = 8e-08 Identities = 29/53 (54%), Positives = 33/53 (62%) Frame = -1 Query: 236 DPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 +P + T L ++ A ASPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 444 EPTAATGSGQLEIDYVRTYAHDASPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPPPPP PPPPP+ Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 499 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 [128][TOP] >UniRef100_C8TA13 Beta-galactosidase n=1 Tax=Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 RepID=C8TA13_KLEPR Length = 610 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +1 Query: 631 VLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 VL R DW N +T LNRL AHP FASWR+ AR + PS + R L+GEW+ Sbjct: 17 VLAREDWQNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRRQLDGEWQ 66 [129][TOP] >UniRef100_C4X846 Beta-D-galactosidase n=1 Tax=Klebsiella pneumoniae NTUH-K2044 RepID=C4X846_KLEPN Length = 1035 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +1 Query: 631 VLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 VL R DW N +T LNRL AHP FASWR+ AR + PS + R L+GEW+ Sbjct: 17 VLAREDWQNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRRQLDGEWQ 66 [130][TOP] >UniRef100_A6T8X0 Beta-galactosidase 1 n=1 Tax=Klebsiella pneumoniae subsp. pneumoniae MGH 78578 RepID=BGAL1_KLEP7 Length = 1035 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +1 Query: 631 VLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 VL R DW N +T LNRL AHP FASWR+ AR + PS + R L+GEW+ Sbjct: 17 VLAREDWQNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRRQLDGEWQ 66 [131][TOP] >UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris RepID=Q09083_PHAVU Length = 580 Score = 54.7 bits (130), Expect(2) = 9e-08 Identities = 30/70 (42%), Positives = 37/70 (52%), Gaps = 10/70 (14%) Frame = -1 Query: 188 PRAAGYASPPPPP--PPPPPPPLW*PPPPPPLW---*PPPPPLRYQA-----YRYRRPRN 39 P Y SPPPP P PPPPP P PPPP++ PPPP +Y++ Y+Y+ P Sbjct: 393 PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPP 452 Query: 38 PYD*RSSESP 9 PY S P Sbjct: 453 PYKYPSPPPP 462 Score = 27.7 bits (60), Expect(2) = 9e-08 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 13/58 (22%) Frame = -3 Query: 441 PSFVPPPPPPPPLLYTI-------YRIQPLPLYQ-PTKQSKFFRYQA-----YRYRRP 307 P + P PPPPP Y+ Y+ P P+Y+ + ++Y + Y+Y+ P Sbjct: 295 PPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSP 352 Score = 49.3 bits (116), Expect(2) = 4e-06 Identities = 28/64 (43%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Frame = -1 Query: 188 PRAAGYASPPPPP--PPPPPPPLW*PPPPPPL--W*PPPPPLRYQAYRYRRPRNPYD*RS 21 P Y SPPPP P PPPPP PPPP+ + PPPP+ Y+Y+ P PY S Sbjct: 442 PPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPV----YKYKSPPPPYKYPS 497 Query: 20 SESP 9 P Sbjct: 498 PPPP 501 Score = 27.3 bits (59), Expect(2) = 4e-06 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 12/57 (21%) Frame = -3 Query: 441 PSFVPPPPPPPPLLYTI-------YRIQPLPLYQPTKQSKFFRYQA-----YRYRRP 307 P + P PPPPP Y Y+ P P+Y+ ++Y + Y+Y P Sbjct: 364 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSP 420 [132][TOP] >UniRef100_B4GY99 GL19880 n=1 Tax=Drosophila persimilis RepID=B4GY99_DROPE Length = 255 Score = 46.2 bits (108), Expect(2) = 9e-08 Identities = 41/116 (35%), Positives = 46/116 (39%), Gaps = 27/116 (23%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPP--------P 141 P PP ++PL + L LV S P +A PPPPPPP P Sbjct: 84 PPPPLFQPL----LRLLRLVKAWDFQSDRP------DKALDQPDPPPPPPPELTFQPELP 133 Query: 140 PPPPLW*P-----------PP------PPPLW*P--PPPPLRYQAYRYRRPRNPYD 30 PPPPL P PP PPPL P PPPPL +Q P P D Sbjct: 134 PPPPLGQPEVPPEDHPLLPPPLGQPLLPPPLCQPLPPPPPLLFQPPPPLPPPPPED 189 Score = 36.2 bits (82), Expect(2) = 9e-08 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -3 Query: 447 LLPSFVPPPPPPPPLLYTIYRIQPLPLYQP 358 LLP PPPPPPPL + + P PL+QP Sbjct: 43 LLPPLFQPPPPPPPLFQPLPPLPP-PLFQP 71 [133][TOP] >UniRef100_UPI0001982DB4 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982DB4 Length = 214 Score = 54.7 bits (130), Expect(2) = 9e-08 Identities = 32/75 (42%), Positives = 37/75 (49%) Frame = +1 Query: 73 RNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGSTSSRA 252 R GGGGG +GG GGG + GGGG GGGGGGG Y H L + +S Sbjct: 121 RGGGGGGRSSGGYGGGGYGGGGGYGGGGGGGACYNCGEEGH-------LARDCSQSSGGG 173 Query: 253 GIH*F*SGRHRGGAG 297 G GR+ GG G Sbjct: 174 G----GGGRYSGGGG 184 Score = 27.7 bits (60), Expect(2) = 9e-08 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 398 YSSGGGGGGGGTKEGKRMVK*EEKPTYMGEEPPQGR 505 YS GGGGGGGG G + E + E P R Sbjct: 179 YSGGGGGGGGGGGGGGGCYRCGEAGHFARECPNNAR 214 [134][TOP] >UniRef100_B3MSC9 GF20819 n=1 Tax=Drosophila ananassae RepID=B3MSC9_DROAN Length = 200 Score = 55.8 bits (133), Expect(2) = 9e-08 Identities = 33/76 (43%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGG---GGGGDAYPAARGIH*F*SGDPLVLERGSTSSR 249 GGGGG+ +GGGGGG +GGGGGGGG GGGG + G GD +++ S Sbjct: 68 GGGGGWSSGGGGGGGWSGGGGGGGGWSSGGGGGGHGGGGG-----GGDVKLIKIISLGGG 122 Query: 250 AGIH*F*SGRHRGGAG 297 G G H GG G Sbjct: 123 GG-----GGGHGGGGG 133 Score = 26.6 bits (57), Expect(2) = 9e-08 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 371 GRGWILYIVYSSGGGGGGGGTKEGKRMVK 457 G GW SGGGGGGG G +++K Sbjct: 143 GGGW-------SGGGGGGGHGGGGTKVIK 164 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/34 (70%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGG--GGGGGDAY 174 GGGGG H GGGGGG+ +GGGGGGG GGGGG + Sbjct: 122 GGGGGGHGGGGGGGWSSGGGGGGGWSGGGGGGGH 155 [135][TOP] >UniRef100_A8J9H7 Mastigoneme-like flagellar protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J9H7_CHLRE Length = 1987 Score = 52.8 bits (125), Expect(3) = 1e-07 Identities = 33/75 (44%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*--WIPRAAGYASPPPPPPPPPPPPLW 123 P PP RP P+ PR + P N P + SPPPP PPPPPPP Sbjct: 1865 PPPPSPRP------PSPNPPSPRPPSPAPPSPNPPPTSPPPSPPPSPPPPRPPPPPPPP- 1917 Query: 122 *PPPPPPLW*PPPPP 78 P PPPP PPPPP Sbjct: 1918 -PSPPPPNRSPPPPP 1931 Score = 25.4 bits (54), Expect(3) = 1e-07 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 441 PSFVPPPPPPP 409 PS PPPPPPP Sbjct: 1858 PSPSPPPPPPP 1868 Score = 23.1 bits (48), Expect(3) = 1e-07 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 429 PPPPPPPP 406 PPPPPP P Sbjct: 1863 PPPPPPSP 1870 [136][TOP] >UniRef100_C5JYR8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JYR8_AJEDS Length = 1704 Score = 50.8 bits (120), Expect(3) = 1e-07 Identities = 34/87 (39%), Positives = 38/87 (43%), Gaps = 12/87 (13%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPP--------- 150 GGP PP P + A P +G P P G PPPPP Sbjct: 955 GGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPPPPPGMGGPPL 1014 Query: 149 PPPPPPPLW*PPPPPP---LW*PPPPP 78 PPPPPP + PPPPPP + PPPPP Sbjct: 1015 PPPPPPGMGGPPPPPPPPGMRGPPPPP 1041 Score = 26.6 bits (57), Expect(3) = 1e-07 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 432 VPPPPPPPP 406 +PPPPPPPP Sbjct: 915 LPPPPPPPP 923 Score = 23.9 bits (50), Expect(3) = 1e-07 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 441 PSFVPPPPPPP 409 P PPPPPPP Sbjct: 899 PKPPPPPPPPP 909 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 4/41 (9%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPP----LW*PPPPP 78 P A G PPPPPPPPPPP + PPPPPP + PPPPP Sbjct: 908 PPAVGGPLPPPPPPPPPPPGVGLPPPPPPPPPGVGAPPPPP 948 [137][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 173 YASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 +ASPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 303 FASPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPPP PPPPP ++A + Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAFEAREF 343 [138][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 62.4 bits (150), Expect = 1e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPPPPPPP++ PPPPPP PPPPP Sbjct: 450 SPPPPPPPPPPPPVYSPPPPPP---PPPPP 476 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 6/38 (15%) Frame = -1 Query: 173 YASPPPPPPPPPPPPLW------*PPPPPPLW*PPPPP 78 Y+ PPPPPPPPPPPP++ PPPPPP++ PPPPP Sbjct: 464 YSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Score = 61.2 bits (147), Expect = 2e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPPPPPPP++ PPPPP PPPPP Sbjct: 496 SPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRY 69 SPPPP PPPPPPP++ PPPPPP PPPPP Y Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPP---PPPPPPVY 510 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -1 Query: 173 YASPPPPPPPPP---PPPLW*PPPPPPLW*PPPPP 78 Y+ PPPPPPPPP PPP PPPPPP++ PPPPP Sbjct: 436 YSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 470 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -1 Query: 173 YASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRY 69 Y+ PPPPPPPPPPP PPPPPP PPPPP Y Sbjct: 449 YSPPPPPPPPPPPPVYSPPPPPPP---PPPPPPVY 480 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 4/35 (11%) Frame = -1 Query: 167 SPPPPPP----PPPPPPLW*PPPPPPLW*PPPPPL 75 SPPPPPP PPPPPP PPPPPP++ PPPPP+ Sbjct: 486 SPPPPPPPVYSPPPPPP---PPPPPPVYSPPPPPV 517 [139][TOP] >UniRef100_C7IYE0 Os02g0131200 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=C7IYE0_ORYSJ Length = 150 Score = 62.4 bits (150), Expect = 1e-07 Identities = 40/84 (47%), Positives = 48/84 (57%), Gaps = 1/84 (1%) Frame = +1 Query: 49 RRYR*A*YRNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLE 228 RR R R GGGGG GGGGGG +GGGGGGG GGGG+A P G+ +GD Sbjct: 54 RRAREMAARGGGGGG---GGGGGGVVDGGGGGGGAGGGGEAEPGGVGLVPA-AGDAAAER 109 Query: 229 RGSTSSRAGIH*F*S-GRHRGGAG 297 G+ + AG+H + RGGAG Sbjct: 110 DGAGGAGAGVHGARADAPARGGAG 133 [140][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -1 Query: 194 WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 W P PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 34 WKPEVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLR 72 PPPPPPPPPPPP PPPPPP PPPPP++ Sbjct: 48 PPPPPPPPPPPPP--PPPPPPPPPPPPPPIK 76 [141][TOP] >UniRef100_UPI00015B4CAB PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B4CAB Length = 972 Score = 52.4 bits (124), Expect(2) = 1e-07 Identities = 29/67 (43%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = -1 Query: 230 RSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYR-- 57 R T P + ++P A P PP PPPPP PPPPPP PPPPP R + Sbjct: 819 RPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPPPPPTRPPVTQKP 878 Query: 56 YRRPRNP 36 Y RP P Sbjct: 879 YTRPPPP 885 Score = 29.6 bits (65), Expect(2) = 1e-07 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -3 Query: 441 PSFVPPPPPP--PPLLYTIY-RIQPLPLYQPTKQSKFFR 334 P PPPPPP PP+ T Y R P P P Q+ + R Sbjct: 774 PPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTR 812 [142][TOP] >UniRef100_B3P3J0 GG21917 n=1 Tax=Drosophila erecta RepID=B3P3J0_DROER Length = 573 Score = 42.4 bits (98), Expect(2) = 1e-07 Identities = 20/38 (52%), Positives = 23/38 (60%) Frame = -1 Query: 149 PPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 P PPPPP PPPPPP PPPPP Y + + P +P Sbjct: 150 PAPPPPP---PPPPPPPPPPPPPPPSY-PHPHPHPHHP 183 Score = 39.7 bits (91), Expect(2) = 1e-07 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 193 GSPGLQGTHHHHHHHHHHHHH 131 G PGL+ H HH HH +HHHH Sbjct: 129 GPPGLKSGHGHHDHHDYHHHH 149 [143][TOP] >UniRef100_Q6IIW5 HDC16773 n=1 Tax=Drosophila melanogaster RepID=Q6IIW5_DROME Length = 241 Score = 52.8 bits (125), Expect(2) = 1e-07 Identities = 29/73 (39%), Positives = 37/73 (50%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGSTSSRAGI 258 GGG + +GG GGG+ +GGGGGGG GGGGD ++ E GS+ G Sbjct: 63 GGGSSWSSGGSGGGWSSGGGGGGGHGGGGDVQII-----------KVITESGSSGGGGGG 111 Query: 259 H*F*SGRHRGGAG 297 + SG GG G Sbjct: 112 GGWSSGGGGGGGG 124 Score = 29.3 bits (64), Expect(2) = 1e-07 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 371 GRGWILYIVYSSGGGGGGGGTKEG 442 G GW SSGGGGGGGG G Sbjct: 122 GGGW------SSGGGGGGGGWSSG 139 [144][TOP] >UniRef100_Q59E78 CG13376 n=1 Tax=Drosophila melanogaster RepID=Q59E78_DROME Length = 193 Score = 52.8 bits (125), Expect(2) = 1e-07 Identities = 29/73 (39%), Positives = 37/73 (50%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGSTSSRAGI 258 GGG + +GG GGG+ +GGGGGGG GGGGD ++ E GS+ G Sbjct: 15 GGGSSWSSGGSGGGWSSGGGGGGGHGGGGDVQII-----------KVITESGSSGGGGGG 63 Query: 259 H*F*SGRHRGGAG 297 + SG GG G Sbjct: 64 GGWSSGGGGGGGG 76 Score = 29.3 bits (64), Expect(2) = 1e-07 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 371 GRGWILYIVYSSGGGGGGGGTKEG 442 G GW SSGGGGGGGG G Sbjct: 74 GGGW------SSGGGGGGGGWSSG 91 [145][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -1 Query: 194 WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 W R+ G SPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 477 WFLRSGG-VSPPPPPPPPPPPP---PPPPPPSPPPPPPP 511 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPP PPPP PPPPPP PPPPP Sbjct: 504 SPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 [146][TOP] >UniRef100_A1TG37 Putative uncharacterized protein n=1 Tax=Mycobacterium vanbaalenii PYR-1 RepID=A1TG37_MYCVP Length = 396 Score = 62.0 bits (149), Expect = 1e-07 Identities = 34/79 (43%), Positives = 38/79 (48%) Frame = -1 Query: 314 VDLEGGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPP 135 +D+ P PP W P E R++ P W P A P PPPPPPPP Sbjct: 187 IDVPAEPHPPEGE-----WAPRGEAGGAHRRSAEQPQ---WAPPPA----PAPPPPPPPP 234 Query: 134 PPLW*PPPPPPLW*PPPPP 78 PP PPPPPP PPPPP Sbjct: 235 PP---PPPPPPAQQPPPPP 250 [147][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 10/55 (18%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQA----------YRYRRPRNPY 33 SPPPPPPPPPPPP PPPPPP PPPPP Y + Y Y P PY Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPY 432 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/47 (57%), Positives = 28/47 (59%) Frame = -1 Query: 176 GYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 G + P PPPPPPPPPP PPPPPP PPPPP Y Y P P Sbjct: 373 GCSPPSPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 [148][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYR 57 PPPPPPPPPPPP PPPPPP PPPPP QA R Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQR 71 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 P A+ +PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 9 PVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 [149][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPP PPPPL PPPPPPL PPPPP Sbjct: 79 SPPPPPPPSPPPPLPSPPPPPPLPSPPPPP 108 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPP PPPPPL PPPPPP PPPPP Sbjct: 127 SPPPPPPSPPPPPLLSPPPPPPSPPPPPPP 156 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 5/36 (13%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPP-----PLW*PPPPP 78 +SPPPPPP PPPPPL PPPPP PL PPPPP Sbjct: 112 SSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPP 147 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPP PPPPPPP PPPPPP PPPPP Sbjct: 2 PPPPSPPPPPPPPSSPPPPPPPSPPPPPP 30 [150][TOP] >UniRef100_Q2KFY0 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea 70-15 RepID=Q2KFY0_MAGGR Length = 669 Score = 50.8 bits (120), Expect(3) = 1e-07 Identities = 35/92 (38%), Positives = 41/92 (44%), Gaps = 13/92 (14%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPP------ 135 PA P+ PL + P P S +P +P + A+PPP PPPPPP Sbjct: 466 PAAPQPPPLPSSQAPLAPPPLPASSAPPAPPPAPPLPPPSSAAAPPPAPPPPPPPGGLAG 525 Query: 134 -PPLW*PPPPP------PLW*PPPPPLRYQAY 60 PP PPPPP P PPPPP R Y Sbjct: 526 APPAPPPPPPPGGMAGAPPAPPPPPPNRDSGY 557 Score = 26.2 bits (56), Expect(3) = 1e-07 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 426 PPPPPPPLLYTIYRIQPLPLYQPTKQSK 343 P PPPPP ++ + P+ P SK Sbjct: 413 PVPPPPPSREPVHHVPPVSAMPPPLPSK 440 Score = 23.9 bits (50), Expect(3) = 1e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P+ PPPPP PP Sbjct: 366 PAAGPPPPPRPP 377 [151][TOP] >UniRef100_A4RBS7 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4RBS7_MAGGR Length = 654 Score = 50.8 bits (120), Expect(3) = 1e-07 Identities = 35/92 (38%), Positives = 41/92 (44%), Gaps = 13/92 (14%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPP------ 135 PA P+ PL + P P S +P +P + A+PPP PPPPPP Sbjct: 466 PAAPQPPPLPSSQAPLAPPPLPASSAPPAPPPAPPLPPPSSAAAPPPAPPPPPPPGGLAG 525 Query: 134 -PPLW*PPPPP------PLW*PPPPPLRYQAY 60 PP PPPPP P PPPPP R Y Sbjct: 526 APPAPPPPPPPGGMAGAPPAPPPPPPNRDSGY 557 Score = 26.2 bits (56), Expect(3) = 1e-07 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 426 PPPPPPPLLYTIYRIQPLPLYQPTKQSK 343 P PPPPP ++ + P+ P SK Sbjct: 413 PVPPPPPSREPVHHVPPVSAMPPPLPSK 440 Score = 23.9 bits (50), Expect(3) = 1e-07 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P+ PPPPP PP Sbjct: 366 PAAGPPPPPRPP 377 [152][TOP] >UniRef100_B9S1L1 DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9S1L1_RICCO Length = 820 Score = 46.2 bits (108), Expect(3) = 2e-07 Identities = 38/117 (32%), Positives = 45/117 (38%), Gaps = 9/117 (7%) Frame = -1 Query: 359 PPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRA 180 PP N DI + +G P PP P P R+ P + R Sbjct: 606 PPPNLCSKDIYMPPPATSKGPPLPPPPPP------PPPPFSSSRTPPPPPPFSS--TSRQ 657 Query: 179 AGYASPPPPPPPPPPPP---------LW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 + + PPPPPPPPP P L PPPPPPL PP R + R P P Sbjct: 658 SSLSPSPPPPPPPPPLPPRQPSSANSLTEPPPPPPL----PPSGRNLSNAPRPPAPP 710 Score = 27.7 bits (60), Expect(3) = 2e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 429 PPPPPPPPL 403 PPPPPPPPL Sbjct: 597 PPPPPPPPL 605 Score = 26.6 bits (57), Expect(3) = 2e-07 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 456 FTILLPSFVPPPPPPPP 406 F + S PPPPPPPP Sbjct: 581 FNKSVSSSPPPPPPPPP 597 [153][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPPL PPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPLLPPPPPP 459 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 +P+ PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 417 LPQIQPPLPPPPPPPPPPPPP---PPPPPPPPPPPPPPL 452 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPLLPPPPP 458 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 +PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 145 TPPPPPPPPPPPP---PPPPPP---PPPPP 168 [154][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAY 174 GGGGGY GGGGGGY GGGGGG GGGGG +Y Sbjct: 120 GGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSY 151 [155][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = -1 Query: 194 WIPR--AAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLR 72 W P A A PPPPPPPPPPPP PPPPPP PPPPP++ Sbjct: 34 WKPEVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVK 76 [156][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPPP PPPPP Q++R+ Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRF 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 [157][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLR 72 PPPPPPPPPPPP PPPPPP PPPPPLR Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLR 40 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRP 45 PPPPPPPPPPPP PPPPPP PPPPP +A + R P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 [158][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/44 (68%), Positives = 30/44 (68%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNPY 33 PPPPPPPPPPPP PPPPPP PPPPP R RRPR PY Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR------RRPR-PY 120 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 +PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 75 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -1 Query: 185 RAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 R A + PPPPPPPPPPP PPPPPP PPPPP Sbjct: 68 RPAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 [159][TOP] >UniRef100_A7TZC6 Putative uncharacterized protein n=1 Tax=Lepeophtheirus salmonis RepID=A7TZC6_9MAXI Length = 134 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -1 Query: 179 AGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 AGY +PPPPPPPPPPP P PPPP PPP P+ AY Y Sbjct: 22 AGYGAPPPPPPPPPPPSYGAPAPPPP---PPPAPIPPYAYNY 60 [160][TOP] >UniRef100_Q0V5Y9 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0V5Y9_PHANO Length = 293 Score = 61.6 bits (148), Expect = 2e-07 Identities = 33/69 (47%), Positives = 38/69 (55%), Gaps = 8/69 (11%) Frame = -1 Query: 188 PRAAGYASPPPPPPP------PPPPPLW*--PPPPPPLW*PPPPPLRYQAYRYRRPRNPY 33 P GY PPPPPPP PPPPP + PPPPPP PPPPP + + +R R+ Sbjct: 63 PPPPGYGEPPPPPPPGYGEQPPPPPPGYAAEPPPPPPGMQPPPPPPGHDSRSHRPRRHRS 122 Query: 32 D*RSSESPH 6 SSES H Sbjct: 123 YSSSSESDH 131 [161][TOP] >UniRef100_B3M2B3 GF17078 n=1 Tax=Drosophila ananassae RepID=B3M2B3_DROAN Length = 599 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -2 Query: 193 GSPGLQGT--HHHHHHHHHHHHHHY 125 G PG +G HH HH HH HHHHH+ Sbjct: 132 GPPGHKGKDDHHGHHDHHDHHHHHH 156 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 19/37 (51%), Positives = 21/37 (56%) Frame = -1 Query: 146 PPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 PPPPPP PPPPPP PPPPP + + P P Sbjct: 157 PPPPPP--PPPPPPPPPPPPPPPPPPPHHPHHHPSPP 191 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRP 45 PPPPPPPPPPPP PPPPPP PPPPP + + + P Sbjct: 157 PPPPPPPPPPPP---PPPPPP---PPPPPPPHHPHHHPSP 190 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 38/116 (32%), Positives = 43/116 (37%) Frame = -1 Query: 425 HHHHHHRYYIQYTESNLYPCINPPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPAL 246 HH HHH +P I PPS +G P PP P + Sbjct: 182 HHPHHHPSPPSVIIP--FPVIPPPSKGGHHH----HHKGSKGPPGPPG--------PPGM 227 Query: 245 ELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 + P P G PPPPPPPPPPPP + P P PP PPP P Sbjct: 228 SVPGP--------------PGPPGTVYPPPPPPPPPPPPPY-PAPYPPAPYPPPSP 268 Score = 26.2 bits (56), Expect(2) = 4e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 Query: 429 PPPPPPPP 406 PPPPPPPP Sbjct: 157 PPPPPPPP 164 [162][TOP] >UniRef100_UPI000186EF1C formin 1,2/cappuccino, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186EF1C Length = 1111 Score = 41.2 bits (95), Expect(4) = 2e-07 Identities = 35/110 (31%), Positives = 40/110 (36%), Gaps = 36/110 (32%) Frame = -1 Query: 299 GPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPP--------P 144 G +PP PL P P SG+P P +PPPPPP P Sbjct: 533 GESPPPPPPLPISGAPPPPPPPPPLPISGAPPPPPPPPSLFNAGAPPPPPPPPPSLSGGP 592 Query: 143 PPPPPL-----------------------W*PPPPPPLW-----*PPPPP 78 PPPPPL + PPPPPP+ PPPPP Sbjct: 593 PPPPPLPSGFTDSSMSSTPLSNSLDTGSTFVPPPPPPIMSSSGPAPPPPP 642 Score = 28.1 bits (61), Expect(4) = 2e-07 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -3 Query: 432 VPPPPPPPPL 403 +PPPPPPPPL Sbjct: 520 LPPPPPPPPL 529 Score = 25.4 bits (54), Expect(4) = 2e-07 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 426 PPPPPPPLLYTIYRIQPLP 370 PPPPPPP L + P P Sbjct: 521 PPPPPPPPLPNLGESPPPP 539 Score = 24.3 bits (51), Expect(4) = 2e-07 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 438 SFVPPPPPPP 409 S PPPPPPP Sbjct: 519 SLPPPPPPPP 528 [163][TOP] >UniRef100_A3LZQ9 Predicted protein n=1 Tax=Pichia stipitis RepID=A3LZQ9_PICST Length = 1786 Score = 44.7 bits (104), Expect(3) = 2e-07 Identities = 24/59 (40%), Positives = 27/59 (45%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPL 126 GGP PP PL + E V+ + PL PPPPPPPPPPPPL Sbjct: 1044 GGPPPPPPPPLPGFMVNNSETVNIAAPPPAPPLPEFMRTVKTDIGGPPPPPPPPPPPPL 1102 Score = 27.7 bits (60), Expect(3) = 2e-07 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 PS + PPPPPPP Sbjct: 1018 PSAITPPPPPPP 1029 Score = 27.7 bits (60), Expect(3) = 2e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 Query: 429 PPPPPPPPL 403 PPPPPPPPL Sbjct: 1026 PPPPPPPPL 1034 [164][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPP P PPPPP++ PPPPPP++ PPPPP Sbjct: 447 SPPPPSPSPPPPPVYSPPPPPPVYSPPPPP 476 [165][TOP] >UniRef100_UPI0000E4896A PREDICTED: similar to CG33556-PA n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4896A Length = 1472 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 7/65 (10%) Frame = -1 Query: 248 LELVDPRSRT-------SGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*P 90 ++ VDPR+ T +G+PL + A A PPPPPPPP PP + PPPPPP P Sbjct: 390 VDFVDPRTSTGDVIVARTGAPL----LSAAPAAAPPPPPPPPPLPPGVGAPPPPPP---P 442 Query: 89 PPPPL 75 PPPPL Sbjct: 443 PPPPL 447 [166][TOP] >UniRef100_B7EZD4 cDNA clone:002-104-C03, full insert sequence n=2 Tax=Oryza sativa Japonica Group RepID=B7EZD4_ORYSJ Length = 478 Score = 61.2 bits (147), Expect = 2e-07 Identities = 38/93 (40%), Positives = 42/93 (45%) Frame = +1 Query: 37 GFRGRRYR*A*YRNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDP 216 G G R+ +R G GGGY GGGGGGY GGGGGG GGGG RG Sbjct: 379 GGGGNRFAGRDFRQGSGGGYSGGGGGGGYSGGGGGGGYSGGGGGYSGGGRG--------- 429 Query: 217 LVLERGSTSSRAGIH*F*SGRHRGGAGPPSRST 315 S R G SG GG G P R++ Sbjct: 430 ---GGYSRGGRGGY----SGGGGGGGGDPYRAS 455 [167][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -1 Query: 179 AGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 AG + PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 455 AGASLPPPPPPPPPPPP---PPPPPPPPPPPPPPL 486 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 IP A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 452 IPHAGASLPPPPPPPPPPPPP---PPPPPP---PPPPP 483 [168][TOP] >UniRef100_Q1IRT5 Putative uncharacterized protein n=1 Tax=Candidatus Koribacter versatilis Ellin345 RepID=Q1IRT5_ACIBL Length = 315 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = +1 Query: 70 YRNGGGGGYHNGGGGGGYHNGGGG--GGGGG--GGGDAY 174 + GGGGG+H GGGGGG+H GGGG GGGGG GGG AY Sbjct: 55 FHGGGGGGFHGGGGGGGFHGGGGGFHGGGGGYHGGGGAY 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH 195 GGGGG+H GGGGGG+H GGGGGG GGGG + G H Sbjct: 50 GGGGGFH-GGGGGGFHGGGGGGGFHGGGGGFHGGGGGYH 87 [169][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 185 RAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 R+ G PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 647 RSVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 [170][TOP] >UniRef100_B4RDQ2 OmpA family protein n=1 Tax=Phenylobacterium zucineum HLK1 RepID=B4RDQ2_PHEZH Length = 410 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 173 YASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 +A+PPPPPPPPPPPP PPPPPP PPPP Y+A ++ Sbjct: 268 FAAPPPPPPPPPPPP---PPPPPPPPPPPPPAPAYEAKQF 304 [171][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 61.2 bits (147), Expect = 2e-07 Identities = 37/98 (37%), Positives = 46/98 (46%), Gaps = 3/98 (3%) Frame = -1 Query: 359 PPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRA 180 P SF + T+ P+PP P ++P P SP P Sbjct: 217 PVDCSSFRCKPFVPTLPAPPPPSPPMPVPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPP 276 Query: 179 AGYASPPPPPP---PPPPPPLW*PPPPPPLW*PPPPPL 75 Y+ PPPPPP PPPPPP++ PPPPPP PPPPP+ Sbjct: 277 PVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPV 314 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 10/42 (23%) Frame = -1 Query: 173 YASPPPPP-PPPPPPPLW*PP---------PPPPLW*PPPPP 78 Y+ PPPPP PPPPPPP++ PP PPPP++ PPPPP Sbjct: 298 YSPPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPP 339 [172][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 61.2 bits (147), Expect = 2e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPP P PPPPP++ PPPPPP++ PPPPP Sbjct: 447 SPPPPSPSPPPPPVYSPPPPPPVYSPPPPP 476 [173][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 IP A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 833 IPHAGASLPPPPPPPPPPPPP---PPPPPPPPPPPPPP 867 [174][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 IP A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 911 IPHAGASLPPPPPPPPPPPPP---PPPPPPPPPPPPPP 945 [175][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 IP A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 911 IPHAGASLPPPPPPPPPPPPP---PPPPPPPPPPPPPP 945 [176][TOP] >UniRef100_A4R506 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4R506_MAGGR Length = 536 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 P AA PPPPPPPPP PP PPPPPP+ PPPPP Sbjct: 429 PAAAAPPPPPPPPPPPPSPPAPPPPPPPPVITPPPPP 465 [177][TOP] >UniRef100_Q0DB53 DEAD-box ATP-dependent RNA helicase 52A n=2 Tax=Oryza sativa Japonica Group RepID=RH52A_ORYSJ Length = 602 Score = 61.2 bits (147), Expect = 2e-07 Identities = 38/93 (40%), Positives = 42/93 (45%) Frame = +1 Query: 37 GFRGRRYR*A*YRNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDP 216 G G R+ +R G GGGY GGGGGGY GGGGGG GGGG RG Sbjct: 503 GGGGNRFAGRDFRQGSGGGYSGGGGGGGYSGGGGGGGYSGGGGGYSGGGRG--------- 553 Query: 217 LVLERGSTSSRAGIH*F*SGRHRGGAGPPSRST 315 S R G SG GG G P R++ Sbjct: 554 ---GGYSRGGRGGY----SGGGGGGGGDPYRAS 579 [178][TOP] >UniRef100_B4L3H7 GI15551 n=1 Tax=Drosophila mojavensis RepID=B4L3H7_DROMO Length = 134 Score = 53.1 bits (126), Expect(3) = 2e-07 Identities = 37/83 (44%), Positives = 41/83 (49%), Gaps = 10/83 (12%) Frame = +1 Query: 79 GGGGGYHNGGGGGG----YHNGGGGGG------GGGGGGDAYPAARGIH*F*SGDPLVLE 228 GGGGG+ GGGGGG NGGGGGG GGGGGG G G L Sbjct: 33 GGGGGHGGGGGGGGKGGWQKNGGGGGGGGWQKSGGGGGGQGGYGGGG-----GGKSLAGN 87 Query: 229 RGSTSSRAGIH*F*SGRHRGGAG 297 RGS+ S G + G+H GG G Sbjct: 88 RGSSVSWQGGN-GGGGKHGGGGG 109 Score = 24.3 bits (51), Expect(3) = 2e-07 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +2 Query: 410 GGGGGGGTKEG 442 GGGGGGG K G Sbjct: 120 GGGGGGGGKHG 130 Score = 23.1 bits (48), Expect(3) = 2e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 407 GGGGGGGG 430 GGGGGGGG Sbjct: 105 GGGGGGGG 112 [179][TOP] >UniRef100_B4GPV6 GL15122 n=1 Tax=Drosophila persimilis RepID=B4GPV6_DROPE Length = 596 Score = 53.1 bits (126), Expect(2) = 2e-07 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPP P PPPP R + Y Y Sbjct: 483 PPPPPPPPPPPP---PPPTEPPPPPPPPEPRVKKYSY 516 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 181 LQGTHHHHHHHHHH 140 L H HHHHH HH Sbjct: 468 LYDDHPHHHHHVHH 481 Score = 49.7 bits (117), Expect(2) = 3e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -1 Query: 155 PPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPP PPPPPP PPPPP Sbjct: 482 PPPPPPPPP---PPPPPPPTEPPPPP 504 Score = 27.3 bits (59), Expect(2) = 3e-06 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 166 HHHHHHHHHH 137 H HHHHH HH Sbjct: 472 HPHHHHHVHH 481 [180][TOP] >UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019859A1 Length = 377 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 29/66 (43%), Positives = 35/66 (53%), Gaps = 15/66 (22%) Frame = -1 Query: 188 PRAAGYASPPPPPPP------PPPPPLW*PPPPPPLW--*PPPPPLRYQA-------YRY 54 P Y SPPPP PP PPPP + PPPPPL PPPPP +Y++ Y+Y Sbjct: 263 PPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKY 322 Query: 53 RRPRNP 36 + P P Sbjct: 323 KSPPPP 328 Score = 26.6 bits (57), Expect(2) = 2e-07 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 14/55 (25%) Frame = -3 Query: 429 PPP-----PPPPPLLYTIYRI--QPLPLYQPTKQSKFFRYQA-------YRYRRP 307 PPP PPPPP +Y Y+ P P++ P ++Y++ Y+Y+ P Sbjct: 218 PPPYKYKSPPPPPPVYK-YKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSP 271 Score = 50.4 bits (119), Expect(2) = 5e-07 Identities = 26/51 (50%), Positives = 29/51 (56%), Gaps = 11/51 (21%) Frame = -1 Query: 188 PRAAGYASPPPPP----PPPPPPPLW*---PPPPPPLW----*PPPPPLRY 69 P Y SPPPPP PPPPPP++ PPPPPP + PPPPP Y Sbjct: 327 PPVYKYKSPPPPPYMYKSPPPPPPVYKYKSPPPPPPKYYYSSPPPPPPHHY 377 Score = 29.3 bits (64), Expect(2) = 5e-07 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Frame = -3 Query: 441 PSFVPPPPPPPPLLYTIYRIQPLPLYQ---PTKQSKFFRYQA-----YRYRRP 307 P PPPPPPP Y P P+Y+ P S ++Y++ Y+Y+ P Sbjct: 242 PPVHSPPPPPPPYKYK-SPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSP 293 Score = 59.7 bits (143), Expect = 6e-07 Identities = 31/64 (48%), Positives = 36/64 (56%), Gaps = 9/64 (14%) Frame = -1 Query: 173 YASPPPPPP------PPPPPPLW*PPPPPPLW---*PPPPPLRYQAYRYRRPRNPYD*RS 21 Y SPPPPPP PPPPPP+ PPPPPP + PPPPP Y+Y+ P P Sbjct: 223 YKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPP---PVYKYKSPPPPSPPYK 279 Query: 20 SESP 9 +SP Sbjct: 280 YKSP 283 Score = 50.4 bits (119), Expect(2) = 9e-07 Identities = 28/72 (38%), Positives = 34/72 (47%), Gaps = 21/72 (29%) Frame = -1 Query: 188 PRAAGYASPPPPPP--------------PPPPPPLW*PPPPPPL---W*PPPPPL----R 72 P Y SPPPPPP PPPPPP++ PP PP PPPPP+ Sbjct: 84 PPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPH 143 Query: 71 YQAYRYRRPRNP 36 + Y+Y+ P P Sbjct: 144 HPPYKYKSPPPP 155 Score = 28.5 bits (62), Expect(2) = 9e-07 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = -3 Query: 543 GSVLSSLCNRVCLLPCGGSSPMYVGFSSYFTILLPSFVPPPPPPPPLLYTIYRI--QPLP 370 G ++SL + ++ S P + +++ P + PPPPP +Y Y+ P P Sbjct: 7 GPSMASLIATLLVVTISLSLPSETSANYHYSSPPPPYYYKSPPPPPPVYK-YKSPPPPPP 65 Query: 369 LYQPTKQSKFFRYQAYRYRRP 307 +Y P + Y+Y+ P Sbjct: 66 VYSPP------HHPPYKYKSP 80 Score = 52.8 bits (125), Expect(2) = 1e-06 Identities = 28/67 (41%), Positives = 35/67 (52%), Gaps = 16/67 (23%) Frame = -1 Query: 188 PRAAGYASPPPPPP------PPPPPPLW*PPPPPPLW-----*PPPPPLRYQA-----YR 57 P Y SPPPPPP PPPP PPPPPP++ PP PP +Y++ Y+ Sbjct: 230 PPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYK 289 Query: 56 YRRPRNP 36 Y+ P P Sbjct: 290 YKSPPPP 296 Score = 25.8 bits (55), Expect(2) = 1e-06 Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = -3 Query: 441 PSFVPPPPPPPPLLYTIYRIQPLPLYQPTKQSKFFRYQA--------YRYRRP 307 P + PPPPP +Y+ P P ++Y++ Y+Y+ P Sbjct: 145 PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSP 197 [181][TOP] >UniRef100_B4JKF1 GH12063 n=1 Tax=Drosophila grimshawi RepID=B4JKF1_DROGR Length = 143 Score = 56.6 bits (135), Expect(2) = 3e-07 Identities = 34/76 (44%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Frame = +1 Query: 76 NGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGD--PLVLERGSTSSR 249 +GGG G GGG GG+ GGGGGGGGGGGG G + G L RGS++S Sbjct: 45 HGGGAGGGKGGGHGGWQKGGGGGGGGGGGGGWQKGGGGGGGYGGGGGRSLAGNRGSSASW 104 Query: 250 AGIH*F*SGRHRGGAG 297 G + G+H GG G Sbjct: 105 QGSN-GGGGKHGGGGG 119 Score = 24.3 bits (51), Expect(2) = 3e-07 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 2/17 (11%) Frame = +2 Query: 398 YSSGGGGGG--GGTKEG 442 Y GGGGGG GG K G Sbjct: 123 YGGGGGGGGKHGGGKHG 139 [182][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPPL PPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPPL PPPPPP PPPP L Sbjct: 260 PPPPPPPPPPPPLPPPPPPPPPLPPPPPSL 289 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 272 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 259 PPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 P+ PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 [183][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -1 Query: 176 GYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 G A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 P PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPP---PPPPPPPPPPPPPP 1437 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PP PP Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP P PPP Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PP PPP PPPPP Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPP PP PPPPP+ Sbjct: 1426 PPPPPPPPPPPPPPTPPPAPPPPPPPPPPI 1455 [184][TOP] >UniRef100_B3Z1U5 Putative uncharacterized protein n=1 Tax=Bacillus cereus W RepID=B3Z1U5_BACCE Length = 66 Score = 60.8 bits (146), Expect = 3e-07 Identities = 33/52 (63%), Positives = 35/52 (67%) Frame = -1 Query: 776 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGXSQSRRCKTTAS 621 HSPFRLRNCWEGRSVRASSLLRQ S V ++RRCKTTAS Sbjct: 11 HSPFRLRNCWEGRSVRASSLLRQ---------NSSSVPLSLGRTRRCKTTAS 53 [185][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -1 Query: 176 GYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 G A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 221 GEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 253 Score = 59.3 bits (142), Expect = 8e-07 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 176 GYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 G +PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 220 GGEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 252 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAY 60 PPPPPPPPPPPP PPPPPP PPPPP Y Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNTGPY 260 [186][TOP] >UniRef100_Q2PF07 Putative uncharacterized protein (Fragment) n=1 Tax=Trifolium pratense RepID=Q2PF07_TRIPR Length = 149 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 3/34 (8%) Frame = +1 Query: 70 YRNGGGGGYHNGGG---GGGYHNGGGGGGGGGGG 162 Y NGGG GYHNGGG GGGYH+GGG GG GGGG Sbjct: 106 YHNGGGSGYHNGGGYHNGGGYHHGGGHGGHGGGG 139 [187][TOP] >UniRef100_B9PDE3 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9PDE3_POPTR Length = 108 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/54 (59%), Positives = 34/54 (62%) Frame = +1 Query: 7 CGDSEDL*SYGFRGRRYR*A*YRNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGD 168 CGDS S G GRR + + GGGGG GGGGGG GGGGG GGGGGGD Sbjct: 47 CGDSN---SGGGGGRRKQGDFFGGGGGGGDDGGGGGGGGDGGGGGGCGGGGGGD 97 [188][TOP] >UniRef100_A8J8Z8 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J8Z8_CHLRE Length = 221 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPP----PPLRYQAYRYRRP 45 SPPPPPPPPPPPPL PPPPPL PPP PP + YR P Sbjct: 2 SPPPPPPPPPPPPLEEDPPPPPLRPPPPRVPLPPRPSSSVLYRTP 46 [189][TOP] >UniRef100_Q9GRW7 Protein no-on-transient A n=1 Tax=Drosophila virilis RepID=NONA_DROVI Length = 697 Score = 60.8 bits (146), Expect = 3e-07 Identities = 37/76 (48%), Positives = 40/76 (52%) Frame = +1 Query: 73 RNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGSTSSRA 252 R GGGGG GGGGGG GGGGGGGGGGG D P RG G G +S+ Sbjct: 195 RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNPDRRG----GGGGGGQNSGGGNNSQR 250 Query: 253 GIH*F*SGRHRGGAGP 300 G F S R R +GP Sbjct: 251 GDDFFYSQRLRSISGP 266 [190][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 54.3 bits (129), Expect(2) = 3e-07 Identities = 34/75 (45%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPP-PPPPPPPPLW* 120 P PP PL +P L P S P P + SPPPP PPPP PPP Sbjct: 1208 PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTP 1267 Query: 119 PPPPPPLW*PPPPPL 75 PP PPP PPPPPL Sbjct: 1268 PPSPPPPTPPPPPPL 1282 Score = 26.2 bits (56), Expect(2) = 3e-07 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 441 PSFVPPPPPPPPL 403 P PPP PPPPL Sbjct: 1185 PPLPPPPSPPPPL 1197 Score = 50.1 bits (118), Expect(2) = 7e-06 Identities = 33/75 (44%), Positives = 35/75 (46%), Gaps = 3/75 (4%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P PP PL +P L P S P P + SPPPP PPPP PP P Sbjct: 941 PPPPSPPPLPPPPLPPPPLPPPPSPPPSPPP----SPPPSPPPSPPPPTPPPPAPPPPNP 996 Query: 116 P---PPPPLW*PPPP 81 P PPPPL PPPP Sbjct: 997 PPPSPPPPLPLPPPP 1011 Score = 25.8 bits (55), Expect(2) = 7e-06 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 441 PSFVPPPPPPPPLLYTIYRIQPLPLYQP 358 P PPP PPPPL P PL P Sbjct: 906 PPNPPPPSPPPPLPLPPPPSPPPPLPPP 933 Score = 47.0 bits (110), Expect(3) = 7e-06 Identities = 34/76 (44%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = -1 Query: 290 PPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPP-----PPPPPPL 126 PP+ PL + P+ P S SPL IP SPPP PP PP PPP Sbjct: 2156 PPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPP---SPPPHPPPQSPLPPSPPP- 2211 Query: 125 W*PPPPPPLW*PPPPP 78 PPPPPPL PP PP Sbjct: 2212 --PPPPPPLPPPPSPP 2225 Score = 25.8 bits (55), Expect(3) = 7e-06 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 447 LLPSFVPPPPPPPP 406 L P VPPPP PPP Sbjct: 2118 LPPPPVPPPPTPPP 2131 Score = 21.9 bits (45), Expect(3) = 7e-06 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 426 PPPPPPPL 403 PPP PPPL Sbjct: 2129 PPPSPPPL 2136 Score = 49.7 bits (117), Expect(2) = 9e-06 Identities = 30/73 (41%), Positives = 35/73 (47%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*P 117 P+PP P + P+L P TS SP P +A + PPP P PPPP P Sbjct: 1748 PSPPPSPPPPSPPPPSLSPSPPPPSTSPSPP-----PPSASPSPPPPSASPSPPPPSLSP 1802 Query: 116 PPPPPLW*PPPPP 78 PPPP P PPP Sbjct: 1803 SPPPPSTSPSPPP 1815 Score = 25.8 bits (55), Expect(2) = 9e-06 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 441 PSFVPPPPPPPPL 403 P PPP PPPPL Sbjct: 1715 PPLPPPPNPPPPL 1727 [191][TOP] >UniRef100_UPI000194BCD9 PREDICTED: similar to hCG38312 n=1 Tax=Taeniopygia guttata RepID=UPI000194BCD9 Length = 551 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 7 PPPPPPPPPPPPSGGPPPPPPSGGPPPPP 35 [192][TOP] >UniRef100_UPI00017466C4 RNA-binding protein (RRM domain) n=1 Tax=Verrucomicrobium spinosum DSM 4136 RepID=UPI00017466C4 Length = 158 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGG---GGGGGDAYPAARG 189 GGGGGY GGGGGGY GGGGGGG GGGGG Y G Sbjct: 84 GGGGGYKGGGGGGGYSGGGGGGGGGYKGGGGGGGYKGGGG 123 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/31 (80%), Positives = 25/31 (80%), Gaps = 2/31 (6%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGG--GGGGG 165 GGGGGY GGGGGGY GGGGGGG GGGGG Sbjct: 104 GGGGGYKGGGGGGGYKGGGGGGGGYKGGGGG 134 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/45 (60%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = +1 Query: 70 YRNGGGGGYHN---GGGGGGYHNGGGGGG--GGGGGGDAYPAARG 189 Y+ GGGGG ++ GGGGGGY GGGGGG GGGGGG Y G Sbjct: 89 YKGGGGGGGYSGGGGGGGGGYKGGGGGGGYKGGGGGGGGYKGGGG 133 [193][TOP] >UniRef100_UPI000069F105 Formin-like protein 3 (Formin homology 2 domain-containing protein 3). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069F105 Length = 1108 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/41 (63%), Positives = 29/41 (70%), Gaps = 3/41 (7%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPL---W*PPPPPL 75 P +A +PPPPPPPPPPPP PPPPPP+ PPPPPL Sbjct: 602 PASASVPAPPPPPPPPPPPPPPPPPPPPPMPTGKCPPPPPL 642 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 +P A + P PPPPPPPPPP PPPPPP PPPPP+ Sbjct: 599 LPPPASASVPAPPPPPPPPPP---PPPPPP---PPPPPM 631 [194][TOP] >UniRef100_Q3ANN6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. CC9605 RepID=Q3ANN6_SYNSC Length = 173 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/40 (70%), Positives = 28/40 (70%) Frame = +1 Query: 70 YRNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARG 189 Y GGGGGY GGGGGGY GGGGG GGGG GD ARG Sbjct: 91 YGGGGGGGY--GGGGGGYRGGGGGGYGGGGAGDRPSGARG 128 [195][TOP] >UniRef100_A3WBS5 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBS5_9SPHN Length = 378 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -1 Query: 176 GYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 G A+PPPPPPPPPPPP PPPPPPL P PPP Sbjct: 227 GQAAPPPPPPPPPPPP---PPPPPPLPPPAPPP 256 [196][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL--RYQAYRYRRPR 42 PPPPPPPPPPPP PPPPPP PPPPPL +Y + PR Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKPPR 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [197][TOP] >UniRef100_B4JMZ8 GH24721 n=1 Tax=Drosophila grimshawi RepID=B4JMZ8_DROGR Length = 207 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAY 174 GGGGGYH GGGGGGYH GGGGG GGGGG Y Sbjct: 71 GGGGGYH-GGGGGGYHGGGGGGYHGGGGGGGY 101 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARG 189 GGGGG H GGGGGGYH GGGGG GGGGG + G Sbjct: 62 GGGGGGHPGGGGGGYHGGGGGGYHGGGGGGYHGGGGG 98 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 8/37 (21%) Frame = +1 Query: 79 GGGGGYHNGG-GGGGYHNGGGG-------GGGGGGGG 165 GGGGGYH GG GGGGYH GGGG GGGGGGGG Sbjct: 120 GGGGGYHGGGAGGGGYHGGGGGVGGGGYHGGGGGGGG 156 Score = 57.4 bits (137), Expect = 3e-06 Identities = 29/57 (50%), Positives = 30/57 (52%), Gaps = 17/57 (29%) Frame = +1 Query: 70 YRNGGGGGYHNGGGGGGYHNGGGGGG-----------------GGGGGGDAYPAARG 189 Y GGGGGYH GGGGGGYH GGGGGG GGGGGG + G Sbjct: 76 YHGGGGGGYH-GGGGGGYHGGGGGGGYGRKPTIEVYVVKPVYQGGGGGGGYHGGGAG 131 [198][TOP] >UniRef100_B3MYN1 GF22178 n=1 Tax=Drosophila ananassae RepID=B3MYN1_DROAN Length = 223 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 4/42 (9%) Frame = +1 Query: 76 NGGGGGYHNGG----GGGGYHNGGGGGGGGGGGGDAYPAARG 189 NGGGGGYH GG GGGGYH GGGGG GGGGG + G Sbjct: 68 NGGGGGYHGGGGGYNGGGGYHGGGGGGNYGGGGGGYHGGGGG 109 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +1 Query: 70 YRNGGGGGYHNGGGGGGYHNGGGGGGGGGGGG 165 Y GGGGGYH GGGGGG GGGGGGGGGG G Sbjct: 156 YPGGGGGGYHGGGGGGGPQWGGGGGGGGGGAG 187 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = +1 Query: 70 YRNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARG 189 Y +GGGGG+ GGGGGG + GGGGGG GGGG YP G Sbjct: 122 YSSGGGGGHRWGGGGGGGYGGGGGGGYHGGGGGGYPGGGG 161 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 10/42 (23%) Frame = +1 Query: 70 YRNGGGGGYHN-------GGGGGGYHNGGGGGG---GGGGGG 165 Y GGGGGYH GGGGGGYH GGGGGG GGGGGG Sbjct: 140 YGGGGGGGYHGGGGGGYPGGGGGGYHGGGGGGGPQWGGGGGG 181 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARG 189 GGGGG + GGGGGGYH GGGGG GGGGG + G Sbjct: 134 GGGGGGYGGGGGGGYHGGGGGGYPGGGGGGYHGGGGG 170 [199][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 55.1 bits (131), Expect(2) = 4e-07 Identities = 31/70 (44%), Positives = 36/70 (51%) Frame = -1 Query: 221 TSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPR 42 ++G+PL +P PPPPPPPPPP P PPPPP PPPPP + P Sbjct: 592 SNGNPL----MPPTPASRGPPPPPPPPPPLPGPSPPPPP----PPPPPTSISSKGPPPPP 643 Query: 41 NPYD*RSSES 12 P D SS S Sbjct: 644 PPPDFSSSSS 653 Score = 25.0 bits (53), Expect(2) = 4e-07 Identities = 16/53 (30%), Positives = 20/53 (37%), Gaps = 9/53 (16%) Frame = -3 Query: 441 PSFVPPPPPPPPLLY---------TIYRIQPLPLYQPTKQSKFFRYQAYRYRR 310 P+ PPPPP PP ++ P PL P S Q+Y R Sbjct: 501 PTLPPPPPPLPPFAISGTIAPQAASLPSSAPPPLPPPLPGSALSMSQSYASNR 553 [200][TOP] >UniRef100_B4GDZ6 GL21920 n=1 Tax=Drosophila persimilis RepID=B4GDZ6_DROPE Length = 590 Score = 40.4 bits (93), Expect(2) = 4e-07 Identities = 22/67 (32%), Positives = 26/67 (38%) Frame = -2 Query: 343 VFPISSLSIPSTSRGGQLHRGGGRSRTSGSPL*N*WIPALELVDPRSRTSGSPGLQGTHH 164 + PI SL +P +GG H G G P P + G PG G H Sbjct: 176 IIPIPSLPLPPPHKGGHHHHHKGSKGPPGPP-----------GPPGTGPPGPPGPPGNSH 224 Query: 163 HHHHHHH 143 HHH H H Sbjct: 225 HHHPHPH 231 Score = 39.7 bits (91), Expect(2) = 4e-07 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNPY 33 PPPPPP P PP + P PP W P P P+ + + ++ + Y Sbjct: 235 PPPPPPYPYPPTVPYPTPPQIPWFPVPVPVPWPSKGHKGDKGHY 278 Score = 47.0 bits (110), Expect(2) = 6e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPP 84 PPP PPPPPPPP PPPPPP PPP Sbjct: 139 PPPGPPPPPPPP---PPPPPP---PPP 159 Score = 29.3 bits (64), Expect(2) = 6e-06 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 193 GSPGLQGTHHHHHHHHHHH 137 G PG H HHHHHH Sbjct: 120 GPPGPSKYRGDHEHHHHHH 138 [201][TOP] >UniRef100_Q1A1A3 Forkhead box protein G1 n=1 Tax=Epomophorus gambianus RepID=FOXG1_EPOGA Length = 485 Score = 44.3 bits (103), Expect(2) = 4e-07 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLR 72 PPPP P PPPPP PPPPP P PP R Sbjct: 57 PPPPAPQPPPPPQQQPPPPPQA--PQPPQAR 85 Score = 35.8 bits (81), Expect(2) = 4e-07 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 Query: 235 IPALELVDPRSRTSGSPGLQGTHHHHHHHHHHH 137 +P D + G HHHHHHHHHH Sbjct: 24 VPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHH 56 [202][TOP] >UniRef100_C0NQ83 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NQ83_AJECG Length = 642 Score = 48.9 bits (115), Expect(3) = 5e-07 Identities = 37/95 (38%), Positives = 42/95 (44%), Gaps = 7/95 (7%) Frame = -1 Query: 299 GPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPP--PPPPPL 126 GP PP P P L P R++ S P +G A PPPPPP PPPP Sbjct: 476 GPVPPPPPP------PTTGLPRPPPRSAPSNSVPPPPPPPSGGAPPPPPPPSAGAPPPP- 528 Query: 125 W*PPPPPP-----LW*PPPPPLRYQAYRYRRPRNP 36 PPPPPP PPPPP A P++P Sbjct: 529 --PPPPPPGSAANSAGPPPPPPASSARPSSLPKSP 561 Score = 26.2 bits (56), Expect(3) = 5e-07 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 444 LPSFVPPPPPPPP 406 +PS P PPPPPP Sbjct: 453 VPSSSPTPPPPPP 465 Score = 23.9 bits (50), Expect(3) = 5e-07 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLP 370 PPPPPP P + + P P Sbjct: 463 PPPPPPAPAPASTGPVPPPP 482 [203][TOP] >UniRef100_B4MEV8 GJ14893 n=1 Tax=Drosophila virilis RepID=B4MEV8_DROVI Length = 137 Score = 51.2 bits (121), Expect(3) = 5e-07 Identities = 37/84 (44%), Positives = 42/84 (50%), Gaps = 11/84 (13%) Frame = +1 Query: 79 GGGGGYHNGGGG-GGYH-NGGGGGG---------GGGGGGDAYPAARGIH*F*SGDPLVL 225 GGGGG+ GGGG GG+ NGGGGGG GGGGGG Y G L Sbjct: 33 GGGGGHGGGGGGQGGWQKNGGGGGGGGQGGWQKNGGGGGGGGYGGGGG-----GVKSLAG 87 Query: 226 ERGSTSSRAGIH*F*SGRHRGGAG 297 RGS+ S G + G+H GG G Sbjct: 88 NRGSSVSWQGGN--GGGKHGGGGG 109 Score = 24.3 bits (51), Expect(3) = 5e-07 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +2 Query: 410 GGGGGGGTKEG 442 GGGGGGG K G Sbjct: 123 GGGGGGGGKHG 133 Score = 23.9 bits (50), Expect(3) = 5e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 398 YSSGGGGGGGG 430 + GGGGGGGG Sbjct: 104 HGGGGGGGGGG 114 [204][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 SPPPPPPPPPPPP PPPPPP PPPPP+ Sbjct: 173 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 203 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPP PPPP PPPPPP PPPPP Sbjct: 151 SPPPPPPPSPPPPPSPPPPPPPSPPPPPPP 180 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPP PPPPPP PPPPPP PPPPP Sbjct: 159 SPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 188 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPP PPPP PPPPPP PPPPP Sbjct: 165 SPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 [205][TOP] >UniRef100_B9LBU3 Putative uncharacterized protein n=1 Tax=Chloroflexus sp. Y-400-fl RepID=B9LBU3_CHLSY Length = 340 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = -1 Query: 233 PRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 P + + SP + A PPPPPPPPPPPP PPPPP + PPPPP Sbjct: 261 PTASPTASPTASPTASATASPTEPPPPPPPPPPPPTVAPPPPPTVAPPPPPP 312 [206][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLR 72 PPPPPPPPPPPP PPPPPP PPPPP R Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPAR 112 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PR PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 64 PRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLR 72 PPPPPPPPPPPP PPPPPP PPPPP R Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLR 72 PPPPPPPPPPPP PPPPPP PPPPP R Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -1 Query: 194 WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 + P A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 14 YTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPP 72 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 [207][TOP] >UniRef100_A9WHI6 Putative uncharacterized protein n=1 Tax=Chloroflexus aurantiacus J-10-fl RepID=A9WHI6_CHLAA Length = 344 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = -1 Query: 233 PRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 P + + SP + A PPPPPPPPPPPP PPPPP + PPPPP Sbjct: 265 PTASPTASPTASPTASATASPTEPPPPPPPPPPPPTVAPPPPPTVAPPPPPP 316 [208][TOP] >UniRef100_A1T5K2 Putative uncharacterized protein n=1 Tax=Mycobacterium vanbaalenii PYR-1 RepID=A1T5K2_MYCVP Length = 142 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRY 69 A+PPPPPPPPPPPP PPPPP++ PPPPP Y Sbjct: 88 AAPPPPPPPPPPPP----PPPPPVYVPPPPPPVY 117 Score = 57.8 bits (138), Expect = 2e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PP 87 PPPPPPPPPPPP++ PPPPPP++ PP Sbjct: 95 PPPPPPPPPPPPVYVPPPPPPVYVPP 120 [209][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 A+PPPPPPPPPPPP PPPPPP PPPPP + A ++ Sbjct: 243 AAPPPPPPPPPPPP---PPPPPPPPPPPPPPAKPAARQF 278 [210][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 60.1 bits (144), Expect = 5e-07 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +1 Query: 73 RNGGGGGYHNGGGGGGYHNGGGGGGGGGGGG 165 R GGGGGY GGGGGGY GGGGG GGGGGG Sbjct: 38 RGGGGGGYGGGGGGGGYGGGGGGGYGGGGGG 68 Score = 59.7 bits (143), Expect = 6e-07 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = +1 Query: 37 GFRGRRYR*A*YRNGGGGGYHNGGGGGGYHNGGGGGGGGGGGG 165 G RGR Y GGGGG + GGGGGGY GGGGG GGGGGG Sbjct: 34 GGRGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGGGGGG 76 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +1 Query: 79 GGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARG 189 GGGGG GGGGGGY GGGGGG GGGGG Y G Sbjct: 31 GGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGG 67 [211][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -1 Query: 173 YASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 + SPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 485 HLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQA 63 PPPPPPPPPPPP PPPPPP PPPPP +++ Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKS 534 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 [212][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYR 51 PPPPPPPPPPPP PPPPPP PPPPP R R R Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRR 49 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRR 48 PPPPPPPPPPPP PPPPPP PPPPP ++ RR Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRR 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [213][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRR 48 PPPPPPPPPPPP PPPPPP PPPPP Y RR Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRR 57 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQ 66 PPPPPPPPPPPP PPPPPP PPPPP R Q Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQ 50 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PPPPPP PPPPP RY Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRY 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [214][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 60.1 bits (144), Expect = 5e-07 Identities = 28/53 (52%), Positives = 30/53 (56%), Gaps = 10/53 (18%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAY----------RYRRPRNP 36 PPPPPPPPPPPP PPPPPP PPPPP + Y R+RR P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQADPPAVPDRHRRDARP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 [215][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 ++PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 362 SAPPPPPPPPPPPPKGAPPPPPPPPPPPPPP 392 [216][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 60.1 bits (144), Expect = 5e-07 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 176 GYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 G + PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 982 GLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1014 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 +P PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 979 VPNGLSPPPPPPPPPPPPPPP---PPPPPPPPPPPPPP 1013 [217][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 60.1 bits (144), Expect = 5e-07 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 PPPPPPPPPPPP PPPPPP PPPPP R+P +P Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPPPPPPP PP PPP PPPPP Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 55.8 bits (133), Expect = 9e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SP PPPPPPPPPP PPPPPP PPPPP Sbjct: 257 SPSPPPPPPPPPP---PPPPPPPSPPPPPP 283 [218][TOP] >UniRef100_Q15637-5 Isoform 5 of Splicing factor 1 n=1 Tax=Homo sapiens RepID=Q15637-5 Length = 764 Score = 60.1 bits (144), Expect = 5e-07 Identities = 30/62 (48%), Positives = 32/62 (51%), Gaps = 8/62 (12%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW--------*PPPPPLRYQAYRYRRPRNPYD*RSSE 15 A PPPPPPPPPPPP PPPPPP PPPPP YQ +P P R + Sbjct: 67 ALPPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPPRKDQ 126 Query: 14 SP 9 P Sbjct: 127 QP 128 [219][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 45.1 bits (105), Expect(3) = 5e-07 Identities = 31/85 (36%), Positives = 32/85 (37%), Gaps = 11/85 (12%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPP------ 141 G P PP P PA P G P P G P PPPPP Sbjct: 184 GPPVPPPHPP------PAEPAPPPPPAPQGPPA----PPPVEGPPPPKGPPPPPHSPPGP 233 Query: 140 -----PPPPLW*PPPPPPLW*PPPP 81 PPPP PPP PP+ PPPP Sbjct: 234 PPAEGPPPPAKVPPPAPPVEGPPPP 258 Score = 26.9 bits (58), Expect(3) = 5e-07 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 441 PSFVPPPPPPPP 406 P PPPPPPPP Sbjct: 135 PPVGPPPPPPPP 146 Score = 26.9 bits (58), Expect(3) = 5e-07 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 429 PPPPPPPPL 403 PPPPPPPP+ Sbjct: 151 PPPPPPPPM 159 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP+ PPPPP Sbjct: 140 PPPPPPPPPPPPP--PPPPPPMAGPPPPP 166 [220][TOP] >UniRef100_Q1A1A2 Forkhead box protein G1 n=1 Tax=Equus burchellii RepID=FOXG1_EQUBU Length = 488 Score = 43.9 bits (102), Expect(2) = 5e-07 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 190 SPGLQGTHHHHHHHHHHHHHHY 125 S G +HH HHHHHHHHHH+ Sbjct: 36 SHGHHNSHHPQHHHHHHHHHHH 57 Score = 35.8 bits (81), Expect(2) = 5e-07 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 146 PPPPPPLW*PPPPPPLW*PPPPP 78 PPPP P PPPPP PPPPP Sbjct: 58 PPPPAP---QPPPPPQQQPPPPP 77 Score = 38.9 bits (89), Expect(2) = 4e-06 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 235 IPALELVDPRSRTSGSPGLQGTHHHHHHHHHHHH 134 +P D + G HHHHHHHHHHH Sbjct: 24 VPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHH 57 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 161 PPPPPPPPPPPLW*PPPPPP 102 PPPP P PPPP PPPPP Sbjct: 58 PPPPAPQPPPPPQQQPPPPP 77 [221][TOP] >UniRef100_UPI0000D9B690 PREDICTED: similar to diaphanous 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9B690 Length = 1269 Score = 45.1 bits (105), Expect(3) = 6e-07 Identities = 38/106 (35%), Positives = 41/106 (38%), Gaps = 12/106 (11%) Frame = -1 Query: 359 PPSNQSFSDIKLIDTVDLEGGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRA 180 PP + + T L GG A P P L + S PL P Sbjct: 648 PPPPPLIGSVCISSTPSLPGGTAIP----------PPPPLPEGASIPPPPPL-----PGD 692 Query: 179 AGYASPPPPPP----PPPPPPL----W*PPPPPPL----W*PPPPP 78 G PPP P PPPPPPL PPPPPPL PPPPP Sbjct: 693 VGIPPPPPLPGDAGIPPPPPPLPGGAGMPPPPPPLPGGPGIPPPPP 738 Score = 26.9 bits (58), Expect(3) = 6e-07 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 438 SFVPPPPPPPP 406 S PPPPPPPP Sbjct: 631 STTPPPPPPPP 641 Score = 26.6 bits (57), Expect(3) = 6e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 429 PPPPPPPPLL 400 PPPPPPPP L Sbjct: 644 PPPPPPPPPL 653 [222][TOP] >UniRef100_Q4P876 Putative uncharacterized protein n=1 Tax=Ustilago maydis RepID=Q4P876_USTMA Length = 460 Score = 47.0 bits (110), Expect(3) = 6e-07 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Frame = -1 Query: 182 AAGYASPPPPPPPPP------PPPLW*PPPPPPLW*PPPPP 78 AAG ++PPPPPPPPP PPP PPPPP P PP Sbjct: 330 AAGSSAPPPPPPPPPMSGSSAPPP---PPPPPTSGSAPLPP 367 Score = 29.3 bits (64), Expect(3) = 6e-07 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLPLYQPTKQSKFFRYQAYRYRRPRGGASS 289 PPPPPPPPL P P P + + RP G+S+ Sbjct: 289 PPPPPPPPLRAPAVSSAPPPPPPPMRPAAGSSAPPPPPMRPAAGSSA 335 Score = 22.3 bits (46), Expect(3) = 6e-07 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 441 PSFVPPPPPP 412 P+ PPPPPP Sbjct: 271 PAPAPPPPPP 280 [223][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 379 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 386 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 367 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 [224][TOP] >UniRef100_UPI0000F53460 enabled homolog isoform 2 n=2 Tax=Mus musculus RepID=UPI0000F53460 Length = 789 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 P +G A+PPPPPPPPPPP PPPPPPL PP PPL Sbjct: 419 PPTSGPAAPPPPPPPPPPP----PPPPPPLPPPPLPPL 452 [225][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 1504 [226][TOP] >UniRef100_UPI000047625B enabled homolog isoform 3 n=1 Tax=Mus musculus RepID=UPI000047625B Length = 785 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 P +G A+PPPPPPPPPPP PPPPPPL PP PPL Sbjct: 415 PPTSGPAAPPPPPPPPPPP----PPPPPPLPPPPLPPL 448 [227][TOP] >UniRef100_UPI00015DF6E5 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E5 Length = 391 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 P +G A+PPPPPPPPPPP PPPPPPL PP PPL Sbjct: 22 PPTSGPAAPPPPPPPPPPP----PPPPPPLPPPPLPPL 55 [228][TOP] >UniRef100_UPI00015DF6E3 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E3 Length = 701 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 P +G A+PPPPPPPPPPP PPPPPPL PP PPL Sbjct: 331 PPTSGPAAPPPPPPPPPPP----PPPPPPLPPPPLPPL 364 [229][TOP] >UniRef100_UPI000056479E enabled homolog isoform 1 n=1 Tax=Mus musculus RepID=UPI000056479E Length = 804 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 P +G A+PPPPPPPPPPP PPPPPPL PP PPL Sbjct: 434 PPTSGPAAPPPPPPPPPPP----PPPPPPLPPPPLPPL 467 [230][TOP] >UniRef100_UPI000179D080 UPI000179D080 related cluster n=1 Tax=Bos taurus RepID=UPI000179D080 Length = 540 Score = 59.7 bits (143), Expect = 6e-07 Identities = 31/61 (50%), Positives = 33/61 (54%), Gaps = 7/61 (11%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW-------*PPPPPLRYQAYRYRRPRNPYD*RSSES 12 A PPPPPPPPPPPP PPPPPP PPPPPL YQ +P P R + Sbjct: 60 ALPPPPPPPPPPPPQQPPPPPPPSSGSSYSPPQPPPPPL-YQRVSPPQPPPPQPPRQDQQ 118 Query: 11 P 9 P Sbjct: 119 P 119 [231][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -1 Query: 176 GYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 G A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 219 GAAPPPPPPPPPPPPP---PPPPPPPPPPPPPP 248 [232][TOP] >UniRef100_A4TEZ3 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4TEZ3_MYCGI Length = 177 Score = 59.7 bits (143), Expect = 6e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 +PPPPPPPPPPPP PPPPPP PPPPP+ Sbjct: 122 APPPPPPPPPPPPPGAPPPPPPPPPPPPPPV 152 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 122 APPPPPPPPPPPPPGAPPPPPPP---PPPPP 149 [233][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 A PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 43 APPPPPPPPPPPPPPPPPPPPPPT--PPPPPL 72 [234][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 59.7 bits (143), Expect = 6e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -1 Query: 170 ASPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 A PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 43 APPPPPPPPPPPPPPPPPPPPPPT--PPPPPL 72 [235][TOP] >UniRef100_Q9ZWT0 Extensin n=1 Tax=Adiantum capillus-veneris RepID=Q9ZWT0_ADICA Length = 207 Score = 59.7 bits (143), Expect = 6e-07 Identities = 48/156 (30%), Positives = 65/156 (41%), Gaps = 20/156 (12%) Frame = -1 Query: 443 YLPLYHHH-----HHHHRYYIQYTESNL-YPCINPPSNQSFSDIKLIDTVDLEGGPAPP- 285 ++P +HHH H H+ ++ Q T + YP +PP + S K P PP Sbjct: 41 HVPYHHHHDSHWRHPHYHHHKQRTPWHPHYPHKSPPPSPSSPPYKYKSPPPPSPSPPPPY 100 Query: 284 --RWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPPPPPPPLW*PPP 111 + P + P + S SP P Y SPPPP P PPPP ++ PP Sbjct: 101 IYKSPPPPSPSPPPPYIYKSPPPPSPSP------PPPYLYKSPPPPSPSPPPPYIYKSPP 154 Query: 110 PPPLW*PPPPPLRYQA-----------YRYRRPRNP 36 PPP P PPP Y + Y+Y+ P P Sbjct: 155 PPPCT-PSPPPYFYSSPPPPSPSPPPPYQYKSPPPP 189 [236][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 675 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPPL PPPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPPL PPPPP PPPPP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 678 SPPPPPPPPPPPP---PPPPPP---PPPPP 701 Score = 55.8 bits (133), Expect = 9e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPP PPPPPPP PPPPPP PPPPP Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP P PPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP P PPPP PPPPP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 55.8 bits (133), Expect = 9e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 680 PPPPPPPPPPPP---PPPPPP---PPPPP 702 Score = 55.8 bits (133), Expect = 9e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPP P Sbjct: 681 PPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 [237][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPL 280 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PR PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 239 PRPPPPPMPPPPPPPPPPPP---PPPPPPSPPPPPPP 272 [238][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 SPPPPPPPPPPPP PPPPPP PPPPP+ Sbjct: 276 SPPPPPPPPPPPP---PPPPPPPPPPPPPPV 303 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPPPPP P PPPPPP PPPPP Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 [239][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 102 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = -1 Query: 191 IPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 +P A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 [240][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 167 SPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 SPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -1 Query: 173 YASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 ++ PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 43 HSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQ 66 PPPPPPPPPPPP PPPPPP PPPPP +++ Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWE 101 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRY 69 PPPPPPPPPPPP PPPPPP W P PP ++ Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPQWEPADPPSKW 109 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -1 Query: 185 RAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 R A PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 40 RNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 [241][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [242][TOP] >UniRef100_B4H321 GL13352 n=1 Tax=Drosophila persimilis RepID=B4H321_DROPE Length = 191 Score = 59.7 bits (143), Expect = 6e-07 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 6/35 (17%) Frame = +1 Query: 79 GGGGGYHNG------GGGGGYHNGGGGGGGGGGGG 165 G GGG HNG GGGGG+HNGGGGGGGGGGGG Sbjct: 105 GNGGGGHNGGGGYPSGGGGGFHNGGGGGGGGGGGG 139 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +1 Query: 76 NGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAA 183 + GGGGY +GGGGG ++ GGGGGGGGGGG AY ++ Sbjct: 111 HNGGGGYPSGGGGGFHNGGGGGGGGGGGGSGAYASS 146 [243][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRY 69 PPPPPPPPPPPP PPPPPP PPPPP Y Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAPY 69 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/43 (62%), Positives = 27/43 (62%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRYRRPRNP 36 PPPPPPPPPPPP PPPPPP PPPPP Y PR P Sbjct: 40 PPPPPPPPPPPP---PPPPPPPPPPPPPPPAPYVY----PRRP 75 [244][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPL 75 PPPPPPPPPPPP PPPPPP PPPPPL Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 98 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -1 Query: 188 PRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PR PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -1 Query: 194 WIPRAAGYASPPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 ++P PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 18 FLPHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPP 78 PPPPPPPPPPPP PPPPPP PPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 [245][TOP] >UniRef100_B5XQY2 Beta-galactosidase n=1 Tax=Klebsiella pneumoniae 342 RepID=BGAL_KLEP3 Length = 1035 Score = 59.7 bits (143), Expect = 6e-07 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = +1 Query: 631 VLQRRDWXNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWK 780 VL R DW N +T LNRL AHP FASWR+ AR + S + R L+GEW+ Sbjct: 17 VLAREDWQNQTITHLNRLPAHPAFASWRDELAARDNHLSTRRRQLDGEWQ 66 [246][TOP] >UniRef100_P04264 Keratin, type II cytoskeletal 1 n=1 Tax=Homo sapiens RepID=K2C1_HUMAN Length = 644 Score = 53.5 bits (127), Expect(2) = 7e-07 Identities = 36/83 (43%), Positives = 43/83 (51%), Gaps = 8/83 (9%) Frame = +1 Query: 73 RNGGGGGYHNGG-----GGGGYHNGGGGGGGG---GGGGDAYPAARGIH*F*SGDPLVLE 228 R GGGGGY +GG GGG Y +GGGGGGG G GG +Y + G + G Sbjct: 518 RGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGS 577 Query: 229 RGSTSSRAGIH*F*SGRHRGGAG 297 GS SS SG +RGG+G Sbjct: 578 YGSGSS--------SGGYRGGSG 592 Score = 25.8 bits (55), Expect(2) = 7e-07 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 398 YSSGGGGGGGGTKEGK 445 Y G GGGGGG+ G+ Sbjct: 587 YRGGSGGGGGGSSGGR 602 [247][TOP] >UniRef100_B4I386 GM18470 n=1 Tax=Drosophila sechellia RepID=B4I386_DROSE Length = 580 Score = 52.0 bits (123), Expect(2) = 7e-07 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = -1 Query: 164 PPPPPPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPPPPPP PP PP PPPP R + Y Y Sbjct: 470 PPPPPPPPPPPP---PPTEPP---PPPPEPRVKKYSY 500 Score = 27.3 bits (59), Expect(2) = 7e-07 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 169 HHHHHHHHHH 140 H HHHHH HH Sbjct: 459 HPHHHHHVHH 468 Score = 47.8 bits (112), Expect(2) = 7e-06 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -1 Query: 152 PPPPPPPPLW*PPPPPPLW*PPPPPLRYQAYRY 54 PPPPPPPP PPPPPP PPPPP + +Y Sbjct: 469 PPPPPPPP---PPPPPPPTEPPPPPPEPRVKKY 498 Score = 28.1 bits (61), Expect(2) = 7e-06 Identities = 23/91 (25%), Positives = 31/91 (34%), Gaps = 20/91 (21%) Frame = -2 Query: 337 PISSLSIPSTSRGGQLHRGGGRSRTSGSPL*N*----------WIPALELVDP-----RS 203 P + + S + GG GGG G P + + P +E P +S Sbjct: 346 PADDMDMGSPADGGDSGGGGGDGDIGGLPSLHNDGSGPDDDHKYDPNMEYATPPPGWLQS 405 Query: 202 RTSGSPGLQGTHHHHH-----HHHHHHHHHY 125 + H H H H H HHH HY Sbjct: 406 HPESAAPKPEDHDHDHAPDHDHVHDHHHDHY 436 [248][TOP] >UniRef100_Q8I1F4 rRNA 2'-O-methyltransferase fibrillarin n=1 Tax=Drosophila erecta RepID=FBRL_DROER Length = 345 Score = 57.0 bits (136), Expect(2) = 7e-07 Identities = 35/75 (46%), Positives = 37/75 (49%) Frame = +1 Query: 73 RNGGGGGYHNGGGGGGYHNGGGGGGGGGGGGDAYPAARGIH*F*SGDPLVLERGSTSSRA 252 R GGGGG GGGGGG+ GGGGGGGGGGG + RG RG R Sbjct: 9 RGGGGGG---GGGGGGFRGRGGGGGGGGGGG--FGGGRG-------------RGGGGDRG 50 Query: 253 GIH*F*SGRHRGGAG 297 G F GR GG G Sbjct: 51 GRGGFGGGRGGGGRG 65 Score = 22.3 bits (46), Expect(2) = 7e-07 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 407 GGGGGGGGTKEGK 445 G GGG GG K GK Sbjct: 98 GRGGGAGGFKGGK 110 [249][TOP] >UniRef100_C1ECP1 Resistance-nodulation-cell division superfamily n=1 Tax=Micromonas sp. RCC299 RepID=C1ECP1_9CHLO Length = 1523 Score = 42.0 bits (97), Expect(3) = 7e-07 Identities = 31/76 (40%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = -1 Query: 296 PAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPP--PPPPPLW 123 P+PP P P L P S + SP P A +PP PP P P PPP Sbjct: 886 PSPPPAIPP-----PPSPLPPPPSPPAPSP------PPPAPVGTPPSPPAPFPPAPPP-- 932 Query: 122 *PPPPPPLW*PPPPPL 75 P PPPPL PP PP+ Sbjct: 933 -PSPPPPL--PPAPPV 945 Score = 28.5 bits (62), Expect(3) = 7e-07 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 438 SFVPPPPPPPP 406 S VPPPPPPPP Sbjct: 855 STVPPPPPPPP 865 Score = 27.7 bits (60), Expect(3) = 7e-07 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 429 PPPPPPPPLLYTIYRIQPLPLYQP 358 PPPPPPPP R P P P Sbjct: 867 PPPPPPPPFPANAPRPPPPPSPPP 890 [250][TOP] >UniRef100_Q54WH2 Formin-A n=1 Tax=Dictyostelium discoideum RepID=FORA_DICDI Length = 1218 Score = 46.6 bits (109), Expect(3) = 8e-07 Identities = 34/86 (39%), Positives = 34/86 (39%), Gaps = 11/86 (12%) Frame = -1 Query: 302 GGPAPPRWRPL*N*WIPALELVDPRSRTSGSPL*N*WIPRAAGYASPPPPPPP------P 141 GGP PP P T G P P G PPPPPPP P Sbjct: 676 GGPPPPP---------------PPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPP 720 Query: 140 PPPP---LW*PPPPPP--LW*PPPPP 78 PPPP PPPPPP PPPPP Sbjct: 721 PPPPGAKAGGPPPPPPPFGKGPPPPP 746 Score = 26.9 bits (58), Expect(3) = 8e-07 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 429 PPPPPPPPL 403 PPPPPPPP+ Sbjct: 664 PPPPPPPPM 672 Score = 24.6 bits (52), Expect(3) = 8e-07 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 438 SFVPPPPPPP 409 S PPPPPPP Sbjct: 647 SVAPPPPPPP 656