[UP]
[1][TOP] >UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR Length = 207 Score = 77.4 bits (189), Expect = 5e-13 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -1 Query: 114 RYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 R GGGGGGYGGGG GG GGGGGGCY+CGE GHMARDC Sbjct: 123 RRGGGGGGYGGGGGYGGGGGGGGGCYSCGESGHMARDC 160 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGG GGG GGG GGGGGGCYNCG GH ARDC Sbjct: 167 GGGGGGRYGGGNGGGGGGGGGGCYNCGGSGHFARDC 202 [2][TOP] >UniRef100_Q84UR8 Os08g0129200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q84UR8_ORYSJ Length = 197 Score = 75.9 bits (185), Expect = 1e-12 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGG---RGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGGYGGGG RGGG GGGGGGCYNCGE GH+AR+C Sbjct: 154 GGGGGGYGGGGGGYRGGGGGGGGGGCYNCGETGHIAREC 192 Score = 70.1 bits (170), Expect = 7e-11 Identities = 33/45 (73%), Positives = 33/45 (73%), Gaps = 8/45 (17%) Frame = -1 Query: 111 YGGGGGGYGGGGRG----GGRGGGGGG----CYNCGEFGHMARDC 1 YGGGGGGYGGG RG GG GGGGGG CY CGE GHMARDC Sbjct: 106 YGGGGGGYGGGDRGYGGGGGYGGGGGGGSRACYKCGEEGHMARDC 150 [3][TOP] >UniRef100_A2YQW2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YQW2_ORYSI Length = 193 Score = 75.9 bits (185), Expect = 1e-12 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGG---RGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGGYGGGG RGGG GGGGGGCYNCGE GH+AR+C Sbjct: 150 GGGGGGYGGGGGGYRGGGGGGGGGGCYNCGETGHIAREC 188 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 111 YGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGG GYGGGG GG GGG CY CGE GHMARDC Sbjct: 110 YGGGDRGYGGGGGYGGGGGGSRACYKCGEEGHMARDC 146 [4][TOP] >UniRef100_Q41188 Glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q41188_ARATH Length = 203 Score = 74.3 bits (181), Expect = 4e-12 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 111 YGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGGYGGGGRGGG GGGG CY+CGE GH ARDC Sbjct: 164 YGGGGGGYGGGGRGGG--GGGGSCYSCGESGHFARDC 198 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/39 (76%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = -1 Query: 105 GGGGGYGGGGRG-GGRGGGGGG---CYNCGEFGHMARDC 1 G GGGYGGGG G GGRGGGG G CY CGE GHMARDC Sbjct: 106 GSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDC 144 [5][TOP] >UniRef100_Q8LPA7 Cold shock protein-1 n=1 Tax=Triticum aestivum RepID=Q8LPA7_WHEAT Length = 229 Score = 72.4 bits (176), Expect = 1e-11 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 111 YGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGGYGGGG G G GGGG GCY CGE GH++RDC Sbjct: 109 YGGGGGGYGGGGGGYGGGGGGRGCYKCGEEGHISRDC 145 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGGYGGGG GG GGGGGGC++CGE GH +R+C Sbjct: 190 GGGGGGYGGGGGRGG-GGGGGGCFSCGESGHFSREC 224 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGGYGGGG GGG GGGG CY CGE GH++RDC Sbjct: 149 GGGGGGYGGGGYGGG-GGGGRECYKCGEEGHISRDC 183 [6][TOP] >UniRef100_Q75QN8 Cold shock domain protein 3 n=1 Tax=Triticum aestivum RepID=Q75QN8_WHEAT Length = 231 Score = 72.0 bits (175), Expect = 2e-11 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -1 Query: 111 YGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGGYGGGG GGG GGGG GCY CGE GH++RDC Sbjct: 116 YGGGGGGYGGGGYGGG-GGGGRGCYKCGEDGHISRDC 151 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGGYGGGG GG GGGGGGC++CGE GH +R+C Sbjct: 192 GGGGGGYGGGGGRGG-GGGGGGCFSCGESGHFSREC 226 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGGYGGGG GGG GGGG CY CGE GH++RDC Sbjct: 155 GGGGGGYGGGGYGGG-GGGGRECYKCGEEGHISRDC 189 [7][TOP] >UniRef100_P27484 Glycine-rich protein 2 n=1 Tax=Nicotiana sylvestris RepID=GRP2_NICSY Length = 214 Score = 71.2 bits (173), Expect = 3e-11 Identities = 30/39 (76%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -1 Query: 114 RYGGGGGGYGGGGR-GGGRGGGGGGCYNCGEFGHMARDC 1 RYGGGGGGYGGGG GGG GGG GC+ CGE GH ARDC Sbjct: 134 RYGGGGGGYGGGGGYGGGGSGGGSGCFKCGESGHFARDC 172 [8][TOP] >UniRef100_Q3HRT2 Putative glycine-rich protein n=1 Tax=Picea glauca RepID=Q3HRT2_PICGL Length = 156 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -1 Query: 123 VEERYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 V+ GGGGGG GGG GGG GGGGG CY CGE GH ARDC Sbjct: 77 VQGNSGGGGGGRGGGRGGGGAGGGGGSCYKCGESGHFARDC 117 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -1 Query: 96 GGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GG GGG GGG G GGG CY CG+FGH ARDC Sbjct: 120 GGGGGGNGGGGGGAGGGSCYQCGDFGHFARDC 151 [9][TOP] >UniRef100_C4JBR4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4JBR4_MAIZE Length = 240 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 G GGGGYGGGG GGG GGGGGGC+ CGE GHMARDC Sbjct: 146 GYGGGGYGGGGYGGG-GGGGGGCFKCGEPGHMARDC 180 Score = 67.8 bits (164), Expect = 4e-10 Identities = 33/56 (58%), Positives = 34/56 (60%), Gaps = 19/56 (33%) Frame = -1 Query: 111 YGGGG---GGYGGGGRGGG----------------RGGGGGGCYNCGEFGHMARDC 1 YGGGG GGYGGGG GGG GGGGGGCYNCG+ GHMARDC Sbjct: 147 YGGGGYGGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGGGCYNCGQAGHMARDC 202 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 100 GGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 138 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = -1 Query: 96 GGYGGGGRGGGRGGGGG--GCYNCGEFGHMARDC 1 GG GGGGR GG GGGGG CYNCGE GH+ARDC Sbjct: 205 GGGGGGGRFGGGGGGGGDRSCYNCGEAGHIARDC 238 [10][TOP] >UniRef100_C0PLI2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PLI2_MAIZE Length = 249 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 G GGGGYGGGG GGG GGGGGGC+ CGE GHMARDC Sbjct: 146 GYGGGGYGGGGYGGG-GGGGGGCFKCGEPGHMARDC 180 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 18/55 (32%) Frame = -1 Query: 111 YGGGGGG------------------YGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGG GGGG GGG GGGGGGCYNCG+ GHMARDC Sbjct: 157 YGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 211 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 24/61 (39%) Frame = -1 Query: 111 YGGGGGGYGGG------------------GRGGGRGGGGGG------CYNCGEFGHMARD 4 YGGGGGG GGG G GGGR GGGGG CYNCGE GH+ARD Sbjct: 187 YGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGHIARD 246 Query: 3 C 1 C Sbjct: 247 C 247 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 100 GGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 138 [11][TOP] >UniRef100_C0PAD4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PAD4_MAIZE Length = 281 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 G GGGGYGGGG GGG GGGGGGC+ CGE GHMARDC Sbjct: 178 GYGGGGYGGGGYGGG-GGGGGGCFKCGEPGHMARDC 212 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 18/55 (32%) Frame = -1 Query: 111 YGGGGGG------------------YGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGG GGGG GGG GGGGGGCYNCG+ GHMARDC Sbjct: 189 YGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 243 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 24/61 (39%) Frame = -1 Query: 111 YGGGGGGYGGG------------------GRGGGRGGGGGG------CYNCGEFGHMARD 4 YGGGGGG GGG G GGGR GGGGG CYNCGE GH+ARD Sbjct: 219 YGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGHIARD 278 Query: 3 C 1 C Sbjct: 279 C 279 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 132 GGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 170 [12][TOP] >UniRef100_C0P2C3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0P2C3_MAIZE Length = 187 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 G GGGGYGGGG GGG GGGGGGC+ CGE GHMARDC Sbjct: 84 GYGGGGYGGGGYGGG-GGGGGGCFKCGEPGHMARDC 118 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 18/55 (32%) Frame = -1 Query: 111 YGGGGGG------------------YGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGG GGGG GGG GGGGGGCYNCG+ GHMARDC Sbjct: 95 YGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 149 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 24/61 (39%) Frame = -1 Query: 111 YGGGGGGYGGG------------------GRGGGRGGGGGG------CYNCGEFGHMARD 4 YGGGGGG GGG G GGGR GGGGG CYNCGE GH+ARD Sbjct: 125 YGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGHIARD 184 Query: 3 C 1 C Sbjct: 185 C 185 [13][TOP] >UniRef100_B4FXR6 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FXR6_MAIZE Length = 303 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 G GGGGYGGGG GGG GGGGGGC+ CGE GHMARDC Sbjct: 200 GYGGGGYGGGGYGGG-GGGGGGCFKCGEPGHMARDC 234 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 18/55 (32%) Frame = -1 Query: 111 YGGGGGG------------------YGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGG GGGG GGG GGGGGGCYNCG+ GHMARDC Sbjct: 211 YGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 265 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 24/61 (39%) Frame = -1 Query: 111 YGGGGGGYGGG------------------GRGGGRGGGGGG------CYNCGEFGHMARD 4 YGGGGGG GGG G GGGR GGGGG CYNCGE GH+ARD Sbjct: 241 YGGGGGGGGGGCYNCGQAGHMARDCPSGGGSGGGRFGGGGGGGGDRSCYNCGEAGHIARD 300 Query: 3 C 1 C Sbjct: 301 C 301 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 154 GGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 192 [14][TOP] >UniRef100_B4FQQ2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FQQ2_MAIZE Length = 134 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 G GGGGYGGGG GGG GGGGGGC+ CGE GHMARDC Sbjct: 31 GYGGGGYGGGGYGGG-GGGGGGCFKCGEPGHMARDC 65 Score = 68.6 bits (166), Expect = 2e-10 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 18/55 (32%) Frame = -1 Query: 111 YGGGGGG------------------YGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGG GGGG GGG GGGGGGCYNCG+ GHMARDC Sbjct: 42 YGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 96 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/61 (52%), Positives = 33/61 (54%), Gaps = 24/61 (39%) Frame = -1 Query: 111 YGGGGGGYGGG------------------GRGGGRGGGGGG------CYNCGEFGHMARD 4 YGGGGGG GGG G GGGR GGGGG CYNCGE GH+ARD Sbjct: 72 YGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGHIARD 131 Query: 3 C 1 C Sbjct: 132 C 132 [15][TOP] >UniRef100_A5BQ96 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BQ96_VITVI Length = 219 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/37 (81%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -1 Query: 108 GGGGGGYGGGGR-GGGRGGGGGGCYNCGEFGHMARDC 1 G GGGGYGGGG GGG GGGGG CYNCGE GH+ARDC Sbjct: 135 GYGGGGYGGGGGYGGGGGGGGGACYNCGEEGHLARDC 171 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/37 (75%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -1 Query: 108 GGGGGGYG-GGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGG Y GGG GGG GGGGGGCY CGE GH AR+C Sbjct: 178 GGGGGRYSSGGGGGGGGGGGGGGCYRCGEAGHFAREC 214 [16][TOP] >UniRef100_UPI00019830CC PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019830CC Length = 241 Score = 68.9 bits (167), Expect = 2e-10 Identities = 32/62 (51%), Positives = 35/62 (56%), Gaps = 19/62 (30%) Frame = -1 Query: 129 DVVEERYGGGGGGYGGGGRGGG-------------------RGGGGGGCYNCGEFGHMAR 7 D V GGGGGG GGGG GGG GGGGGGCYNCG++GH+AR Sbjct: 133 DCVRRNNGGGGGGSGGGGGGGGCYTCGQPGHLARDCSRPSGGGGGGGGCYNCGDYGHLAR 192 Query: 6 DC 1 DC Sbjct: 193 DC 194 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 13/52 (25%) Frame = -1 Query: 117 ERYGGGGGGYGGGGRGGG-------------RGGGGGGCYNCGEFGHMARDC 1 + YGGGGGG G GGR GG GGGG CYNCG GH+ARDC Sbjct: 83 DNYGGGGGGGGRGGRSGGGYGSGWRTGDRGGNGGGGAACYNCGGTGHLARDC 134 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = -1 Query: 105 GGGGGYGGGGRGGGR--GGGGGGCYNCGEFGHMARDC 1 G G +GGGG GGG GGGGGGCYNCG+ GH AR+C Sbjct: 199 GSAGRFGGGGGGGGGRFGGGGGGCYNCGQEGHFAREC 235 [17][TOP] >UniRef100_C5XT04 Putative uncharacterized protein Sb04g001720 n=1 Tax=Sorghum bicolor RepID=C5XT04_SORBI Length = 251 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/35 (82%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -1 Query: 102 GGGGYGGGGRGG-GRGGGGGGCYNCGEFGHMARDC 1 GGGGYGGGG GG G GGGGG CYNCG+ GHMARDC Sbjct: 179 GGGGYGGGGGGGYGGGGGGGACYNCGQTGHMARDC 213 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 105 GGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGYGGGG GG GGGGGGC+ CGE GHMARDC Sbjct: 144 GGGGGYGGGG--GGYGGGGGGCFKCGEPGHMARDC 176 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGG---GGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGG YGG GGR G GGG G CY CGE GHMARDC Sbjct: 101 GGGGRSYGGSWGGGRRSGGGGGAGACYKCGEPGHMARDC 139 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/65 (49%), Positives = 33/65 (50%), Gaps = 29/65 (44%) Frame = -1 Query: 108 GGGGGGYGGGGRGG--------------------------GRGGGGGG---CYNCGEFGH 16 GGGGGGYGGGG GG G GGGGGG CYNCGE GH Sbjct: 185 GGGGGGYGGGGGGGACYNCGQTGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGH 244 Query: 15 MARDC 1 +ARDC Sbjct: 245 IARDC 249 [18][TOP] >UniRef100_UPI0001982DB4 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982DB4 Length = 214 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -1 Query: 108 GGGGGGY-GGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGG Y GGGG GGG GGGGGGCY CGE GH AR+C Sbjct: 173 GGGGGRYSGGGGGGGGGGGGGGGCYRCGEAGHFAREC 209 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 G GGGGYGGGG GG GGGGG CYNCGE GH+ARDC Sbjct: 132 GYGGGGYGGGGGYGG-GGGGGACYNCGEEGHLARDC 166 [19][TOP] >UniRef100_A5BG48 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BG48_VITVI Length = 247 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 23/66 (34%) Frame = -1 Query: 129 DVVEERYGGGGGGYGGGG-----------------------RGGGRGGGGGGCYNCGEFG 19 D V GGGGGG GGGG GGG GGGGGGCYNCG++G Sbjct: 133 DCVRRNNGGGGGGXGGGGGGGGGGCYTCGQPGHLARDCSRPSGGGGGGGGGGCYNCGDYG 192 Query: 18 HMARDC 1 H+ARDC Sbjct: 193 HLARDC 198 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -1 Query: 114 RYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 R+GGGGGG GGGR GG GGGGGGCYNCG+ GH AR+C Sbjct: 207 RFGGGGGG--GGGRFGG-GGGGGGCYNCGQEGHFAREC 241 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 13/52 (25%) Frame = -1 Query: 117 ERYGGGGGGYGGGGRGGG-------------RGGGGGGCYNCGEFGHMARDC 1 + YGGGGGG G GGR GG GGGG CYNCG GH+ARDC Sbjct: 83 DXYGGGGGGGGRGGRSGGGYGSGWRTGDRGGNGGGGAACYNCGGTGHLARDC 134 [20][TOP] >UniRef100_A9NNT8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NNT8_PICSI Length = 205 Score = 67.0 bits (162), Expect = 6e-10 Identities = 31/40 (77%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -1 Query: 108 GGGGGGYGGG---GRGGGRGGGGGG-CYNCGEFGHMARDC 1 GGGGGG GGG GRGGG GGGGGG CY CGE GH ARDC Sbjct: 126 GGGGGGRGGGRGGGRGGGAGGGGGGSCYKCGESGHFARDC 165 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 99 GGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGG GGG GGG G GGG CY CG+FGH ARDC Sbjct: 168 GGGGGGGNGGGGGGAGGGSCYQCGDFGHFARDC 200 [21][TOP] >UniRef100_Q75QN9 Cold shock domain protein 2 n=1 Tax=Triticum aestivum RepID=Q75QN9_WHEAT Length = 205 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGGYGGGG GG GGGGGGC++CGE GH +R+C Sbjct: 166 GGGGGGYGGGGGRGG-GGGGGGCFSCGESGHFSREC 200 Score = 64.3 bits (155), Expect = 4e-09 Identities = 31/53 (58%), Positives = 33/53 (62%), Gaps = 16/53 (30%) Frame = -1 Query: 111 YGGGGGGYGGGGR----GGGRGGGGGG------------CYNCGEFGHMARDC 1 YGGGGGGYGGGG GGG GGGGGG CY CGE GH++RDC Sbjct: 109 YGGGGGGYGGGGGSYGGGGGYGGGGGGGRYGGGSGGGRECYKCGEEGHISRDC 161 [22][TOP] >UniRef100_C1MPH3 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MPH3_9CHLO Length = 835 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGG GGG GGG GGGGG C+ CGE GH ARDC Sbjct: 753 GGGGGGQYGGGGGGGGGGGGGSCFKCGESGHWARDC 788 [23][TOP] >UniRef100_A9RSY7 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RSY7_PHYPA Length = 161 Score = 65.9 bits (159), Expect = 1e-09 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGG GGGG GGG GGGGG C+ CG+ GH AR+C Sbjct: 101 GGGGGGKGGGGGGGGGGGGGGDCFKCGQPGHWAREC 136 [24][TOP] >UniRef100_B6U2B9 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6U2B9_MAIZE Length = 208 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -1 Query: 117 ERYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 +R GGGGGYGGG GGG GGGG GC+ CGE GHMARDC Sbjct: 135 DRGYGGGGGYGGG-YGGGGGGGGRGCFKCGEEGHMARDC 172 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 29/66 (43%) Frame = -1 Query: 111 YGGGGG---GYGGGGRGGGRG----------------------GGGGG----CYNCGEFG 19 YGGGGG GYGGGG GGGRG GGGGG CYNCG+ G Sbjct: 138 YGGGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGGYGGGGGGGRXSECYNCGQEG 197 Query: 18 HMARDC 1 H++RDC Sbjct: 198 HISRDC 203 [25][TOP] >UniRef100_B6TP60 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6TP60_MAIZE Length = 208 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -1 Query: 117 ERYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 +R GGGGGYGGG GGG GGGG GC+ CGE GHMARDC Sbjct: 135 DRGYGGGGGYGGG-YGGGGGGGGRGCFKCGEEGHMARDC 172 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 29/66 (43%) Frame = -1 Query: 111 YGGGGG---GYGGGGRGGGRG----------------------GGGGG----CYNCGEFG 19 YGGGGG GYGGGG GGGRG GGGGG CYNCG+ G Sbjct: 138 YGGGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGGYGGGGGGGRGSECYNCGQEG 197 Query: 18 HMARDC 1 H++RDC Sbjct: 198 HISRDC 203 [26][TOP] >UniRef100_B6SP06 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6SP06_MAIZE Length = 208 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -1 Query: 117 ERYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 +R GGGGGYGGG GGG GGGG GC+ CGE GHMARDC Sbjct: 135 DRGYGGGGGYGGG-YGGGGGGGGRGCFKCGEEGHMARDC 172 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 29/66 (43%) Frame = -1 Query: 111 YGGGGG---GYGGGGRGGGRG----------------------GGGGG----CYNCGEFG 19 YGGGGG GYGGGG GGGRG GGGGG CYNCG+ G Sbjct: 138 YGGGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGGYGGGGGGGRGSECYNCGQEG 197 Query: 18 HMARDC 1 H++RDC Sbjct: 198 HISRDC 203 [27][TOP] >UniRef100_B9ILD8 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9ILD8_POPTR Length = 198 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/41 (70%), Positives = 30/41 (73%), Gaps = 3/41 (7%) Frame = -1 Query: 114 RYGGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 R GGGGGG GGGGRGGGRG GG CY CGE GH AR+C Sbjct: 74 RGGGGGGGGGGGGRGGGRGRSGGSDLKCYECGEAGHFAREC 114 [28][TOP] >UniRef100_UPI00019852F3 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019852F3 Length = 228 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 16/53 (30%) Frame = -1 Query: 111 YGGGGGGYGGGGRGGGRG----------------GGGGGCYNCGEFGHMARDC 1 YGGGGGG GGGG GGG G GGGG CYNCG GH+ARDC Sbjct: 105 YGGGGGGGGGGGGGGGYGRGVRGGRRSGRTDDGYGGGGACYNCGRTGHLARDC 157 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGR--GGGGGGCYNCGEFGHMARDC 1 G GGGGY G GGG G GGG CYNCGE GH ARDC Sbjct: 186 GAGGGGYSAGAGGGGYSFGAGGGACYNCGEEGHFARDC 223 [29][TOP] >UniRef100_B9RJ51 Cold shock protein, putative n=1 Tax=Ricinus communis RepID=B9RJ51_RICCO Length = 184 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -1 Query: 111 YGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 Y GGGGG GGG R G GGG G CYNCGE GH ARDC Sbjct: 142 YQGGGGGGGGGSRRFGGGGGSGACYNCGEEGHFARDC 178 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/49 (59%), Positives = 31/49 (63%), Gaps = 14/49 (28%) Frame = -1 Query: 105 GGGGGYGGGGRG----------GGRGGGGGG----CYNCGEFGHMARDC 1 GGGGGY GGGRG GGR GGGG CYNCG +GH+ARDC Sbjct: 93 GGGGGYSGGGRGDGGVYVRRGRGGRSGGGGAGGSACYNCGRYGHLARDC 141 [30][TOP] >UniRef100_A4QWM8 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4QWM8_MAGGR Length = 199 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/40 (72%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -1 Query: 108 GGGGGGY--GGGGRGGGRGGGGGG--CYNCGEFGHMARDC 1 GGGGGGY GGGG GGG GGG GG CY+CG GHM+RDC Sbjct: 114 GGGGGGYSGGGGGYGGGYGGGAGGKTCYSCGGVGHMSRDC 153 [31][TOP] >UniRef100_C5YGM9 Putative uncharacterized protein Sb06g029650 n=1 Tax=Sorghum bicolor RepID=C5YGM9_SORBI Length = 215 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -1 Query: 108 GGGGGGYGGGGRGG-GRGGGGGGCYNCGEFGHMARDC 1 GGGGGGYGGGG GG G GGGG CYNC + GH++RDC Sbjct: 174 GGGGGGYGGGGGGGYGGGGGGRECYNCHQEGHISRDC 210 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/40 (70%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = -1 Query: 111 YGGGGG---GYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGG G GGGG GG GGGG GC+ CGE GHMARDC Sbjct: 132 YGGGGDRGYGRGGGGGYGGGGGGGRGCFKCGEEGHMARDC 171 [32][TOP] >UniRef100_C0Z2E8 AT4G38680 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2E8_ARATH Length = 204 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/39 (76%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = -1 Query: 105 GGGGGYGGGGRG-GGRGGGGGG---CYNCGEFGHMARDC 1 G GGGYGGGG G GGRGGGG G CY CGE GHMARDC Sbjct: 106 GSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDC 144 [33][TOP] >UniRef100_B0L0X0 VASA n=1 Tax=Fenneropenaeus chinensis RepID=B0L0X0_FENCH Length = 712 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/45 (62%), Positives = 34/45 (75%), Gaps = 5/45 (11%) Frame = -1 Query: 120 EERYGGGGGGYGGGGR--GGGRGGGGGG---CYNCGEFGHMARDC 1 ++ +G GGGG+GG GR GGGRGGG GG C+ CG+ GHMARDC Sbjct: 56 DDAFGSGGGGFGGRGRSRGGGRGGGRGGSRACFKCGDEGHMARDC 100 [34][TOP] >UniRef100_B9GUE2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GUE2_POPTR Length = 184 Score = 63.2 bits (152), Expect = 9e-09 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGGR---GGGRGGGGGGCYNCGEFGHMARDC 1 G GG YGGGG GG GGGGGGCYNCGE GH ARDC Sbjct: 140 GDDGGRYGGGGGRRYSGGGGGGGGGCYNCGEEGHFARDC 178 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/40 (60%), Positives = 27/40 (67%), Gaps = 5/40 (12%) Frame = -1 Query: 105 GGGGGYGGGGRGGGRGGGGGG-----CYNCGEFGHMARDC 1 G GGGY GG GRG GGGG C+NCG +GH+ARDC Sbjct: 97 GRGGGYERGGHSRGRGYGGGGSSGGACFNCGRYGHLARDC 136 [35][TOP] >UniRef100_Q6YUR8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6YUR8_ORYSJ Length = 241 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -1 Query: 99 GGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGG G GG GGG GG GGGC+ CGE GHMARDC Sbjct: 142 GGGVGVGGGGGGGGGAGGGCFKCGEMGHMARDC 174 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 20/56 (35%) Frame = -1 Query: 108 GGGGGGYGGG--------------------GRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGGG GGG G GGG GGGGG CYNCGE GH+ARDC Sbjct: 151 GGGGGGAGGGCFKCGEMGHMARDCFNSGGGGGGGGGGGGGGACYNCGETGHLARDC 206 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGG---GGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGG YGG GGR G GG GGGC+ CGE GHMARDC Sbjct: 101 GGGGRSYGGSWGGGRRSGGGGPGGGCFKCGESGHMARDC 139 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 18/54 (33%) Frame = -1 Query: 108 GGGGGGY----------------GGGGRGGGRGGGGG--GCYNCGEFGHMARDC 1 GGGGGG GGGG GGGR GGGG CYNCGE GH+ARDC Sbjct: 186 GGGGGGACYNCGETGHLARDCYNGGGGGGGGRFGGGGDRSCYNCGEAGHIARDC 239 [36][TOP] >UniRef100_Q38896 Glycine-rich protein 2b n=2 Tax=Arabidopsis thaliana RepID=GRP2B_ARATH Length = 201 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGGG YG GG GGG GGGG CY+CGE GH ARDC Sbjct: 161 GGGGGRYGSGGGGGG-GGGGLSCYSCGESGHFARDC 195 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 5/41 (12%) Frame = -1 Query: 108 GGGGGGYGGG--GRG-GGRGGGGG--GCYNCGEFGHMARDC 1 G GGG YGGG GRG GGRGGGGG C+ CGE GHMAR+C Sbjct: 111 GRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMAREC 151 [37][TOP] >UniRef100_A8J4I2 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8J4I2_CHLRE Length = 200 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 114 RYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 R GGGGGG+GGGG GG GG CY CGE GH+ARDC Sbjct: 80 RGGGGGGGFGGGGGPGGPGGREMRCYECGEIGHIARDC 117 [38][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSS 121 SL+ P+ P L PPPPPP PPP PPPP PPPPPP SS Sbjct: 3055 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPPSSS 3093 [39][TOP] >UniRef100_A9SWE4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SWE4_PHYPA Length = 165 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -1 Query: 111 YGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGG G GG GGG GGGGG C+ CG+ GH AR+C Sbjct: 96 YGGGGGG-GRGGGGGGGGGGGGDCFKCGQPGHWAREC 131 [40][TOP] >UniRef100_UPI0000E47A48 PREDICTED: similar to HEXBP DNA binding protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E47A48 Length = 186 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/58 (51%), Positives = 31/58 (53%), Gaps = 21/58 (36%) Frame = -1 Query: 111 YGGGGGGYGGG---------------------GRGGGRGGGGGGCYNCGEFGHMARDC 1 YGGGGGG GGG RGGGRGGG CYNCGE GH+ARDC Sbjct: 21 YGGGGGGRGGGDRTCYNCGQPGHISRDCPQGDSRGGGRGGGDRSCYNCGEPGHIARDC 78 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/39 (64%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGG---GGRGGGRGGGGGGCYNCGEFGHMARDC 1 GGGG YG GG GGGRGGG CYNCG+ GH++RDC Sbjct: 10 GGGGSSYGNRSYGGGGGGRGGGDRTCYNCGQPGHISRDC 48 [41][TOP] >UniRef100_A9TVK2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TVK2_PHYPA Length = 349 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -1 Query: 105 GGGGGYGG---GGRGGGRGGGGGGCYNCGEFGHMARDC 1 GG GGYGG GG GGGRGGGG CY CG+ GH AR+C Sbjct: 239 GGAGGYGGNFGGGGGGGRGGGGRPCYTCGQEGHFAREC 276 [42][TOP] >UniRef100_UPI0000E7FF28 PREDICTED: similar to zinc-finger homeodomain protein 4 isoform 2 n=1 Tax=Gallus gallus RepID=UPI0000E7FF28 Length = 3618 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 SL+ P+ P L PPPPPP PPP PPPP PPPPPP S Sbjct: 3139 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPSSS 3176 [43][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 SL+ P+ P L PPPPPP PPP PPPP PPPPPP S Sbjct: 3053 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPSSS 3090 [44][TOP] >UniRef100_UPI0000ECD10B Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10B Length = 3578 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 SL+ P+ P L PPPPPP PPP PPPP PPPPPP S Sbjct: 3099 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPSSS 3136 [45][TOP] >UniRef100_O73590 Zinc finger homeobox protein 4 n=1 Tax=Gallus gallus RepID=ZFHX4_CHICK Length = 3573 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 SL+ P+ P L PPPPPP PPP PPPP PPPPPP S Sbjct: 3094 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPSSS 3131 [46][TOP] >UniRef100_A7NV84 Chromosome chr18 scaffold_1, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NV84_VITVI Length = 189 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGR--GGGGGGCYNCGEFGHMARDC 1 G GGGGY G GGG G GGG CYNCGE GH ARDC Sbjct: 147 GAGGGGYSAGAGGGGYSFGAGGGACYNCGEEGHFARDC 184 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = -1 Query: 108 GGGGGGYGGG-GRGGGRG-GGGGGCYNCGEFGHMARDC 1 GGGG G+ GG RGG G GGGG CYNCG GH+ARDC Sbjct: 81 GGGGRGFSGGRSRGGNDGYGGGGACYNCGRTGHLARDC 118 [47][TOP] >UniRef100_A7QDX1 Chromosome chr4 scaffold_83, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QDX1_VITVI Length = 157 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = -1 Query: 105 GGGGGYGGGGRGGGR--GGGGGGCYNCGEFGHMARDC 1 G G +GGGG GGG GGGGGGCYNCG+ GH AR+C Sbjct: 115 GSAGRFGGGGGGGGGRFGGGGGGCYNCGQEGHFAREC 151 [48][TOP] >UniRef100_C0KIF4 Vasa n=1 Tax=Strongylocentrotus purpuratus RepID=C0KIF4_STRPU Length = 766 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -1 Query: 117 ERYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 E GG GGG GG R GG GGGGG CY C E GHMARDC Sbjct: 121 ESGGGRGGGGFGGRREGGGGGGGGACYKCQEEGHMARDC 159 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/55 (49%), Positives = 29/55 (52%), Gaps = 17/55 (30%) Frame = -1 Query: 114 RYGGGGGGYG-----------------GGGRGGGRGGGGGGCYNCGEFGHMARDC 1 R GGGGGG G G GGGRGGG CYNCGE GHM+R+C Sbjct: 135 REGGGGGGGGACYKCQEEGHMARDCPNGDSSGGGRGGGDRSCYNCGETGHMSREC 189 [49][TOP] >UniRef100_B4FNK1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FNK1_MAIZE Length = 395 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 100 GGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 138 [50][TOP] >UniRef100_A9SBU8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SBU8_PHYPA Length = 198 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 G G GG G GG GG RGG GGG CYNCGE GHMARDC Sbjct: 117 GRGRGGRGSGGFGGERGGVGGGDRSCYNCGEGGHMARDC 155 [51][TOP] >UniRef100_C7EAA1 Vasa-like protein n=1 Tax=Haliotis asinina RepID=C7EAA1_9VEST Length = 763 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -1 Query: 111 YGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 +GG GG G GGRGG GGGG GC+ CGE GH +R+C Sbjct: 186 FGGRGGRGGRGGRGGSNGGGGSGCFKCGEEGHFSREC 222 [52][TOP] >UniRef100_C1E508 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E508_9CHLO Length = 867 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -1 Query: 105 GGGGGYGGGG-RGGGRGGGGGGCYNCGEFGHMARDC 1 GGGG YGGGG RGGG GG G C+ CG+ GH ARDC Sbjct: 795 GGGGQYGGGGGRGGGSGGKSGKCHKCGQLGHWARDC 830 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 111 YGG-GGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 YGG GGG+GGGG GGG GG G C+ CG+ GH RDC Sbjct: 753 YGGDAGGGWGGGGGGGGGGGQSGQCFTCGQTGHWTRDC 790 [53][TOP] >UniRef100_B9T6D3 Cellular nucleic acid binding protein, putative n=1 Tax=Ricinus communis RepID=B9T6D3_RICCO Length = 266 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/36 (69%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = -1 Query: 105 GGGGGYGGGGRGGGRGG-GGGGCYNCGEFGHMARDC 1 G GG GGGR GG+GG GGGGC+NCGE GH AR+C Sbjct: 227 GASGGGAGGGRFGGKGGSGGGGCFNCGEEGHFAREC 262 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 11/50 (22%) Frame = -1 Query: 117 ERYGGG------GGGYGGGG-----RGGGRGGGGGGCYNCGEFGHMARDC 1 +R GGG GGG+GG R GGGGGGCYNCG GH+AR+C Sbjct: 95 KRGGGGDGPAKRGGGFGGSWSSSSTRRNNNGGGGGGCYNCGGSGHIAREC 144 [54][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 +CP P + PPPPPP PPP PPPP PPPPPP Sbjct: 128 VCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPP 159 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 131 PPPPMCAPPPPPPPPPPPPPPPPPPPPPPP 160 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 MC P PPPPPP PPP PPPP PPPPPP Sbjct: 135 MCAPPPP---PPPPPPPPPPPPPPPPPPPPPP 163 [55][TOP] >UniRef100_C6TFM2 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TFM2_SOYBN Length = 170 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -1 Query: 108 GGGGGGYGGGGRGG-GRGGGGGGCYNCGEFGHMARDC 1 GGGG G GGG GG GR GGG CYNCG GH+ARDC Sbjct: 84 GGGGRGIGGGRGGGFGRRGGGPECYNCGRIGHLARDC 120 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/39 (61%), Positives = 27/39 (69%), Gaps = 4/39 (10%) Frame = -1 Query: 105 GGGGGYGGGGR----GGGRGGGGGGCYNCGEFGHMARDC 1 GGGGG G GR GGG GGGG GC+NCGE G+ R+C Sbjct: 125 GGGGGVDGDGRNRRRGGGGGGGGRGCFNCGEEGYFVREC 163 [56][TOP] >UniRef100_B9N668 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N668_POPTR Length = 187 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 3/37 (8%) Frame = -1 Query: 102 GGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 GGGG GGGGRGGGRG GG CY CGE GH AR+C Sbjct: 74 GGGGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC 110 [57][TOP] >UniRef100_Q9SJA6 Putative RSZp22 splicing factor n=1 Tax=Arabidopsis thaliana RepID=Q9SJA6_ARATH Length = 196 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 5/46 (10%) Frame = -1 Query: 123 VEERYGGGGGGYGGGGRGGGRGGGGGG-----CYNCGEFGHMARDC 1 VE+ + GGGG GGGRGGG GG G G CY CGE GH AR+C Sbjct: 66 VEQSHNRGGGGGRGGGRGGGDGGRGRGGSDLKCYECGESGHFAREC 111 [58][TOP] >UniRef100_Q6PGC9 Zinc finger protein 341 n=1 Tax=Mus musculus RepID=Q6PGC9_MOUSE Length = 846 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 SL M P L QPPPPPP PPP PPPP PPPPPP Sbjct: 165 SLNMHPVPNYLTQPPPPPPPPPPLPPPPQPPPPPP 199 [59][TOP] >UniRef100_A2AVM0 Zinc finger protein 341 n=1 Tax=Mus musculus RepID=A2AVM0_MOUSE Length = 839 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 SL M P L QPPPPPP PPP PPPP PPPPPP Sbjct: 165 SLNMHPVPNYLTQPPPPPPPPPPLPPPPQPPPPPP 199 [60][TOP] >UniRef100_UPI00019829E9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019829E9 Length = 182 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGG-GCYNCGEFGHMARDC 1 GGGGGG GGGGR GRGGG CY CGE GH AR+C Sbjct: 74 GGGGGGGGGGGRDRGRGGGEDLKCYECGEPGHFAREC 110 [61][TOP] >UniRef100_A5BHG0 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BHG0_VITVI Length = 318 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGG-GCYNCGEFGHMARDC 1 GGGGGG GGGGR GRGGG CY CGE GH AR+C Sbjct: 189 GGGGGGGGGGGRDRGRGGGEDLKCYECGEPGHFAREC 225 [62][TOP] >UniRef100_Q9V3V0 Xl6 n=1 Tax=Drosophila melanogaster RepID=Q9V3V0_DROME Length = 258 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 8/46 (17%) Frame = -1 Query: 114 RYGGGGGGYGGGGRGGGRGG---GGGG-----CYNCGEFGHMARDC 1 R GGGGGG GGGG GGG GG GGGG CY CG GH AR C Sbjct: 85 RSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHC 130 [63][TOP] >UniRef100_Q9AXN2 RNA-binding protein n=1 Tax=Triticum aestivum RepID=Q9AXN2_WHEAT Length = 183 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = -1 Query: 111 YGGGGGGYGGG-----GRGGGRGGGGGGCYNCGEFGHMARDC 1 Y GGG YGGG GRGGGRGGGG CY CG+ GH AR+C Sbjct: 98 YRGGGDRYGGGRDFGGGRGGGRGGGGD-CYKCGKPGHFAREC 138 [64][TOP] >UniRef100_Q2QKC3 Pre-mRNA processing factor n=1 Tax=Triticum aestivum RepID=Q2QKC3_WHEAT Length = 194 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GG GGG GGGG G GRGG CY CGE GH AR+C Sbjct: 77 GGRGGGGGGGGGGRGRGGSDMKCYECGESGHFAREC 112 [65][TOP] >UniRef100_C9S6J1 Cellular nucleic acid-binding protein n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S6J1_9PEZI Length = 189 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 4/40 (10%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG----CYNCGEFGHMARDC 1 GG GGGYGGG GG GGGG G CY+CG FGHM+RDC Sbjct: 105 GGFGGGYGGGA-GGYSGGGGYGAPKTCYSCGGFGHMSRDC 143 [66][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 17 CPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 CP P PPPPPP PPP PPPP PPPPPP Sbjct: 67 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P +P+ PPPPPP PPP PPPP PPPPPP Sbjct: 16 PIAPERIIPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP R Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P+ PPPPPP PPP PPPP PPPPPP Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP R Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPPP 89 [67][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 17 CPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 CP P PPPPPP PPP PPPP PPPPPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+ P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [68][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 17 CPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 CP P PPPPPP PPP PPPP PPPPPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+ P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [69][TOP] >UniRef100_O81126 9G8-like SR protein n=1 Tax=Arabidopsis thaliana RepID=O81126_ARATH Length = 200 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = -1 Query: 117 ERYGGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 ER GGG GG GGG GGGRGG GG CY CGE GH AR+C Sbjct: 74 ERGGGGRGGDRGGG-GGGRGGRGGSDLKCYECGETGHFAREC 114 [70][TOP] >UniRef100_Q6TEC0 Vasa-like protein n=1 Tax=Crassostrea gigas RepID=Q6TEC0_CRAGI Length = 758 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 4/39 (10%) Frame = -1 Query: 105 GGGGGYGGGGR---GGGRGGGGG-GCYNCGEFGHMARDC 1 G GGG+GGG R GGG GGGGG GC NCGE GH AR+C Sbjct: 135 GFGGGFGGGDRPPRGGGFGGGGGSGCRNCGEEGHFAREC 173 [71][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 +P + QPPPPPP PPP PPPP PPPPPP Sbjct: 315 TPDVEQPPPPPPPPPPPPPPPPPPPPPP 342 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+ Q PPPPPP PPP PPPP PPPPPP Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 [72][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 M +P L PPPPPP PPP PPPP PPPPPP Sbjct: 1467 MARETPPLPPPPPPPPPPPPPPPPPPPPPPPP 1498 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1472 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 1501 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1502 [73][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 S P SP PPPPPP PPP PPPP PPPPPP Sbjct: 371 SFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPY 112 PPPPPP PPP PPPP PPPPPPY Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPY 408 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+ P PPPPPP PPP PPPP PPPPPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 [74][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P L PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 17 CPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 CP P P PPPP PPP PPPP PPPPPP Sbjct: 21 CPPPPPPPPPLPPPPPPPPPPPPPPPPPPPP 51 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 [75][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP+R Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHR 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 [76][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSST 124 P P PPPPPP PPP PPPP PPPPPP R T Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQT 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [77][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 PPPPPP PPP PPPP PPPPPP ++S T Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPKKTSDT 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 PPPPPP PPP PPPP PPPPPP T+ Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPKKTS 70 [78][TOP] >UniRef100_Q94C69 Putative glycine-rich, zinc-finger DNA-binding protein n=1 Tax=Arabidopsis thaliana RepID=Q94C69_ARATH Length = 301 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -1 Query: 114 RYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 R G GG YGGGG GRG GG GCY CG GH ARDC Sbjct: 177 RGGSGGNRYGGGG---GRGSGGDGCYMCGGVGHFARDC 211 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -1 Query: 105 GGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GG GG GG GG R GG G CY CG+ GH ARDC Sbjct: 111 GGSGGKSFGGGGGRRSGGEGECYMCGDVGHFARDC 145 [79][TOP] >UniRef100_A8JAG8 Argonaute-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JAG8_CHLRE Length = 1037 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 114 RYGGGGGGYGGGGRGGGRGGGGGGCYNCG 28 R GGGGGGYGGGG GGGRGGGGGG Y G Sbjct: 48 RGGGGGGGYGGGGGGGGRGGGGGGGYGGG 76 [80][TOP] >UniRef100_Q2WBX4 Vasa protein isoform n=1 Tax=Platynereis dumerilii RepID=Q2WBX4_PLADU Length = 732 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = -1 Query: 114 RYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 R GG G GGGG GGG GGG GC+ CGE GH +R+C Sbjct: 162 RGGGFGSSGGGGGFGGGGSGGGKGCFKCGEEGHFSREC 199 [81][TOP] >UniRef100_A7T8H9 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis RepID=A7T8H9_NEMVE Length = 624 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GG GGG+GGG GG GG GC CGE GH ARDC Sbjct: 14 GGSGGGFGGGRSFGGGSHGGDGCRKCGESGHFARDC 49 [82][TOP] >UniRef100_C0SCG6 Cellular nucleic acid-binding protein n=2 Tax=Paracoccidioides brasiliensis RepID=C0SCG6_PARBP Length = 190 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 8/39 (20%) Frame = -1 Query: 93 GYGGGGRGGGRGGGGGG--------CYNCGEFGHMARDC 1 GYG GG GGG GG GGG CY+CG FGHMARDC Sbjct: 108 GYGSGGYGGGAGGYGGGYGGNRQQTCYSCGGFGHMARDC 146 [83][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 [84][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 [85][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 1492 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 1520 [86][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 1488 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 1516 [87][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 1488 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 1516 [88][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 [89][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 [90][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 [91][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 [92][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 [93][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 [94][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP +T+ Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 [95][TOP] >UniRef100_C6HQM3 F-box protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6HQM3_AJECH Length = 857 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 4/40 (10%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG----CYNCGEFGHMARDC 1 G G GGYGG GG GG GGG CY+CG +GHMARDC Sbjct: 774 GYGSGGYGGATGGGYSGGYGGGRQQTCYSCGGYGHMARDC 813 [96][TOP] >UniRef100_C0NYF8 Zinc knuckle domain-containing protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NYF8_AJECG Length = 184 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 4/40 (10%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG----CYNCGEFGHMARDC 1 G G GGYGG GG GG GGG CY+CG +GHMARDC Sbjct: 101 GYGSGGYGGATGGGYSGGYGGGRQQTCYSCGGYGHMARDC 140 [97][TOP] >UniRef100_A6QXE9 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus NAm1 RepID=A6QXE9_AJECN Length = 191 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 27/40 (67%), Gaps = 4/40 (10%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG----CYNCGEFGHMARDC 1 G G GGYGG GG GG GGG CY+CG +GHMARDC Sbjct: 108 GYGSGGYGGATGGGYSGGYGGGRQQTCYSCGGYGHMARDC 147 [98][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPPRPPP PPPP PPPPPP Sbjct: 336 PPPPPPRPPPPPPPPPPPPPPP 357 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPPRPPP PPPP PPPPPP Sbjct: 783 PPPPPPRPPPPPPPPPPPPPPP 804 [99][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP PPPPPP PPP PPPP PPPPPP Sbjct: 171 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+ P PPPPPP PPP PPPP PPPPPP Sbjct: 172 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 166 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 195 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 198 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 [100][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP PPPPPP PPP PPPP PPPPPP Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 17 CPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 CP P PPPPPP PPP PPPP PPPPPP Sbjct: 357 CPPPPP--PPPPPPPPPPPPPPPPSPPPPPP 385 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+ P PPPPPP PPP PPPP PPPPPP Sbjct: 378 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 390 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 401 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSS 121 P P PPPPPP PPP PPPP PPPPPP +S Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPAS 413 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 [101][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPPRPPP PPPP PPPPPP Sbjct: 20 PPPPPPRPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P +PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPRPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPRPPPPPPPPPPPPPPPPPPPPPPP 49 [102][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP PPPPPP PPP PPPP PPPPPP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPY 112 P SP PPPPPP PPP PPPP PPPPP Y Sbjct: 274 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPVY 304 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPP PPP PPPP PPPPPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPP 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 [103][TOP] >UniRef100_A7R244 Chromosome undetermined scaffold_398, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R244_VITVI Length = 822 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPPRPPP PPPP PPPPPP Sbjct: 336 PPPPPPRPPPPPPPPPPPPPPP 357 [104][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 P P PPPPPP PPP PPPP PPPPPP R+ Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRA 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [105][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P P PPPPPP PPP PPPP PPPPPP TT Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTT 50 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P P PPPPPP PPP PPPP PPPPPP ++ T Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRT 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [106][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP R Sbjct: 71 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQR 102 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P L PPPPPP PPP PPPP PPPPPP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 [107][TOP] >UniRef100_Q4JF01 Vasa homlogue n=1 Tax=Platynereis dumerilii RepID=Q4JF01_PLADU Length = 712 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 13/49 (26%) Frame = -1 Query: 108 GGGGGGYGGG--------GRGGGRGGGGG-----GCYNCGEFGHMARDC 1 GGGGGG+GG G GGG GGGGG GC+ CGE GH +R+C Sbjct: 153 GGGGGGFGGSRGGGFGSSGGGGGFGGGGGSGGGKGCFKCGEEGHFSREC 201 [108][TOP] >UniRef100_B5X0E7 Vasa (Fragment) n=1 Tax=Capitella sp. I Grassle & Grassle, 1976 RepID=B5X0E7_9ANNE Length = 516 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 6/41 (14%) Frame = -1 Query: 105 GGGGGYGG-----GGRGGGRGGGGG-GCYNCGEFGHMARDC 1 GGGGG+GG GG GG GGGGG GC CGE GH AR+C Sbjct: 100 GGGGGFGGSSGGGGGFGGSSGGGGGSGCRKCGEEGHFAREC 140 [109][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P +P PPPPPP PPP PPPP PPPPPP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPP 880 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 883 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 M P PPPPPP PPP PPPP PPPPPP Sbjct: 846 MVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPP 877 [110][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 2342 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2370 [111][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 1280 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 1308 [112][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 2342 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2370 [113][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 2345 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2373 [114][TOP] >UniRef100_UPI0001A2D80C UPI0001A2D80C related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D80C Length = 815 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPP 106 PN P PPPPPP PPP PPPP PPPPP Sbjct: 276 PNGPSAALPPPPPPPPPPPPPPPPPPPPP 304 [115][TOP] >UniRef100_UPI0000DC0BBF UPI0000DC0BBF related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DC0BBF Length = 116 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +2 Query: 23 NSPQL*QPPPPPPRPPPRPPPP*PPPPP 106 +SP+ QPPPPPP PPP PPPP PPPPP Sbjct: 88 SSPKTNQPPPPPPPPPPPPPPPPPPPPP 115 [116][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 2404 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2432 [117][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 2404 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2432 [118][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +2 Query: 8 LAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 LA C ++ PPPPPP PPP PPPP PPPPPP Sbjct: 221 LAECLDAAGFAPPPPPPPPPPPPPPPPPPPPPPP 254 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP++ Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQ 263 [119][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 +P PPPPPP PPP PPPP PPPPPP TT Sbjct: 230 APPAPPPPPPPPPPPPPPPPPPPPPPPPPPEETT 263 [120][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 S A P P PPPPPP PPP PPPP PPPPPP Sbjct: 302 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [121][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSS 121 P P PPPPPP PPP PPPP PPPPPP +S Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVETS 502 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 SP PPPPPP PPP PPPP PPPPPP Sbjct: 467 SPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 [122][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 S A P P PPPPPP PPP PPPP PPPPP Y + Sbjct: 255 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAYEA 292 [123][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP PPPPPP PPP PPPP PPPPPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+ P PPPPPP PPP PPPP PPPPPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P L PPPPPP PPP PPPP PPPPPP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPY 112 P P PPPPPP PPP PPPP PPPPPP+ Sbjct: 673 PPLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P L PPPPP PPP PPPP PPPPPP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 [124][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +2 Query: 2 QSLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 Q + P P PPPPPP PPP PPPP PPPPPP Sbjct: 45 QPICCVPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 [125][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P P PPPPPP PPP PPPP PPPPPP R T+ Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 [126][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP R Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQR 108 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 [127][TOP] >UniRef100_A0BLV2 Chromosome undetermined scaffold_115, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BLV2_PARTE Length = 1084 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 7/43 (16%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPR-------PPPP*PPPPPPYRSSTT 127 PN PQ+ PPPPPP PPP PPPP PPPPPP S T Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLT 583 [128][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 [129][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 P P PPPPPP PPP PPPP PPPPPP R+ Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRA 61 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 SL P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP R Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [130][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 [131][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 QPPPPPP PPP PPPP PPPPPP T+ Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 [132][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 344 PQPPAAQAPPPPPPPPPPPPPPPPPPPPPP 373 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P + Q PPPPPP PPP PPPP PPPPPP ++T Sbjct: 346 PPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPAST 381 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P Q PPPPP PPP PPPP PPPPPP Sbjct: 343 PPQPPAAQAPPPPPPPPPPPPPPPPPPPPP 372 [133][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P L PPPPPP PPP PPPP PPPPPP Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 PPPPPP PPP PPPP PPPPPP + T Sbjct: 146 PPPPPPPPPPPPPPPPPPPPPPPKPPKT 173 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 [134][TOP] >UniRef100_UPI0000E23E7D PREDICTED: WAS protein homology region 2 domain containing 1 n=1 Tax=Pan troglodytes RepID=UPI0000E23E7D Length = 813 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRS 118 PPPPPP PPP PPPP PPPPPP R+ Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPLRA 665 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 23 NSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 +S +L PPPPPP PPP PPPP PPPPPP Sbjct: 632 SSEELSLPPPPPPPPPPPPPPPPPPPPPP 660 [135][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P P PPPPPP PPP PPPP PPPPPP S T Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPIT 540 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 [136][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+S PPPPPP PPP PPPP PPPPPP Sbjct: 1531 PSSSSSPSPPPPPPPPPPPPPPPPPPPPPP 1560 [137][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPP 109 QPPPPPP PPP PPPP PPPPPP Sbjct: 99 QPPPPPPPPPPPPPPPPPPPPPP 121 [138][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSST 124 P P PPPPPP PPP PPPP PPPPPP ST Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPST 531 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 + P P PPPPPP PPP PPPP PPPPPP Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 [139][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P P PPPPPP PPP PPPP PPPPPP TT Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPRFTT 153 [140][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 11 AMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 AM +P PPPPPP PPP PPPP PPPPPP Sbjct: 70 AMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP R Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 115 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP R Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 114 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 [141][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +2 Query: 2 QSLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPY 112 Q L P P PPPPPP PPP PPPP PPPP PY Sbjct: 33 QCLCCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAPY 69 [142][TOP] >UniRef100_A4H3P3 Putative uncharacterized protein n=1 Tax=Leishmania braziliensis RepID=A4H3P3_LEIBR Length = 1295 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/29 (68%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -3 Query: 124 GGGAIW-WWRRRLWWWWTWR-RTWWRRRW 44 GGG W WWR R WWWW WR WWRRRW Sbjct: 1261 GGGGRWRWWRWRWWWWWWWRWWWWWRRRW 1289 [143][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPY 112 P P PPPPPP PPP PPPP PPPPPP+ Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPF 300 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 [144][TOP] >UniRef100_UPI0000E468D6 PREDICTED: similar to laminin alpha chain n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E468D6 Length = 3053 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGGCYNCGE 25 GGGGGG GGGG GGG GGGGGGCY+ G+ Sbjct: 1944 GGGGGGGGGGGGGGGGGGGGGGCYSGGD 1971 [145][TOP] >UniRef100_O23646 RSZp22 protein n=1 Tax=Arabidopsis thaliana RepID=O23646_ARATH Length = 200 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -1 Query: 117 ERYGGGGGGYGGGGRGGGRGGGGGG---CYNCGEFGHMARDC 1 ER GGG GG GGG G GRGG GG CY CGE GH AR+C Sbjct: 74 ERGGGGRGGDRGGG-GAGRGGRGGSDLKCYECGETGHFAREC 114 [146][TOP] >UniRef100_A9S1L9 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9S1L9_PHYPA Length = 187 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 12/47 (25%) Frame = -1 Query: 105 GGGGGYGGGG-RGGGRGGGGGG-----------CYNCGEFGHMARDC 1 GGG G+GG G RG GRGG G G CYNCGE GH+ARDC Sbjct: 101 GGGRGFGGSGARGRGRGGRGSGGFGGVGGGDRPCYNCGEGGHIARDC 147 [147][TOP] >UniRef100_C0KIF0 Vasa n=1 Tax=Asterias forbesi RepID=C0KIF0_ASTFO Length = 715 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 111 YGGGGGGYGG-GGRGGGRGGGGGGCYNCGEFGHMARDC 1 +GG G GG GG GGG GGGGG CY C E GH AR+C Sbjct: 98 FGGSKGRSGGFGGGGGGDGGGGGECYKCHETGHFAREC 135 [148][TOP] >UniRef100_B4J8X0 GH19908 n=1 Tax=Drosophila grimshawi RepID=B4J8X0_DROGR Length = 484 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -1 Query: 126 VVEERYGGGGGGYGGGGRGGGRGGGGGGCYNCGEFGH 16 + E+ +G GGGG GGGG GGG GGG GG Y+ G GH Sbjct: 89 ITEDHHGHGGGGGGGGGHGGGHGGGHGGGYSAGGHGH 125 [149][TOP] >UniRef100_B0W4N4 Putative uncharacterized protein n=1 Tax=Culex quinquefasciatus RepID=B0W4N4_CULQU Length = 160 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 7/43 (16%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRG---GGGGG----CYNCGEFGHMARDC 1 GGGGGG GG RGGG GGGGG CY C + GH ARDC Sbjct: 24 GGGGGGRPGGPRGGGERREFGGGGGRREKCYKCNQMGHFARDC 66 [150][TOP] >UniRef100_UPI0000F202B4 PREDICTED: similar to tubby like protein 4 n=1 Tax=Danio rerio RepID=UPI0000F202B4 Length = 1606 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P L PPPPPP PPP PPPP PPPPPP Sbjct: 1331 PVLSPPPPPPPPPPPPPPPPLPPPPPP 1357 [151][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 SL P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP R Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [152][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P Q+ PPPPPP PPP PPPP PPPPPP Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 [153][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 2 QSLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 +S+ P P PPPPPP PPP PPPP PPPPPP Sbjct: 647 RSVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 [154][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 2 QSLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 QS A P PPPPPP PPP PPPP PPPPPP Sbjct: 53 QSAAPAQARPTPPPPPPPPPPPPPPPPPPPPPPPPP 88 [155][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPP PPP PPPP PPPPPP Sbjct: 100 PPPPPPPPPPSPPPPPPPPPPP 121 [156][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 11 AMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 A+ P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 AVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP + Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVK 76 [157][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 11 AMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 A+ P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 AVNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P P PPPPPP PPP PPPP PPPPPP + Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIK 76 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 [158][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P +P PPPPPP PPP PPPP PPPPPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 8 LAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 L P P PPPPPP PPP PPPP PPPPPP Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPP 86 [159][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 P P PPPPPP PPP PPPP PPPPPP +S Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [160][TOP] >UniRef100_B7PLD9 Circumsporozoite protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PLD9_IXOSC Length = 188 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P+ PPPPPP PPP PPPP PPPPPP S T Sbjct: 22 PRSETPPPPPPPPPPPPPPPPPPPPPPAPPSET 54 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 PPPPPP PPP PPPP PPPPP S TT Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPAPPSETT 55 [161][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPY 112 P P PPPPPP PPP PPPP PPPPPP+ Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [162][TOP] >UniRef100_B6AF23 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AF23_9CRYT Length = 876 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P L PPPPPP PPP PPPP PPPP + SS+T Sbjct: 187 PPLHPPPPPPPPPPPPPPPPPPPPPSSHSSSST 219 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 P P PPPPPP PPP PPPP PPPPP SS++ Sbjct: 183 PLYPPPLHPPPPPPPPPPPPPPPPPPPPPSSHSSSS 218 [163][TOP] >UniRef100_B4P1N6 GE19123 (Fragment) n=1 Tax=Drosophila yakuba RepID=B4P1N6_DROYA Length = 391 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = +2 Query: 14 MCPNSPQL*QPPP---PPPRPPPRPPPP*PPPPPP 109 +CP PQ PP P P+PPPRPPPP PPPPPP Sbjct: 200 LCPRPPQYYPPPSSNRPKPKPPPRPPPPPPPPPPP 234 [164][TOP] >UniRef100_B4M7B5 GJ16487 n=1 Tax=Drosophila virilis RepID=B4M7B5_DROVI Length = 880 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 PPPPPP PPP PPPP PPPPPP S+++ Sbjct: 186 PPPPPPPPPPPPPPPPPPPPPPPESASS 213 [165][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPP 106 P P L PPPPPP PPP PPPP PPPPP Sbjct: 311 PPPPPLPSPPPPPPTPPPPPPPPPPPPPP 339 [166][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 + P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 LLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [167][TOP] >UniRef100_UPI0000122A7F Hypothetical protein CBG13587 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000122A7F Length = 148 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -1 Query: 129 DVVEERYGGGGGGYGGGGRGGGRGG-GGGGCYNCGEFGHMARDC 1 D R GG YGGG RGGGRGG GG CYNCG GH++R+C Sbjct: 77 DCPSARDDGGSRSYGGG-RGGGRGGYGGQKCYNCGRNGHISREC 119 [168][TOP] >UniRef100_Q5Z9D5 Os06g0553200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5Z9D5_ORYSJ Length = 186 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 126 VVEERYGGGGGGYGGGGRGGGRGGGGGGCYN 34 V E+++GGGGGGYGGGG GG GGGGGG Y+ Sbjct: 33 VAEKKFGGGGGGYGGGGGGGYGGGGGGGGYS 63 [169][TOP] >UniRef100_C4MLW6 Vasa protein n=1 Tax=Parhyale hawaiensis RepID=C4MLW6_9CRUS Length = 707 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 5/42 (11%) Frame = -1 Query: 111 YGGGG---GGYGGGGRGGGRGGGGG--GCYNCGEFGHMARDC 1 YG G GG+GGGGRG GRGG GG GC CGE GH A +C Sbjct: 28 YGSGSRGRGGFGGGGRGRGRGGRGGSTGCRKCGEEGHRAFEC 69 [170][TOP] >UniRef100_B7P029 Vasa n=1 Tax=Chlamys farreri RepID=B7P029_9BIVA Length = 801 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 15/52 (28%) Frame = -1 Query: 111 YGGGGGGYG-----GGG-------RGGGRGGGGG---GCYNCGEFGHMARDC 1 +G GGGG+G GGG RGGG GGGGG GC+ CGE GH AR+C Sbjct: 132 FGRGGGGFGKGSGDGGGFGSDRPPRGGGFGGGGGSSSGCHKCGEDGHFAREC 183 [171][TOP] >UniRef100_A8XI91 Putative uncharacterized protein n=1 Tax=Caenorhabditis briggsae RepID=A8XI91_CAEBR Length = 156 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/44 (59%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = -1 Query: 129 DVVEERYGGGGGGYGGGGRGGGRGG-GGGGCYNCGEFGHMARDC 1 D R GG YGGG RGGGRGG GG CYNCG GH++R+C Sbjct: 85 DCPSARDDGGSRSYGGG-RGGGRGGYGGQKCYNCGRNGHISREC 127 [172][TOP] >UniRef100_UPI00017C348A PREDICTED: zinc finger protein 341 n=1 Tax=Bos taurus RepID=UPI00017C348A Length = 853 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 +L M P L QPPPPPP PPP PPPP P PPPP Sbjct: 171 NLNMHPAPNYLAQPPPPPPPPPPLPPPPPPQPPPP 205 [173][TOP] >UniRef100_UPI000195134F UPI000195134F related cluster n=1 Tax=Bos taurus RepID=UPI000195134F Length = 854 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 +L M P L QPPPPPP PPP PPPP P PPPP Sbjct: 165 NLNMHPAPNYLAQPPPPPPPPPPLPPPPPPQPPPP 199 [174][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 PPPPPP PPP PPPP PPPPPP TT Sbjct: 223 PPPPPPPPPPPPPPPPPPPPPPPPPPTT 250 [175][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSST 124 P P PPPPPP PPP PPPP PPPPPP S T Sbjct: 1426 PPPPPPPPPPPPPPTPPPAPPPP-PPPPPPISSGT 1459 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = +2 Query: 8 LAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 L + P PPPPPP PPP PPPP PPPPPP Sbjct: 1400 LTLTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPP 1433 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 [176][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 239 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPP PPP PPPP PPPPPP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPP 227 [177][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+SP PPPPP PPP PPPP PPPPPP Sbjct: 232 PSSPSPSPRPPPPPMPPPPPPPPPPPPPPP 261 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPP 271 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 [178][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 [179][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 M P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 MEPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSS 121 P P PPPPPP PPP PPPP PPPPPP + S Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [180][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1208 PPPPSPPPPPPPPPPPPPLPPPPSPPPPPP 1237 [181][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 + P P PPPPPP PPP PPPP PPPPPP Sbjct: 70 LTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [182][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSS 121 P P PPPPPP PPP PPPP PPPPPP S Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGS 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [183][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 11 AMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 A P P PPPPPP PPP PPPP PPPPPP Sbjct: 42 AHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [184][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 PPPPPP PPP PPPP PPPPPP S T Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPSVT 527 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+S PPPPPP PPP PPPP PPPPPP Sbjct: 494 PSSTPPPPPPPPPPPPPPPPPPPPPPPPPP 523 [185][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPP--RPPPP*PPPPPP 109 P+S L QPPPPPP PPP PPPP PPPPPP Sbjct: 146 PSSAPLPQPPPPPPPPPPASAPPPPPPPPPPP 177 [186][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 14 MCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 + P P PPPPPP PPP PPPP PPPPPP Sbjct: 983 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1014 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 PN PPPPPP PPP PPPP PPPPPP Sbjct: 980 PNGLSPPPPPPPPPPPPPPPPPPPPPPPPP 1009 [187][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP+ PPPP P PPP PPPP PPPPPP Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPP 274 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 [188][TOP] >UniRef100_B9T7V5 Arginine/serine-rich splicing factor, putative n=1 Tax=Ricinus communis RepID=B9T7V5_RICCO Length = 184 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = -1 Query: 102 GGGGYGGGGRGGGRGGGGGG--CYNCGEFGHMARDC 1 GGGG GGG GGGRG GG CY CGE GH AR+C Sbjct: 74 GGGGRGGGSGGGGRGRGGEDMKCYECGEPGHFAREC 109 [189][TOP] >UniRef100_C5FRH2 Zinc knuckle domain-containing protein n=1 Tax=Microsporum canis CBS 113480 RepID=C5FRH2_NANOT Length = 185 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/41 (58%), Positives = 26/41 (63%), Gaps = 5/41 (12%) Frame = -1 Query: 108 GGGGGGYGGGGRGGGRGGGGGG-----CYNCGEFGHMARDC 1 G G GGYG G G GGGG G CY+CG +GHMARDC Sbjct: 110 GYGSGGYGNSGSGSYGGGGGYGGRSQTCYSCGGYGHMARDC 150 [190][TOP] >UniRef100_Q4TB69 Chromosome 11 SCAF7190, whole genome shotgun sequence n=1 Tax=Tetraodon nigroviridis RepID=Q4TB69_TETNG Length = 452 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +2 Query: 2 QSLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPP 106 +SLA+ ++ PPPPPP PPP PPPP PPPPP Sbjct: 338 RSLALMRQKRRMSSPPPPPPLPPPPPPPPPPPPPP 372 [191][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P L PPPPPP PPP PPPP PPPPPP Sbjct: 209 PPPPPL--PPPPPPPPPPSPPPPSPPPPPP 236 [192][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP PPPPPP PPP PPPP PPPP P Sbjct: 305 PPSPPPPSPPPPPPSPPPSPPPPSPPPPSP 334 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP PPPPPP PPP PPPP PPPP P Sbjct: 361 PPSPPPPSPPPPPPSPPPSPPPPSPPPPSP 390 [193][TOP] >UniRef100_Q1GRM3 OmpA/MotB n=1 Tax=Sphingopyxis alaskensis RepID=Q1GRM3_SPHAL Length = 373 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 +P+ PPPPPP PPP PPPP PPPPPP Sbjct: 226 APEPVAPPPPPPPPPPPPPPPPPPPPPP 253 [194][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 [195][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 224 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 253 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 [196][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP PPPPPP PPP PPPP PPPPPP Sbjct: 224 PPSP----PPPPPPPPPPSPPPPPPPPPPP 249 [197][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYR 115 P SP PPPPPP PP PPPP PPPPPP R Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPR 283 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 20 PNSPQL*QPPPPPPR-PPPRPPPP*PPPPPP 109 P+ P PPPPPPR PPP PPPP PPPPPP Sbjct: 305 PSPPPPSPPPPPPPRPPPPSPPPPSPPPPPP 335 [198][TOP] >UniRef100_C5YU09 Putative uncharacterized protein Sb08g008380 n=1 Tax=Sorghum bicolor RepID=C5YU09_SORBI Length = 149 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 41 QPPPPPPRPPPRPPPP*PPPPPPYRSS 121 +PPPPPP PPP PPPP PPPPPP S Sbjct: 8 RPPPPPPPPPPPPPPPPPPPPPPLSPS 34 [199][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [200][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P SP PPPPPP PPP PPPP PPPPPP Sbjct: 256 PPSP----PPPPPPSPPPPPPPPPPPPPPP 281 [201][TOP] >UniRef100_Q5CS67 Signal peptide containing large protein with proline stretches n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CS67_CRYPV Length = 1884 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRS 118 PPPPPP PPP PPPP PPPPP Y S Sbjct: 1180 PPPPPPPPPPPPPPPPPPPPPSYTS 1204 [202][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 [203][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [204][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [205][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 [206][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [207][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P PPPPPP PPP PPPP PPPPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 [208][TOP] >UniRef100_B3M2B3 GF17078 n=1 Tax=Drosophila ananassae RepID=B3M2B3_DROAN Length = 599 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPY 112 PPPPPP PPP PPPP PPPPPP+ Sbjct: 160 PPPPPPPPPPPPPPPPPPPPPPH 182 [209][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 4/37 (10%) Frame = +2 Query: 11 AMCPNSPQL*QPPPPPPR----PPPRPPPP*PPPPPP 109 A P SP L PPPPPP PPP PPPP PPPPPP Sbjct: 216 APSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPPPP 252 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P QPPPPP PPP PPPP PPPPPP Sbjct: 56 PPPPPPSQPPPPPSSPPPPPPPPSPPPPPP 85 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P L PPPPPP PPP PPPP PPPPPP Sbjct: 135 PPPPPLLSPPPPPPSPPP-PPPPSPPPPPP 163 [210][TOP] >UniRef100_Q966I7 Putative uncharacterized protein n=1 Tax=Caenorhabditis elegans RepID=Q966I7_CAEEL Length = 151 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -1 Query: 96 GGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 GG GGG RGGG GGGG CYNCG GH +RDC Sbjct: 53 GGSGGGQRGGG--GGGGSCYNCGGRGHYSRDC 82 [211][TOP] >UniRef100_Q4JG17 Vasa-like protein n=1 Tax=Litopenaeus vannamei RepID=Q4JG17_LITVA Length = 703 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -1 Query: 105 GGGGGYGGGGRGGGRGGGGGGCYNCGEFGHMARDC 1 G G G G G RGG R GG GC+ CGE GHM+RDC Sbjct: 145 GFGFGSGSGSRGGRRNDGGRGCFKCGEEGHMSRDC 179 [212][TOP] >UniRef100_Q8T8R1 CCHC-type zinc finger protein CG3800 n=1 Tax=Drosophila melanogaster RepID=Y3800_DROME Length = 165 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 10/46 (21%) Frame = -1 Query: 108 GGGGGGYGGGGRGGG---RGGGGGG-------CYNCGEFGHMARDC 1 GGG GG GGGG GGG RG GGG CY C +FGH AR C Sbjct: 25 GGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARAC 70 [213][TOP] >UniRef100_UPI0001926BAB PREDICTED: similar to mini-collagen n=1 Tax=Hydra magnipapillata RepID=UPI0001926BAB Length = 149 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +2 Query: 8 LAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 L +C +P PPPPPP PPP PPPP PPPPPP Sbjct: 44 LQVCCMAP----PPPPPPPPPPPPPPPPPPPPPP 73 [214][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 17 CPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 CP P PPPPPP P P PPPP PPPPPP Sbjct: 287 CPPPPPPCPPPPPPPPPCPPPPPPPPPPPPP 317 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = +2 Query: 17 CPNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 CP P P PPPP PPP PPPP PPPPPP Sbjct: 294 CPPPPPPPPPCPPPPPPPPPPPPPCPPPPPP 324 [215][TOP] >UniRef100_UPI0001923DA0 PREDICTED: similar to predicted protein n=1 Tax=Hydra magnipapillata RepID=UPI0001923DA0 Length = 1853 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P P L PPPPPP PPP PPPP PPP PP Sbjct: 1392 PPPPHLPLPPPPPPPPPPPPPPPPPPPSPP 1421 [216][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPP PPP PPPP PPPPPP Sbjct: 2802 PPPPPPTPPPPPPPPPPPPPPP 2823 [217][TOP] >UniRef100_UPI0000F2AE0C PREDICTED: similar to hCG1781691 n=1 Tax=Monodelphis domestica RepID=UPI0000F2AE0C Length = 358 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 17 CPN-SPQL*QPPPPPPRPPPRPPPP*PPPPP 106 C N S Q QPPPPPP PPP PPPP PPPPP Sbjct: 9 CSNPSTQPPQPPPPPPPPPPPPPPPPPPPPP 39 [218][TOP] >UniRef100_UPI00005A4477 PREDICTED: similar to zinc finger protein 341 isoform 3 n=1 Tax=Canis lupus familiaris RepID=UPI00005A4477 Length = 853 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 5 SLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRS 118 SL M L QPPPPPP PPP PPPP P PPPP +S Sbjct: 165 SLNMHSAPSYLTQPPPPPPPPPPLPPPPPPQPPPPPQS 202 [219][TOP] >UniRef100_C6XK60 OmpA/MotB domain protein n=1 Tax=Hirschia baltica ATCC 49814 RepID=C6XK60_HIRBI Length = 386 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPPPP*PPPPPP 109 +P PPPPPP PPP PPPP PPPPPP Sbjct: 230 APAAPPPPPPPPPPPPPPPPPPPPPPPP 257 [220][TOP] >UniRef100_A1W8T6 Nuclease (SNase domain protein) n=1 Tax=Acidovorax sp. JS42 RepID=A1W8T6_ACISJ Length = 205 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/40 (55%), Positives = 26/40 (65%) Frame = +2 Query: 2 QSLAMCPNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSS 121 ++ A P P PPPPPP PPP PPPP PPP PP R++ Sbjct: 5 RATAARPQWPHADAPPPPPPPPPPPPPPPPPPPLPPRRAA 44 [221][TOP] >UniRef100_Q3ECQ3 Uncharacterized protein At1g54215.1 n=1 Tax=Arabidopsis thaliana RepID=Q3ECQ3_ARATH Length = 169 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PNSPQL*QPPPPPPRPPPRPPPP*PPPPPPYRSS 121 P PQ PPPPPP PPP PPPP PPPPP S Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMS 69 [222][TOP] >UniRef100_Q4CLZ3 Putative uncharacterized protein (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CLZ3_TRYCR Length = 624 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPP 109 PPPPPP PPP PPPP PPPPPP Sbjct: 337 PPPPPPSPPPPPPPPPPPPPPP 358 [223][TOP] >UniRef100_B4QT65 GD21099 n=1 Tax=Drosophila simulans RepID=B4QT65_DROSI Length = 360 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPPPP*PPPPPP 109 P+ PPPPPP PPP PPPP PPPPPP Sbjct: 136 PKAKLPPPPPPPPPPPPPPPPPPPPPP 162 [224][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSSTT 127 PPPPPP PPP PPPP PPPPPP TT Sbjct: 122 PPPPPPPPPPPPPPPPPPPPPPPPLFTT 149 [225][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +2 Query: 44 PPPPPPRPPPRPPPP*PPPPPPYRSS 121 PPPPPP PPP PPPP PPPPPP S+ Sbjct: 1037 PPPPPPPPPPPPPPPPPPPPPPPMSA 1062