[UP]
[1][TOP] >UniRef100_Q41188 Glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q41188_ARATH Length = 203 Score = 82.4 bits (202), Expect = 1e-14 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGGYGG GRGGG GGGG CY+CGESGH ARDC Sbjct: 160 GGGGYGGGGGGYGGGGRGGG--GGGGSCYSCGESGHFARDC 198 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGYGGGGGGYGG RGGG G GG CY CGE GHMARDC Sbjct: 108 GGGYGGGGGGYGG--RGGG-GRGGSDCYKCGEPGHMARDC 144 [2][TOP] >UniRef100_B9H173 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9H173_POPTR Length = 207 Score = 82.4 bits (202), Expect = 1e-14 Identities = 38/58 (65%), Positives = 39/58 (67%), Gaps = 17/58 (29%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGR-----------------GGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGGYGG G GGGR GGGGGGCY+CGESGHMARDC Sbjct: 103 GGGGYGGGGGGYGGGGYGGGRRGGGGGGYGGGGGYGGGGGGGGGCYSCGESGHMARDC 160 Score = 76.3 bits (186), Expect = 1e-12 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 +GG G GGGGG YGG G GGG GGGGGGCYNCG SGH ARDC Sbjct: 162 QGGSGGGGGGGRYGG-GNGGGGGGGGGGCYNCGGSGHFARDC 202 [3][TOP] >UniRef100_Q8LPA7 Cold shock protein-1 n=1 Tax=Triticum aestivum RepID=Q8LPA7_WHEAT Length = 229 Score = 79.3 bits (194), Expect = 1e-13 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGGYGG G G G GGGG GCY CGE GH++RDC Sbjct: 105 GGGGYGGGGGGYGGGGGGYGGGGGGRGCYKCGEEGHISRDC 145 Score = 71.6 bits (174), Expect = 3e-11 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGG GGGGGGYGG G G G GGGGGGC++CGESGH +R+C Sbjct: 186 GGGGGGGGGGYGG-GGGRGGGGGGGGCFSCGESGHFSREC 224 Score = 65.5 bits (158), Expect = 2e-09 Identities = 34/72 (47%), Positives = 36/72 (50%), Gaps = 31/72 (43%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRG----------------------------GGRGGGGGG---CY 37 GGGGYGGGGGGYGG G G GG GGGGGG CY Sbjct: 112 GGGGYGGGGGGYGGGGGGRGCYKCGEEGHISRDCPQGGGGGGGYGGGGYGGGGGGGRECY 171 Query: 36 NCGESGHMARDC 1 CGE GH++RDC Sbjct: 172 KCGEEGHISRDC 183 [4][TOP] >UniRef100_Q84UR8 Os08g0129200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q84UR8_ORYSJ Length = 197 Score = 79.3 bits (194), Expect = 1e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGGY RGGG GGGGGGCYNCGE+GH+AR+C Sbjct: 156 GGGGYGGGGGGY----RGGGGGGGGGGCYNCGETGHIAREC 192 Score = 72.0 bits (175), Expect = 2e-11 Identities = 34/49 (69%), Positives = 34/49 (69%), Gaps = 8/49 (16%) Frame = -3 Query: 123 GGGGYGGGGGGYGG----VGRGGGRGGGGGG----CYNCGESGHMARDC 1 G GYGGGGGGYGG G GGG GGGGGG CY CGE GHMARDC Sbjct: 102 GDRGYGGGGGGYGGGDRGYGGGGGYGGGGGGGSRACYKCGEEGHMARDC 150 [5][TOP] >UniRef100_A2YQW2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YQW2_ORYSI Length = 193 Score = 79.3 bits (194), Expect = 1e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGGY RGGG GGGGGGCYNCGE+GH+AR+C Sbjct: 152 GGGGYGGGGGGY----RGGGGGGGGGGCYNCGETGHIAREC 188 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/40 (72%), Positives = 29/40 (72%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGYGGG GYGG G GG GGG CY CGE GHMARDC Sbjct: 107 GGGYGGGDRGYGGGGGYGGGGGGSRACYKCGEEGHMARDC 146 [6][TOP] >UniRef100_Q75QN8 Cold shock domain protein 3 n=1 Tax=Triticum aestivum RepID=Q75QN8_WHEAT Length = 231 Score = 79.0 bits (193), Expect = 2e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGGYGG G GGG GGGG GCY CGE GH++RDC Sbjct: 112 GGGGYGGGGGGYGGGGYGGG-GGGGRGCYKCGEDGHISRDC 151 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/65 (50%), Positives = 37/65 (56%), Gaps = 24/65 (36%) Frame = -3 Query: 123 GGGGYGGGGGGY----------------------GGVGRGGGRGGGGGG--CYNCGESGH 16 GGGGYGGGGGG GG G GGGRGGGGGG C++CGESGH Sbjct: 162 GGGGYGGGGGGGRECYKCGEEGHISRDCPQGGGGGGYGGGGGRGGGGGGGGCFSCGESGH 221 Query: 15 MARDC 1 +R+C Sbjct: 222 FSREC 226 [7][TOP] >UniRef100_C0PLI2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PLI2_MAIZE Length = 249 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 18/59 (30%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGG GG G GGG GGGGGGCYNCG++GHMARDC Sbjct: 153 GGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 211 Score = 73.2 bits (178), Expect = 9e-12 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGG YGG G GGG GGGGGGC+ CGE GHMARDC Sbjct: 143 GGGGYGGGG--YGGGGYGGG-GGGGGGCFKCGEPGHMARDC 180 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/45 (71%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 RGGGG GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 94 RGGGGSGGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 138 Score = 67.4 bits (163), Expect = 5e-10 Identities = 35/65 (53%), Positives = 37/65 (56%), Gaps = 24/65 (36%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGG------CYNCGESGH 16 GGGGYGGGGGG GG G GGGR GGGGG CYNCGE+GH Sbjct: 183 GGGGYGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGH 242 Query: 15 MARDC 1 +ARDC Sbjct: 243 IARDC 247 [8][TOP] >UniRef100_C0PAD4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PAD4_MAIZE Length = 281 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 18/59 (30%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGG GG G GGG GGGGGGCYNCG++GHMARDC Sbjct: 185 GGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 243 Score = 73.2 bits (178), Expect = 9e-12 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGG YGG G GGG GGGGGGC+ CGE GHMARDC Sbjct: 175 GGGGYGGGG--YGGGGYGGG-GGGGGGCFKCGEPGHMARDC 212 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/45 (71%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 RGGGG GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 126 RGGGGSGGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 170 Score = 67.4 bits (163), Expect = 5e-10 Identities = 35/65 (53%), Positives = 37/65 (56%), Gaps = 24/65 (36%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGG------CYNCGESGH 16 GGGGYGGGGGG GG G GGGR GGGGG CYNCGE+GH Sbjct: 215 GGGGYGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGH 274 Query: 15 MARDC 1 +ARDC Sbjct: 275 IARDC 279 [9][TOP] >UniRef100_C0P2C3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0P2C3_MAIZE Length = 187 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 18/59 (30%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGG GG G GGG GGGGGGCYNCG++GHMARDC Sbjct: 91 GGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 149 Score = 73.9 bits (180), Expect = 5e-12 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RGGGG G GGGGYGG G GGG GGGGGGC+ CGE GHMARDC Sbjct: 79 RGGGG-GYGGGGYGGGGYGGG-GGGGGGCFKCGEPGHMARDC 118 Score = 67.4 bits (163), Expect = 5e-10 Identities = 35/65 (53%), Positives = 37/65 (56%), Gaps = 24/65 (36%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGG------CYNCGESGH 16 GGGGYGGGGGG GG G GGGR GGGGG CYNCGE+GH Sbjct: 121 GGGGYGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGH 180 Query: 15 MARDC 1 +ARDC Sbjct: 181 IARDC 185 [10][TOP] >UniRef100_B4FXR6 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FXR6_MAIZE Length = 303 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 18/59 (30%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGG GG G GGG GGGGGGCYNCG++GHMARDC Sbjct: 207 GGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 265 Score = 73.2 bits (178), Expect = 9e-12 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGG YGG G GGG GGGGGGC+ CGE GHMARDC Sbjct: 197 GGGGYGGGG--YGGGGYGGG-GGGGGGCFKCGEPGHMARDC 234 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/45 (71%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 RGGGG GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 148 RGGGGSGGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 192 Score = 67.8 bits (164), Expect = 4e-10 Identities = 35/65 (53%), Positives = 37/65 (56%), Gaps = 24/65 (36%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGG------CYNCGESGH 16 GGGGYGGGGGG GG G GGGR GGGGG CYNCGE+GH Sbjct: 237 GGGGYGGGGGGGGGGCYNCGQAGHMARDCPSGGGSGGGRFGGGGGGGGDRSCYNCGEAGH 296 Query: 15 MARDC 1 +ARDC Sbjct: 297 IARDC 301 [11][TOP] >UniRef100_B4FQQ2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FQQ2_MAIZE Length = 134 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 18/59 (30%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGG GG G GGG GGGGGGCYNCG++GHMARDC Sbjct: 38 GGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGYGGGGGGGGGGCYNCGQAGHMARDC 96 Score = 73.2 bits (178), Expect = 9e-12 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGG YGG G GGG GGGGGGC+ CGE GHMARDC Sbjct: 28 GGGGYGGGG--YGGGGYGGG-GGGGGGCFKCGEPGHMARDC 65 Score = 67.4 bits (163), Expect = 5e-10 Identities = 35/65 (53%), Positives = 37/65 (56%), Gaps = 24/65 (36%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV------------------GRGGGRGGGGGG------CYNCGESGH 16 GGGGYGGGGGG GG G GGGR GGGGG CYNCGE+GH Sbjct: 68 GGGGYGGGGGGGGGGCYNCGQAGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGH 127 Query: 15 MARDC 1 +ARDC Sbjct: 128 IARDC 132 [12][TOP] >UniRef100_C4JBR4 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4JBR4_MAIZE Length = 240 Score = 74.7 bits (182), Expect = 3e-12 Identities = 36/60 (60%), Positives = 38/60 (63%), Gaps = 19/60 (31%) Frame = -3 Query: 123 GGGGYGGGG---GGYGGVGRGGG----------------RGGGGGGCYNCGESGHMARDC 1 GGGGYGGGG GGYGG G GGG GGGGGGCYNCG++GHMARDC Sbjct: 143 GGGGYGGGGYGGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGGGCYNCGQAGHMARDC 202 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/45 (71%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 RGGGG GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 94 RGGGGSGGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 138 Score = 60.1 bits (144), Expect = 8e-08 Identities = 35/86 (40%), Positives = 37/86 (43%), Gaps = 45/86 (52%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV---------------------------------------GRGGGR 61 GGGGYGGGGGG GG G GGGR Sbjct: 153 GGGGYGGGGGGGGGCFKCGEPGHMARDCSSGGGGGGCYNCGQAGHMARDCPSGGGGGGGR 212 Query: 60 GGGGGG------CYNCGESGHMARDC 1 GGGGG CYNCGE+GH+ARDC Sbjct: 213 FGGGGGGGGDRSCYNCGEAGHIARDC 238 Score = 58.2 bits (139), Expect = 3e-07 Identities = 32/70 (45%), Positives = 33/70 (47%), Gaps = 29/70 (41%) Frame = -3 Query: 123 GGGGYGG-------------------------GGGGYGGVGRG----GGRGGGGGGCYNC 31 GGG G GGGGYGG G G GG GGGGGGC+ C Sbjct: 111 GGGRRSGGGGGPGACYKCGEPGHMARDCPSADGGGGYGGGGYGGGGYGGGGGGGGGCFKC 170 Query: 30 GESGHMARDC 1 GE GHMARDC Sbjct: 171 GEPGHMARDC 180 [13][TOP] >UniRef100_A9NNT8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NNT8_PICSI Length = 205 Score = 74.7 bits (182), Expect = 3e-12 Identities = 36/52 (69%), Positives = 36/52 (69%), Gaps = 11/52 (21%) Frame = -3 Query: 123 GGGGYGGGGG--GYGGVGRGGGRGGG---------GGGCYNCGESGHMARDC 1 GGGGYGGGGG G GG GRGGGRGGG GG CY CGESGH ARDC Sbjct: 114 GGGGYGGGGGWNGGGGGGRGGGRGGGRGGGAGGGGGGSCYKCGESGHFARDC 165 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/61 (50%), Positives = 32/61 (52%), Gaps = 19/61 (31%) Frame = -3 Query: 126 RGGGGYGGGGG------------------GYGGVGRGGGRGGGGGG-CYNCGESGHMARD 4 RGGG GGGGG G GG G GGG GG GGG CY CG+ GH ARD Sbjct: 140 RGGGAGGGGGGSCYKCGESGHFARDCTSGGGGGGGNGGGGGGAGGGSCYQCGDFGHFARD 199 Query: 3 C 1 C Sbjct: 200 C 200 [14][TOP] >UniRef100_A5BQ96 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BQ96_VITVI Length = 219 Score = 73.9 bits (180), Expect = 5e-12 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 R GGYGGGG G GG G GGG GGGGG CYNCGE GH+ARDC Sbjct: 131 RSSGGYGGGGYGGGG-GYGGGGGGGGGACYNCGEEGHLARDC 171 Score = 66.6 bits (161), Expect = 8e-10 Identities = 33/72 (45%), Positives = 35/72 (48%), Gaps = 31/72 (43%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV-------------------------------GRGGGRGGGGGGCY 37 GGGGYGGGGGG GG G GGG GGGGGGCY Sbjct: 143 GGGGYGGGGGGGGGACYNCGEEGHLARDCSQSSGGGGGGGRYSSGGGGGGGGGGGGGGCY 202 Query: 36 NCGESGHMARDC 1 CGE+GH AR+C Sbjct: 203 RCGEAGHFAREC 214 [15][TOP] >UniRef100_UPI0001982DB4 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982DB4 Length = 214 Score = 72.4 bits (176), Expect = 1e-11 Identities = 37/72 (51%), Positives = 38/72 (52%), Gaps = 31/72 (43%) Frame = -3 Query: 123 GGGGYGGGGGGYG---GVGRGGGRGG----------------------------GGGGCY 37 GGGGYGGGGGGYG G GRGGGRGG GGG CY Sbjct: 95 GGGGYGGGGGGYGYNGGGGRGGGRGGRGGGGGGRSSGGYGGGGYGGGGGYGGGGGGGACY 154 Query: 36 NCGESGHMARDC 1 NCGE GH+ARDC Sbjct: 155 NCGEEGHLARDC 166 Score = 67.4 bits (163), Expect = 5e-10 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 + GG GGGG GG G GGG GGGGGGCY CGE+GH AR+C Sbjct: 168 QSSGGGGGGGRYSGGGGGGGGGGGGGGGCYRCGEAGHFAREC 209 [16][TOP] >UniRef100_Q38896 Glycine-rich protein 2b n=2 Tax=Arabidopsis thaliana RepID=GRP2B_ARATH Length = 201 Score = 72.4 bits (176), Expect = 1e-11 Identities = 33/44 (75%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG--CYNCGESGHMARDC 1 +GGGGY GGGGG G G GGG GGGGGG CY+CGESGH ARDC Sbjct: 153 QGGGGYSGGGGG-GRYGSGGGGGGGGGGLSCYSCGESGHFARDC 195 Score = 64.3 bits (155), Expect = 4e-09 Identities = 32/49 (65%), Positives = 34/49 (69%), Gaps = 8/49 (16%) Frame = -3 Query: 123 GGGGYGGG------GGGYGGVGRGGGRGGGGG--GCYNCGESGHMARDC 1 GGGG GGG GGGYGG G GGRGGGGG C+ CGE GHMAR+C Sbjct: 104 GGGGRGGGRGGGSYGGGYGGRG-SGGRGGGGGDNSCFKCGEPGHMAREC 151 [17][TOP] >UniRef100_Q75QN9 Cold shock domain protein 2 n=1 Tax=Triticum aestivum RepID=Q75QN9_WHEAT Length = 205 Score = 72.0 bits (175), Expect = 2e-11 Identities = 34/57 (59%), Positives = 36/57 (63%), Gaps = 16/57 (28%) Frame = -3 Query: 123 GGGGYGGGGGGYGG----VGRGGGRGGGGGG------------CYNCGESGHMARDC 1 GGGGYGGGGGGYGG G GGG GGGGGG CY CGE GH++RDC Sbjct: 105 GGGGYGGGGGGYGGGGGSYGGGGGYGGGGGGGRYGGGSGGGRECYKCGEEGHISRDC 161 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 114 GYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 G GGGGGGYGG G G G GGGGGGC++CGESGH +R+C Sbjct: 164 GGGGGGGGYGG-GGGRGGGGGGGGCFSCGESGHFSREC 200 [18][TOP] >UniRef100_P27484 Glycine-rich protein 2 n=1 Tax=Nicotiana sylvestris RepID=GRP2_NICSY Length = 214 Score = 72.0 bits (175), Expect = 2e-11 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGR-GGGRGGGGGGCYNCGESGHMARDC 1 GG YGGGGGGYGG G GGG GGG GC+ CGESGH ARDC Sbjct: 131 GGSRYGGGGGGYGGGGGYGGGGSGGGSGCFKCGESGHFARDC 172 Score = 65.9 bits (159), Expect = 1e-09 Identities = 34/66 (51%), Positives = 35/66 (53%), Gaps = 25/66 (37%) Frame = -3 Query: 123 GGGGYGGGG-----------------------GGYGGVGR--GGGRGGGGGGCYNCGESG 19 GGGGYGGGG GG GG GR GGG GGGGGGCY CGE G Sbjct: 144 GGGGYGGGGSGGGSGCFKCGESGHFARDCSQSGGGGGGGRFGGGGGGGGGGGCYKCGEDG 203 Query: 18 HMARDC 1 H AR+C Sbjct: 204 HFAREC 209 [19][TOP] >UniRef100_UPI00019852F3 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019852F3 Length = 228 Score = 71.6 bits (174), Expect = 3e-11 Identities = 33/57 (57%), Positives = 35/57 (61%), Gaps = 16/57 (28%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRG----------------GGGGGCYNCGESGHMARDC 1 GGGGYGGGGGG GG G GGG G GGGG CYNCG +GH+ARDC Sbjct: 101 GGGGYGGGGGGGGGGGGGGGYGRGVRGGRRSGRTDDGYGGGGACYNCGRTGHLARDC 157 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = -3 Query: 123 GGGGY--GGGGGGYGGVGRGGGR--GGGGGGCYNCGESGHMARDC 1 GGGGY G GGGGY GGG G GGG CYNCGE GH ARDC Sbjct: 179 GGGGYSAGAGGGGYSAGAGGGGYSFGAGGGACYNCGEEGHFARDC 223 [20][TOP] >UniRef100_A9RSY7 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RSY7_PHYPA Length = 161 Score = 71.6 bits (174), Expect = 3e-11 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGG GGGGGG GG G GGG GGGGG C+ CG+ GH AR+C Sbjct: 96 GGGGGGGGGGGKGGGGGGGGGGGGGGDCFKCGQPGHWAREC 136 [21][TOP] >UniRef100_C5XT04 Putative uncharacterized protein Sb04g001720 n=1 Tax=Sorghum bicolor RepID=C5XT04_SORBI Length = 251 Score = 71.2 bits (173), Expect = 3e-11 Identities = 35/62 (56%), Positives = 37/62 (59%), Gaps = 21/62 (33%) Frame = -3 Query: 123 GGGGYGGGGGG--------------------YGGVGRGG-GRGGGGGGCYNCGESGHMAR 7 GGGGYGGGGGG YGG G GG G GGGGG CYNCG++GHMAR Sbjct: 152 GGGGYGGGGGGCFKCGEPGHMARDCPSGGGGYGGGGGGGYGGGGGGGACYNCGQTGHMAR 211 Query: 6 DC 1 DC Sbjct: 212 DC 213 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/45 (71%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 RGGGG GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 95 RGGGGSGGGGRSYGGSWGGGRRSGGGGGAGACYKCGEPGHMARDC 139 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGYGGGGGGYGG GGGGC+ CGE GHMARDC Sbjct: 145 GGGGYGGGGGGYGG---------GGGGCFKCGEPGHMARDC 176 Score = 65.9 bits (159), Expect = 1e-09 Identities = 34/63 (53%), Positives = 36/63 (57%), Gaps = 22/63 (34%) Frame = -3 Query: 123 GGGGYGGGGGGYG----------------GVGRGGGRGGGGGG------CYNCGESGHMA 10 GGGGYGGGGGG G G GGGR GGGGG CYNCGE+GH+A Sbjct: 187 GGGGYGGGGGGGACYNCGQTGHMARDCPSGGGGGGGRFGGGGGGGGDRSCYNCGEAGHIA 246 Query: 9 RDC 1 RDC Sbjct: 247 RDC 249 [22][TOP] >UniRef100_Q6YUR8 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6YUR8_ORYSJ Length = 241 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGG---GCYNCGESGHMARDC 1 RGGGG GGGG YGG GG R GGGG GC+ CGESGHMARDC Sbjct: 95 RGGGGSGGGGRSYGGSWGGGRRSGGGGPGGGCFKCGESGHMARDC 139 Score = 67.8 bits (164), Expect = 4e-10 Identities = 32/57 (56%), Positives = 34/57 (59%), Gaps = 16/57 (28%) Frame = -3 Query: 123 GGGGYGGGGGGY----------------GGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGG GG GGG GG G GGG GGGGG CYNCGE+GH+ARDC Sbjct: 150 GGGGGGGAGGGCFKCGEMGHMARDCFNSGGGGGGGGGGGGGGACYNCGETGHLARDC 206 Score = 63.9 bits (154), Expect = 5e-09 Identities = 33/59 (55%), Positives = 35/59 (59%), Gaps = 18/59 (30%) Frame = -3 Query: 123 GGGGYGGGGGGY----------------GGVGRGGGRGGGGG--GCYNCGESGHMARDC 1 GGGG GGGGGG GG G GGGR GGGG CYNCGE+GH+ARDC Sbjct: 181 GGGGGGGGGGGACYNCGETGHLARDCYNGGGGGGGGRFGGGGDRSCYNCGEAGHIARDC 239 Score = 63.5 bits (153), Expect = 7e-09 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 16/57 (28%) Frame = -3 Query: 123 GGGGYGGG----------------GGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGG GGG GGG G G GGG GG GGGC+ CGE GHMARDC Sbjct: 118 GGGGPGGGCFKCGESGHMARDCFNGGGVGVGGGGGGGGGAGGGCFKCGEMGHMARDC 174 [23][TOP] >UniRef100_C0Z2E8 AT4G38680 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2E8_ARATH Length = 204 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/40 (80%), Positives = 32/40 (80%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGYGGGGGGYGG RGGG G GG CY CGE GHMARDC Sbjct: 108 GGGYGGGGGGYGG--RGGG-GRGGSDCYKCGEPGHMARDC 144 [24][TOP] >UniRef100_B4FNK1 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FNK1_MAIZE Length = 395 Score = 70.5 bits (171), Expect = 6e-11 Identities = 32/45 (71%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 RGGGG GGGG YGG GG R GGGGG CY CGE GHMARDC Sbjct: 94 RGGGGSGGGGRSYGGSWGGGRRSGGGGGPGACYKCGEPGHMARDC 138 [25][TOP] >UniRef100_Q3HRT2 Putative glycine-rich protein n=1 Tax=Picea glauca RepID=Q3HRT2_PICGL Length = 156 Score = 69.3 bits (168), Expect = 1e-10 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -3 Query: 117 GGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 G GGGGGG GG GGG GGGGG CY CGESGH ARDC Sbjct: 79 GNSGGGGGGRGGGRGGGGAGGGGGSCYKCGESGHFARDC 117 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/60 (53%), Positives = 33/60 (55%), Gaps = 18/60 (30%) Frame = -3 Query: 126 RGGGGYGGGGG-----------------GYGGVGRGGGRGGGGGG-CYNCGESGHMARDC 1 RGGGG GGGGG G GG G GGG GG GGG CY CG+ GH ARDC Sbjct: 92 RGGGGAGGGGGSCYKCGESGHFARDCTSGGGGGGNGGGGGGAGGGSCYQCGDFGHFARDC 151 [26][TOP] >UniRef100_B6U2B9 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6U2B9_MAIZE Length = 208 Score = 69.3 bits (168), Expect = 1e-10 Identities = 34/48 (70%), Positives = 35/48 (72%), Gaps = 7/48 (14%) Frame = -3 Query: 123 GGG--GYGG-----GGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGG GYGG GGGGYGG G GGG GGGG GC+ CGE GHMARDC Sbjct: 126 GGGDRGYGGDRGYGGGGGYGG-GYGGGGGGGGRGCFKCGEEGHMARDC 172 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/64 (53%), Positives = 37/64 (57%), Gaps = 23/64 (35%) Frame = -3 Query: 123 GGGGYGGG-GGGYGGVGRG-----------------GGRGGGGGG-----CYNCGESGHM 13 GGGGYGGG GGG GG GRG GG GGGGGG CYNCG+ GH+ Sbjct: 140 GGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGGYGGGGGGGRXSECYNCGQEGHI 199 Query: 12 ARDC 1 +RDC Sbjct: 200 SRDC 203 [27][TOP] >UniRef100_B6TP60 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6TP60_MAIZE Length = 208 Score = 69.3 bits (168), Expect = 1e-10 Identities = 34/48 (70%), Positives = 35/48 (72%), Gaps = 7/48 (14%) Frame = -3 Query: 123 GGG--GYGG-----GGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGG GYGG GGGGYGG G GGG GGGG GC+ CGE GHMARDC Sbjct: 126 GGGDRGYGGDRGYGGGGGYGG-GYGGGGGGGGRGCFKCGEEGHMARDC 172 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/64 (53%), Positives = 37/64 (57%), Gaps = 23/64 (35%) Frame = -3 Query: 123 GGGGYGGG-GGGYGGVGRG-----------------GGRGGGGGG-----CYNCGESGHM 13 GGGGYGGG GGG GG GRG GG GGGGGG CYNCG+ GH+ Sbjct: 140 GGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGGYGGGGGGGRGSECYNCGQEGHI 199 Query: 12 ARDC 1 +RDC Sbjct: 200 SRDC 203 [28][TOP] >UniRef100_B6SP06 Glycine-rich protein 2b n=1 Tax=Zea mays RepID=B6SP06_MAIZE Length = 208 Score = 69.3 bits (168), Expect = 1e-10 Identities = 34/48 (70%), Positives = 35/48 (72%), Gaps = 7/48 (14%) Frame = -3 Query: 123 GGG--GYGG-----GGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGG GYGG GGGGYGG G GGG GGGG GC+ CGE GHMARDC Sbjct: 126 GGGDRGYGGDRGYGGGGGYGG-GYGGGGGGGGRGCFKCGEEGHMARDC 172 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/64 (53%), Positives = 37/64 (57%), Gaps = 23/64 (35%) Frame = -3 Query: 123 GGGGYGGG-GGGYGGVGRG-----------------GGRGGGGGG-----CYNCGESGHM 13 GGGGYGGG GGG GG GRG GG GGGGGG CYNCG+ GH+ Sbjct: 140 GGGGYGGGYGGGGGGGGRGCFKCGEEGHMARDCSQGGGYGGGGGGGRGSECYNCGQEGHI 199 Query: 12 ARDC 1 +RDC Sbjct: 200 SRDC 203 [29][TOP] >UniRef100_B9RJ51 Cold shock protein, putative n=1 Tax=Ricinus communis RepID=B9RJ51_RICCO Length = 184 Score = 67.0 bits (162), Expect = 6e-10 Identities = 30/48 (62%), Positives = 31/48 (64%), Gaps = 7/48 (14%) Frame = -3 Query: 123 GGGGYGGGGGGYGGV-------GRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGY GGG G GGV GR GG G GG CYNCG GH+ARDC Sbjct: 94 GGGGYSGGGRGDGGVYVRRGRGGRSGGGGAGGSACYNCGRYGHLARDC 141 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -3 Query: 111 YGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 Y GGGGG GG R G GGG G CYNCGE GH ARDC Sbjct: 142 YQGGGGGGGGGSRRFGGGGGSGACYNCGEEGHFARDC 178 [30][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 +CP P + PPPPPP PPP P PP PPPPPP PPPP Sbjct: 128 VCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 131 PPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 165 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 10/46 (21%) Frame = +2 Query: 17 CPDSPQL*QPPPPPP----------RPPPRPTPP*PPPPPPYPPPP 124 CP P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 112 CPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPP 157 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 8/45 (17%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPTPP*P--------PPPPPYPPPP 124 MC P PPPPPP PPP P PP P PPPPP PPPP Sbjct: 135 MCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPP 179 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P + PPPPPP PPP P P PPPPPP PPPP Sbjct: 186 PPPPPMCLPPPPPPPPPPPPCPL-PPPPPPCPPPP 219 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/41 (58%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +2 Query: 8 LAMCPDSPQL*QPPPPPPRPPPRPTPP*--PPPPPPYPPPP 124 + CP P PPPP P PPP P PP PPPPPP PPPP Sbjct: 166 VVFCPPPPPC--PPPPAPCPPPPPPPPMCLPPPPPPPPPPP 204 [31][TOP] >UniRef100_C5YGM9 Putative uncharacterized protein Sb06g029650 n=1 Tax=Sorghum bicolor RepID=C5YGM9_SORBI Length = 215 Score = 66.2 bits (160), Expect = 1e-09 Identities = 35/60 (58%), Positives = 36/60 (60%), Gaps = 19/60 (31%) Frame = -3 Query: 123 GGGGYGGGGG-GYGGVG---------RGGGRGGGGG---------GCYNCGESGHMARDC 1 GGGGYGGGG GYGG G RG GRGGGGG GC+ CGE GHMARDC Sbjct: 112 GGGGYGGGGDRGYGGGGDRVYGGGGDRGYGRGGGGGYGGGGGGGRGCFKCGEEGHMARDC 171 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/68 (48%), Positives = 36/68 (52%), Gaps = 27/68 (39%) Frame = -3 Query: 123 GGGGYG-------------------------GGGGGYGGVGRGGGRGGGGGG--CYNCGE 25 GGGGYG GGGGGYGG G GGG GGGGGG CYNC + Sbjct: 144 GGGGYGGGGGGGRGCFKCGEEGHMARDCSQGGGGGGYGG-GGGGGYGGGGGGRECYNCHQ 202 Query: 24 SGHMARDC 1 GH++RDC Sbjct: 203 EGHISRDC 210 [32][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 65.9 bits (159), Expect = 1e-09 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 CP P PPPPPP PPP P PP PPPPPP PPPPR Sbjct: 67 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPPRP PP PPPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPPR Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P+ PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P+ PPPPPP PPP P PP PPPPPP PPPP Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPPRP P P PP PPPPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPP 85 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPP P PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P +P PPPP PPP P PP PPPPPP PPPP Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPP P PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 109 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPP 69 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPP 107 [33][TOP] >UniRef100_C1MPH3 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MPH3_9CHLO Length = 835 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 108 GGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGG YGG G GGG GGGGG C+ CGESGH ARDC Sbjct: 754 GGGGGQYGG-GGGGGGGGGGGSCFKCGESGHWARDC 788 [34][TOP] >UniRef100_C0KIF4 Vasa n=1 Tax=Strongylocentrotus purpuratus RepID=C0KIF4_STRPU Length = 766 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/52 (61%), Positives = 33/52 (63%), Gaps = 10/52 (19%) Frame = -3 Query: 126 RGGGGYGGG----------GGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RGGGG GGG GGG+GG GGG GGGGG CY C E GHMARDC Sbjct: 109 RGGGGGGGGRGAESGGGRGGGGFGGRREGGG-GGGGGACYKCQEEGHMARDC 159 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/64 (48%), Positives = 35/64 (54%), Gaps = 22/64 (34%) Frame = -3 Query: 126 RGGGGYGG----GGGGYGGV------------------GRGGGRGGGGGGCYNCGESGHM 13 RGGGG+GG GGGG GG GGGRGGG CYNCGE+GHM Sbjct: 126 RGGGGFGGRREGGGGGGGGACYKCQEEGHMARDCPNGDSSGGGRGGGDRSCYNCGETGHM 185 Query: 12 ARDC 1 +R+C Sbjct: 186 SREC 189 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/56 (51%), Positives = 33/56 (58%), Gaps = 16/56 (28%) Frame = -3 Query: 120 GGGYGGGG------GGYGGVGR--------GGGRGGGGG--GCYNCGESGHMARDC 1 GGG GGG G G + R GGGRGGGGG CYNCGE+GHM+R+C Sbjct: 166 GGGRGGGDRSCYNCGETGHMSRECPTKDSSGGGRGGGGGDRSCYNCGETGHMSREC 221 [35][TOP] >UniRef100_A7NV84 Chromosome chr18 scaffold_1, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7NV84_VITVI Length = 189 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = -3 Query: 123 GGGGY--GGGGGGYGGVGRGGGR--GGGGGGCYNCGESGHMARDC 1 GGGGY G GGGGY GGG G GGG CYNCGE GH ARDC Sbjct: 140 GGGGYSAGAGGGGYSAGAGGGGYSFGAGGGACYNCGEEGHFARDC 184 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGG-GY-GGVGRGGGRG-GGGGGCYNCGESGHMARDC 1 RG GGGGG G+ GG RGG G GGGG CYNCG +GH+ARDC Sbjct: 74 RGSYSSGGGGGRGFSGGRSRGGNDGYGGGGACYNCGRTGHLARDC 118 [36][TOP] >UniRef100_UPI00019830CC PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019830CC Length = 241 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/53 (56%), Positives = 32/53 (60%), Gaps = 12/53 (22%) Frame = -3 Query: 123 GGGGYGGGGGGYG------------GVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGG GGGGGG G R G GGGGGGCYNCG+ GH+ARDC Sbjct: 142 GGGGSGGGGGGGGCYTCGQPGHLARDCSRPSGGGGGGGGCYNCGDYGHLARDC 194 Score = 63.9 bits (154), Expect = 5e-09 Identities = 31/49 (63%), Positives = 33/49 (67%), Gaps = 8/49 (16%) Frame = -3 Query: 123 GGGGYGGG-----GGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 GGGG GGG GGGYG R G RGG GGG CYNCG +GH+ARDC Sbjct: 86 GGGGGGGGRGGRSGGGYGSGWRTGDRGGNGGGGAACYNCGGTGHLARDC 134 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -3 Query: 117 GGYGGGGGGYGGVGRGGGR-GGGGGGCYNCGESGHMARDC 1 G +GGGGGG GGGR GGGGGGCYNCG+ GH AR+C Sbjct: 202 GRFGGGGGG------GGGRFGGGGGGCYNCGQEGHFAREC 235 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/58 (51%), Positives = 33/58 (56%), Gaps = 16/58 (27%) Frame = -3 Query: 126 RGGGGYGG------GGGGY----------GGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RGG G GG GG G+ GG G G G GGGGGGCY CG+ GH+ARDC Sbjct: 111 RGGNGGGGAACYNCGGTGHLARDCVRRNNGGGGGGSGGGGGGGGCYTCGQPGHLARDC 168 [37][TOP] >UniRef100_B9GUE2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GUE2_POPTR Length = 184 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/40 (70%), Positives = 28/40 (70%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GG GG GG GG GG GGGGGGCYNCGE GH ARDC Sbjct: 139 GGDDGGRYGGGGGRRYSGGGGGGGGGCYNCGEEGHFARDC 178 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/56 (55%), Positives = 33/56 (58%), Gaps = 14/56 (25%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGG---------RGGGGGG-----CYNCGESGHMARDC 1 RGG G GGG G Y G GRGGG RG GGGG C+NCG GH+ARDC Sbjct: 81 RGGRGGGGGRGYYSGRGRGGGYERGGHSRGRGYGGGGSSGGACFNCGRYGHLARDC 136 [38][TOP] >UniRef100_C7EAA1 Vasa-like protein n=1 Tax=Haliotis asinina RepID=C7EAA1_9VEST Length = 763 Score = 64.3 bits (155), Expect = 4e-09 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGG+GG GG G GRGG GGGG GC+ CGE GH +R+C Sbjct: 183 GGGFGGRGGRGGRGGRGGSNGGGGSGCFKCGEEGHFSREC 222 [39][TOP] >UniRef100_A4QWM8 Putative uncharacterized protein n=1 Tax=Magnaporthe grisea RepID=A4QWM8_MAGGR Length = 199 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGY GGGGGYGG G G G GG CY+CG GHM+RDC Sbjct: 116 GGGGYSGGGGGYGG---GYGGGAGGKTCYSCGGVGHMSRDC 153 [40][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +2 Query: 23 DSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 D P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [41][TOP] >UniRef100_B9ILD8 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9ILD8_POPTR Length = 198 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 RGGGG GGGGGG GRGGGRG GG CY CGE+GH AR+C Sbjct: 74 RGGGGGGGGGGG----GRGGGRGRSGGSDLKCYECGEAGHFAREC 114 [42][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +2 Query: 23 DSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 D P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [43][TOP] >UniRef100_A9TVK2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TVK2_PHYPA Length = 349 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Frame = -3 Query: 120 GGGYGGGGGGYGGV---GRGGGRGGGGGGCYNCGESGHMARDC 1 GGG GG GGYGG G GGGRGGGG CY CG+ GH AR+C Sbjct: 234 GGGSRGGAGGYGGNFGGGGGGGRGGGGRPCYTCGQEGHFAREC 276 [44][TOP] >UniRef100_A5BG48 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BG48_VITVI Length = 247 Score = 63.9 bits (154), Expect = 5e-09 Identities = 31/49 (63%), Positives = 33/49 (67%), Gaps = 8/49 (16%) Frame = -3 Query: 123 GGGGYGGG-----GGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 GGGG GGG GGGYG R G RGG GGG CYNCG +GH+ARDC Sbjct: 86 GGGGGGGGRGGRSGGGYGSGWRTGDRGGNGGGGAACYNCGGTGHLARDC 134 Score = 63.2 bits (152), Expect = 9e-09 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 26/67 (38%) Frame = -3 Query: 123 GGGGYGGGGGGY-----------------------GGVGRGGGR---GGGGGGCYNCGES 22 GGGG GGGGG Y GG G GGGR GGGGGGCYNCG+ Sbjct: 175 GGGGGGGGGGCYNCGDYGHLARDCTLESGXAGRFGGGGGGGGGRFGGGGGGGGCYNCGQE 234 Query: 21 GHMARDC 1 GH AR+C Sbjct: 235 GHFAREC 241 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/60 (51%), Positives = 34/60 (56%), Gaps = 18/60 (30%) Frame = -3 Query: 126 RGGGGYGG------GGGGY------------GGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RGG G GG GG G+ GG G GGG GGGGGGCY CG+ GH+ARDC Sbjct: 111 RGGNGGGGAACYNCGGTGHLARDCVRRNNGGGGGGXGGGGGGGGGGCYTCGQPGHLARDC 170 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/57 (52%), Positives = 33/57 (57%), Gaps = 16/57 (28%) Frame = -3 Query: 123 GGGGYGGGGGGYGG----------VGRGGGRG------GGGGGCYNCGESGHMARDC 1 GGGG GGGGGG GG + R R GGGGGCYNCG+ GH+ARDC Sbjct: 142 GGGGXGGGGGGGGGGCYTCGQPGHLARDCSRPSGGGGGGGGGGCYNCGDYGHLARDC 198 [45][TOP] >UniRef100_Q4JF01 Vasa homlogue n=1 Tax=Platynereis dumerilii RepID=Q4JF01_PLADU Length = 712 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 6/47 (12%) Frame = -3 Query: 123 GGGGYGGG-GGGYGGVGRGGGRGGGGG-----GCYNCGESGHMARDC 1 GGGG+GG GGG+G G GGG GGGGG GC+ CGE GH +R+C Sbjct: 155 GGGGFGGSRGGGFGSSGGGGGFGGGGGSGGGKGCFKCGEEGHFSREC 201 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = -3 Query: 123 GGGGYGGG----GGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 G G GG GGG+GG RGGG GGG GCY CG GH+ARDC Sbjct: 73 GSRGAGGDDEPRGGGFGGK-RGGG-GGGSSGCYKCGGEGHIARDC 115 [46][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 M ++P L PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1467 MARETPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1503 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPPPP PP PR Sbjct: 1479 PPPPPPPPPPPPPPPPPPPPPPPPPLPR 1506 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPPPP P PR Sbjct: 1482 PPPPPPPPPPPPPPPPPPPPPPLPRTPR 1509 [47][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +2 Query: 8 LAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 LA C D+ PPPPPP PPP P PP PPPPPP PPPP Sbjct: 221 LAECLDAAGFAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP P PP PPPPPP+ PP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQPP 265 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPPPP PPR Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPFQPPR 266 [48][TOP] >UniRef100_A9SWE4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SWE4_PHYPA Length = 165 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGG-CYNCGESGHMARDC 1 GGG G GGGG GG G GGG GGGGGG C+ CG+ GH AR+C Sbjct: 90 GGGDRGYGGGGGGGRGGGGGGGGGGGGDCFKCGQPGHWAREC 131 [49][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 63.2 bits (152), Expect = 9e-09 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 +P + QPPPPPP PPP P PP PPPPPP PPPP Sbjct: 315 TPDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD Q PPPPPP PPP P PP PPPPPP PPPP Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPP+ Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQ 368 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PP PPP P PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPP 372 [50][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P L PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P P PPPP PPP P PP PPPPPP PPPP Sbjct: 21 CPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 16 PPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPP 50 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 23 DSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 D P PPPPPP PP P PP PPPPPP PPPP Sbjct: 15 DPPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPP 48 [51][TOP] >UniRef100_B7P029 Vasa n=1 Tax=Chlamys farreri RepID=B7P029_9BIVA Length = 801 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 8/50 (16%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVG-----RGGGRGGGGG---GCYNCGESGHMARDC 1 RGGGG+G G G GG G RGGG GGGGG GC+ CGE GH AR+C Sbjct: 134 RGGGGFGKGSGDGGGFGSDRPPRGGGFGGGGGSSSGCHKCGEDGHFAREC 183 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 15/55 (27%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGR--------------GGGRGGGGGG-CYNCGESGHMARDC 1 GGG+GGGGG G + GGGRGGGGGG C+ CGE GH AR+C Sbjct: 157 GGGFGGGGGSSSGCHKCGEDGHFARECPTGGGGRGGGGGGKCHKCGEEGHFAREC 211 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/52 (51%), Positives = 30/52 (57%), Gaps = 11/52 (21%) Frame = -3 Query: 123 GGGGYGGGGGGY-------GGVGR----GGGRGGGGGGCYNCGESGHMARDC 1 GGGG GGGGGG G R GGG GGG C+ CGE GHM+R+C Sbjct: 186 GGGGRGGGGGGKCHKCGEEGHFARECPTGGGGGGGDRSCFKCGEQGHMSREC 237 [52][TOP] >UniRef100_B0L0X0 VASA n=1 Tax=Fenneropenaeus chinensis RepID=B0L0X0_FENCH Length = 712 Score = 63.2 bits (152), Expect = 9e-09 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -3 Query: 111 YGGGGGGYGGVGR--GGGRGGGGGG---CYNCGESGHMARDC 1 +G GGGG+GG GR GGGRGGG GG C+ CG+ GHMARDC Sbjct: 59 FGSGGGGFGGRGRSRGGGRGGGRGGSRACFKCGDEGHMARDC 100 [53][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPPR Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPR 103 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 + P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 22 LLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P L P PPPP PPP P PP PPPPPP PPPP Sbjct: 20 PHLLPPRPPPPPPPPPPPPPPPPPPPPPPPPP 51 [54][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PPPPPP PPPP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P+PP PPPPPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PP PPP PPPP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP P P P+PP PPPPPP PPPP Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP PPPPPP PPPP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PP PPP P PP PPPPPP PPPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP P PPPP PPPP Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP P P P PP PPPPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P PP PPPPPP PPPP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PP PPP P PP PPPPPP PPPP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP PPPPPP PPPP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPPPP PPPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P P PPPPPP PPPP Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPP PP P PP PPPPPP PPPP Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPP---PPPYPPPP 124 P SP PPPPPP PPP P PP PPP PPP PPPP Sbjct: 223 PPSP----PPPPPPSPPPSPPPPPPPPPPSPPPSPPPP 256 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P+PP PPPPP PPPP Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPPPP PP P Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP P PP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYP 115 P SP PPPPPP PPP P PP PPPPP YP Sbjct: 274 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP PP PPPPPP PPPP Sbjct: 271 PPPPPSPPPPPPPPPPPP---PPPPPPPPPPPPPP 302 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P++P PP PPP PPP P P PPPPPP PP P Sbjct: 215 PNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSP 249 [55][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPPR Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SL P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [56][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP+PPPP Sbjct: 673 PPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PPPPPP PPPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P L PPPPPP PPP P PP PPPPPP PPPP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP PP PPPPPP PPPP Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP P PPPP PPP P PP PPPPPP PPPP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PP PPP PPPP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P+PP PPPPPP PPPP Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP PPPPPP PPPP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPPPP PPPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPP PP PPPP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PP PPP P PP PPPPPP PPPP Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P L PP PPP PPP P PP PPPPPP PPPP Sbjct: 670 PPPPPL--PPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PP PPP P PP PPPPPP PPPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P PP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP----PPPPYPPPP 124 P P PPPPPP PPP P PP PP PPPP PPPP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +2 Query: 20 PDSPQL*QPPPPP----PRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP P PPP P PP PPPPPP PPPP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P P PPPP PPP P PP PPPPPP PPP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PP PPP PPP Sbjct: 677 PSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP S + PPPP PPP P PP PPPP P PPPP Sbjct: 199 CPVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPP 234 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P L PPPP PPP P+PP P PPPP PPPP Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPP 249 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 47 PPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPP PP P PP PPPPPP PPPP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPP 239 [57][TOP] >UniRef100_Q01DC8 Plg protein (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01DC8_OSTTA Length = 3738 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/40 (62%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +2 Query: 8 LAMCPDSPQL*QPPPPP-PRPPPRPTPP*PPPPPPYPPPP 124 +++CP P PPPPP P PPP P PP PPPPPP PPPP Sbjct: 1 MSVCPPPPAPPSPPPPPSPPPPPSPAPPSPPPPPPSPPPP 40 [58][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPPR Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 99 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [59][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPPR Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [60][TOP] >UniRef100_B5X0E7 Vasa (Fragment) n=1 Tax=Capitella sp. I Grassle & Grassle, 1976 RepID=B5X0E7_9ANNE Length = 516 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 9/50 (18%) Frame = -3 Query: 123 GGGGYGG---GGGGYGGVGRGGGR------GGGGGGCYNCGESGHMARDC 1 GGGG+GG GGGG+GG GGG GGGG GC CGE GH AR+C Sbjct: 91 GGGGFGGSSGGGGGFGGSSGGGGGFGGSSGGGGGSGCRKCGEEGHFAREC 140 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/67 (44%), Positives = 34/67 (50%), Gaps = 26/67 (38%) Frame = -3 Query: 123 GGGGYGG---GGGGYGGVGRGGG--------------------RGGGGGG---CYNCGES 22 GGGG+GG GGGG+GG GGG GGGGGG C+ CGE Sbjct: 101 GGGGFGGSSGGGGGFGGSSGGGGGSGCRKCGEEGHFARECPNSEGGGGGGSGNCHKCGEP 160 Query: 21 GHMARDC 1 GH AR+C Sbjct: 161 GHFAREC 167 [61][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPPR Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 114 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 AM +P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 70 AMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 ++ M P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 70 AMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P + PPPP PPP P PP PPPPPP PPPP Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPP 100 [62][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPPR Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SL P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [63][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPPRPPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPRPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PP PPP PPPRP PP PPPPPP PPPP Sbjct: 16 PPLPPPPPPPRPPPPPPPPPPPPPPPP 42 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P L PPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PP PPP PPP P PP PPPPPP PPP Sbjct: 16 PPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYP 115 P P PPPPPP PPP P PP PPPPPP P Sbjct: 20 PPPPPPRPPPPPPPPPPPPPPPPPPPPPPPLP 51 [64][TOP] >UniRef100_A9SBU8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SBU8_PHYPA Length = 198 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 9/50 (18%) Frame = -3 Query: 123 GGGGYGGGG------GGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 GG G+GGG GG G G GG RGG GGG CYNCGE GHMARDC Sbjct: 106 GGRGFGGGAARGRGRGGRGSGGFGGERGGVGGGDRSCYNCGEGGHMARDC 155 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/70 (42%), Positives = 32/70 (45%), Gaps = 28/70 (40%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGR-------------------------GGGRGGGGGG---CYNC 31 RG GG+GG GG GG R GGG GGG GG CY C Sbjct: 123 RGSGGFGGERGGVGGGDRSCYNCGEGGHMARDCQNESTGNARQGGGGGGGVGGSRSCYTC 182 Query: 30 GESGHMARDC 1 GE+GH ARDC Sbjct: 183 GEAGHFARDC 192 [65][TOP] >UniRef100_Q2WBX4 Vasa protein isoform n=1 Tax=Platynereis dumerilii RepID=Q2WBX4_PLADU Length = 732 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/46 (58%), Positives = 32/46 (69%), Gaps = 5/46 (10%) Frame = -3 Query: 123 GGGGYGGG-GGGYGGVGRGGGRGGGGGG----CYNCGESGHMARDC 1 GGGG+GG GGG+G G GGG GGGG G C+ CGE GH +R+C Sbjct: 154 GGGGFGGSRGGGFGSSGGGGGFGGGGSGGGKGCFKCGEEGHFSREC 199 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/53 (50%), Positives = 30/53 (56%), Gaps = 14/53 (26%) Frame = -3 Query: 117 GGYGGGGGGYG-----------GVGRGGGRGGGGGG---CYNCGESGHMARDC 1 GG+GG G+G G G GG RGGGGGG CY CG GH+ARDC Sbjct: 63 GGFGGRSNGFGSRGAGGDDEPRGGGFGGKRGGGGGGSSGCYKCGGEGHIARDC 115 [66][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 357 CPPPPP--PPPPPPPPPPPPPPPPSPPPPPPPPPPP 390 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P+PP PPPPPP PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PPPPPP PP P Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P PP PPPPPP PPPP Sbjct: 367 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 401 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PP PPP P PP PPPPPP PPPP Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP PPPPPP PPPP Sbjct: 369 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPPPP PPPP Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +2 Query: 11 AMCPDSPQL*--QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 A CP P QP PPPP PPP P PP PPPPPP PPP Sbjct: 343 ACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPP 382 [67][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 344 PQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P Q PPPPP PPP P PP PPPPPP PPPP Sbjct: 343 PPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPP 377 [68][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 M + P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 846 MVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 882 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPP PPPP Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPP P PPPP Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970 [69][TOP] >UniRef100_UPI0000E47A48 PREDICTED: similar to HEXBP DNA binding protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E47A48 Length = 186 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/69 (47%), Positives = 34/69 (49%), Gaps = 28/69 (40%) Frame = -3 Query: 123 GGGG-------YGGGGGGYGGV---------------------GRGGGRGGGGGGCYNCG 28 GGGG YGGGGGG GG RGGGRGGG CYNCG Sbjct: 10 GGGGSSYGNRSYGGGGGGRGGGDRTCYNCGQPGHISRDCPQGDSRGGGRGGGDRSCYNCG 69 Query: 27 ESGHMARDC 1 E GH+ARDC Sbjct: 70 EPGHIARDC 78 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/61 (47%), Positives = 32/61 (52%), Gaps = 20/61 (32%) Frame = -3 Query: 123 GGGGYGGGGGG-----YG---------------GVGRGGGRGGGGGGCYNCGESGHMARD 4 GG G GGG GG YG G RGGGRGGG CYNCG+ GH++RD Sbjct: 81 GGRGGGGGRGGSDRACYGCGATDHMARECPNSKGDSRGGGRGGGDRTCYNCGQPGHISRD 140 Query: 3 C 1 C Sbjct: 141 C 141 [70][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P Q+ PPPPPP PPP P PP PPPPPP PPPP Sbjct: 227 PPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P PP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPP P PPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPP PP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PP PPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP P PPPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 [71][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPP 232 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PP PPP PPPP Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PP PPP PPPP Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +2 Query: 2 QSLAMCPDSPQL*QPPPPP--PRPPPRPTPP*PPPPPPYPPPP 124 Q++ + P P PPPPP P PPP P PP PPPPPP PPPP Sbjct: 197 QNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 239 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PP PPP P PP PPPPPP PPPP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP + + PPPPP PPP P+PP PPPPPP P PP Sbjct: 195 CPQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPP 230 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P+PP PPPPPP P PP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 242 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P+PP PPPPPP P PP Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPP P PPPP Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPP-PPPPSPSPPPP 267 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTP--P*PPPPPPYPPPP 124 P SP PPPPPP PPP P P P PPPPPP P PP Sbjct: 238 PPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPP 274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 A C PQ P PP PPP P PP PPPPPP PPPP Sbjct: 190 AACDCCPQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPP 227 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/38 (60%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPP---PPPYPPPP 124 P P P PPPP PPP P+PP PPP PPP PPPP Sbjct: 243 PPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 [72][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1208 PPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPP 1242 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPRP PP P PPPP PPPP Sbjct: 1187 PGRPPPTAPSPPPPGQPPRPAPPPPSPPPPPPPPP 1221 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPP P PPPP Sbjct: 1203 PPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPP 1237 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P P PPPP P PPP P PP PP PPPP PPPP Sbjct: 1200 PGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPP 1235 [73][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +2 Query: 8 LAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 L P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPP P PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPP PP PPP P PP PPPPPP PPPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPP 81 [74][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 QPPPPPP PPP P PP PPPPPP PPPP Sbjct: 99 QPPPPPPPPPPPPPPPPPPPPPPPPPPP 126 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 101 PPPPPPPPPPPPPPPPPPPPPPPPPPP 127 [75][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPK 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP P PR Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPR 48 [76][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 166 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*P----PPPPPYPPPP 124 CP P PPPPPP PPP P+PP P PPPPP PPPP Sbjct: 130 CPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPP 169 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPPPP PPPP Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP PPPPPP PPPP Sbjct: 153 PPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPP 187 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP PPPPPP PPPP Sbjct: 155 PPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 189 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P PP PPPPPP PPPP Sbjct: 161 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 195 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPPPP PPPP Sbjct: 164 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 198 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP-PPYPPPP 124 P SP PPPPPP PPP P+PP PPPP PP PPPP Sbjct: 149 PPSP----PPPPPPSPPPPPSPPPPPPPSPPPPPPP 180 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPP P P P PP PPPPPP PPPP Sbjct: 157 PPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P + PPPPP PP P PP PPPPP PPPP Sbjct: 121 CPPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPP 156 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P+ PPPPPP PPP P P PPPP P PPPP Sbjct: 123 PPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPP 157 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP----*PPPPPPYPPPP 124 P P+ PPPP P PPP P+PP PPPPPP PPPP Sbjct: 125 PPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPP 163 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPPPP PP R Sbjct: 178 PPPPPPPPPPPPPPPPPPPPPPPPPVDR 205 [77][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/41 (58%), Positives = 26/41 (63%) Frame = +2 Query: 2 QSLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 +S + P P PPPPPP PPP P PP PP PPP PPPP Sbjct: 480 RSGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP PPPPPP PPPP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP PPPPPP PPPP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P PP PPPPPP PPPP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPPPP PP P Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP P PP PPPPPP P P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 [78][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 S P SP PPPPPP PPP P PP PPPPPP PPPP Sbjct: 371 SFGCSPPSPP---PPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPP---PYPPPP 124 P P PPPPPP PPP P PP PPPPP P PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 [79][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P+PP PPPPPP PPPP Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P + PPPPPP PPP P PP PPPPP PPPP Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PP PPP PPPP Sbjct: 239 PRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPP 273 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPP PPP P PP PPPPPP PP P Sbjct: 232 PSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSP 266 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SP+ PP PPP PPP P PP PPPPP PPPP Sbjct: 238 SPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPP 270 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SP PPPP P PPP P PP PPPPPP PPP Sbjct: 236 SPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPP 268 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPP PP P Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLP 285 [80][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PPPPPP PPPP Sbjct: 224 PPSP----PPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PP PPP P PP PPPPPP PPPP Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP S PPPPPP PPP P+PP PPPPP PPPP Sbjct: 196 CPTSRASKYPPPPPP-PPPSPSPPPSPPPPPSPPPP 230 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPP PPP P PP PP PPP PPPP Sbjct: 212 PPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPP PPP P+PP PPPPPP P PP Sbjct: 218 PPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 252 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPP-PRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP P PPP P PP PPPPP PPPP Sbjct: 225 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 [81][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SP PPPPPP PPP P+PP PPPPPP PPPP Sbjct: 224 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPP P PPPP+ Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPK 273 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP PP PPPPPP PPPP Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PP PPP P PP PPPPPP PPPP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SP PPPPPP PPP P P PPPPPP PPPP Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 254 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP P P P PP PPPPPP PPPP Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 23 DSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 D P PPPPP PPP P PP PP PPP PPPP Sbjct: 217 DRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPP 250 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP P PP Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P PP PPPPPP PPP Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP P PPPP P PP Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 [82][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 M P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 MEPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQP 46 [83][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P+P PPPPPP+PPPP Sbjct: 2055 PPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPP 2089 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PP PPP PPPP Sbjct: 2119 PSPPPPPSPPPPPPSPPPAPLPPPPPSPPPSPPPP 2153 [84][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 + P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 70 LTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVP 117 [85][TOP] >UniRef100_A7QDX1 Chromosome chr4 scaffold_83, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QDX1_VITVI Length = 157 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -3 Query: 117 GGYGGGGGGYGGVGRGGGR-GGGGGGCYNCGESGHMARDC 1 G +GGGGGG GGGR GGGGGGCYNCG+ GH AR+C Sbjct: 118 GRFGGGGGG------GGGRFGGGGGGCYNCGQEGHFAREC 151 [86][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 83 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 [87][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 + P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 [88][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 A P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 42 AHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [89][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [90][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 107 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPP R Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQR 108 [91][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SP PPPPPP PPP P+PP PPPPPP PPPP Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P P PPPPPP PPPP Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP+ PPPP P PPP P PP PPPPPP P PP Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPP 279 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPP PPPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP PP PPPPPP PPPP Sbjct: 258 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PP P Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP P P P PP PPPPPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP P PPPP PPP P PP PPP PP PPPP Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPP PP PPP P PP PPPPPP P PPR Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPR 301 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PP P P P PP PPPPPP PPPP Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPP 275 [92][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQ 101 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P L PPPPPP PPP P PP PPPPPP P PP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPP 91 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPP-PPPPPPSPPPP 93 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PP PPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP P PPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPP PP PPP P PP PPPPPP PPPP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPP 85 [93][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P PPPPPP P P P PP PPPPPP PPPP Sbjct: 287 CPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPP 322 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P PP PPP PPP P PP PPPPPP PPPP Sbjct: 246 CPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPP 281 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPT--PP*PPPPPPYPPPP 124 CP P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 261 CPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPP 298 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 298 PPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPP 331 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 281 PPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPP 315 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P P PPPP PPP P PP PPPPPP PP P Sbjct: 294 CPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCP 329 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPP--PPPYPPPP 124 P P PPPPPP PPP P PP PPP PPP PPPP Sbjct: 255 PPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPP 291 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP P PPPP PPPP Sbjct: 269 PPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPP 303 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPP P PPPP Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPP 324 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 5/41 (12%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPP-----PPPYPPPP 124 CP P PPPPP PPP P PP PPP PPP PPPP Sbjct: 304 CPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPP 344 [94][TOP] >UniRef100_Q9AXN2 RNA-binding protein n=1 Tax=Triticum aestivum RepID=Q9AXN2_WHEAT Length = 183 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RGGG GGG +GG GRGGGRGGGG CY CG+ GH AR+C Sbjct: 99 RGGGDRYGGGRDFGG-GRGGGRGGGGD-CYKCGKPGHFAREC 138 [95][TOP] >UniRef100_C6TFM2 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TFM2_SOYBN Length = 170 Score = 60.5 bits (145), Expect = 6e-08 Identities = 30/44 (68%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG--CYNCGESGHMARDC 1 R GG GGGG G GG GRGGG G GGG CYNCG GH+ARDC Sbjct: 78 RPGGFRGGGGRGIGG-GRGGGFGRRGGGPECYNCGRIGHLARDC 120 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/39 (61%), Positives = 27/39 (69%), Gaps = 4/39 (10%) Frame = -3 Query: 105 GGGGGYGGVGR----GGGRGGGGGGCYNCGESGHMARDC 1 GGGGG G GR GGG GGGG GC+NCGE G+ R+C Sbjct: 125 GGGGGVDGDGRNRRRGGGGGGGGRGCFNCGEEGYFVREC 163 [96][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [97][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [98][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = +2 Query: 8 LAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 +A ++P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 VASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [99][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [100][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPP R Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHR 42 [101][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPPPP PPP P PP PPPPPP PPP R Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLR 40 [102][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [103][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [104][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P L PPPPPP PPP P PP PPPPPP PPPP Sbjct: 135 PPPPPLLSPPPPPPSPPP-PPPPSPPPPPPSPPPP 168 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 A P SP L PPPPPP PPP P PP PPPP P PPPP Sbjct: 216 APSPPSPPLPPPPPPPPSPPP-PPPPSPPPPSPPPPPP 252 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPPP Sbjct: 1 PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPP 35 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P QPPPPP PPP P PP PPPPPP PPP Sbjct: 56 PPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPP 90 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP +PPP P+ P PPPPPP PPPP Sbjct: 49 PPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPP 83 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPP P PPPP Sbjct: 65 PPPPSSPPPPPPPPSPPP-PPPPSPPPPLPSPPPP 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPP P PPP P+PP PPP PP PPPP Sbjct: 4 PPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPP 38 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PP P PP PPPPPP PPP Sbjct: 32 PPPPPPPSPPSPLPPSPPPPPPPSPPP 58 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P P PPPPP PPPP Sbjct: 40 PPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPP 74 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 3/35 (8%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*P---PPPPPYPPPP 124 P L PPPPPP P P P PP P PPPPP PPPP Sbjct: 90 PPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPP 124 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRP--TPP*PPPPPPYPPPP 124 P P L PPPPPP PPP P +PP PPP PP PPPP Sbjct: 121 PPPPPL-SPPPPPPSPPPPPLLSPPPPPPSPPPPPPP 156 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 8/43 (18%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRP----PPRPTPP*PP----PPPPYPPPP 124 P P L PPPPPP P PP P+PP PP PPPP PPPP Sbjct: 96 PPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPP 138 [105][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 2802 PPPPPPTPPPPPPPPPPPPPPPPPPPPQ 2829 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP P P P PP PPPPPP PPPP Sbjct: 2800 PPPPPPPPTPPPPPPPPPPPPPPPPPP 2826 [106][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP P P PTPP PPPPPP PPPP Sbjct: 1935 PPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPP 1969 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPT---PP*PPPPPPYPPPP 124 P++P PPPPPP PPP PT PP PPPPPP PPPP Sbjct: 1929 PETPPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPP 1966 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P PP PPPPPP PPPP Sbjct: 1937 PPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPP 1971 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPP 109 SL+ P P L PPPPPP PPP P PP PPPPPP Sbjct: 3053 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPP 3087 [107][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P + PPPPPP PPP P+PP PPPPPP PPP Sbjct: 90 PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPP 123 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP P P P PP PPPPPP PPPP Sbjct: 108 PPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP P+PP PPPPPP PPP Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPP P PPPP Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P PP Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P PP PPPPPP PPPP Sbjct: 82 PPSPS--PPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPPPP PPPP Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 87 PPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPP 121 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 88 PPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPP 122 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPP P PPPP Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P PP Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPP-PPPPPPSPSPP 153 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 6/42 (14%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPR------PTPP*PPPPPPYPPPPR 127 P SP+ P PP PRPPPR P+PP P PPPP PPPPR Sbjct: 214 PPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPR 255 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/41 (58%), Positives = 27/41 (65%), Gaps = 6/41 (14%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPR------PTPP*PPPPPPYPPPP 124 P P+ PPPPPP PPP+ P+PP PPPPPP PPPP Sbjct: 60 PSGPEHPPPPPPPPPPPPQPPLPPSPSPP-PPPPPPVPPPP 99 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPP-PPPPRPPPRPTPP*PPPPPPYPPPP 124 P P QPP PP P PPP P PP PPPPPP PPPP Sbjct: 71 PPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPP 106 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P SP PP PPPRPPP P PP P PP P PP PR Sbjct: 193 PPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPR 228 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPP---PRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P P PP PPPPPP PPPP Sbjct: 91 PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P P PPPP PPP P PP PPPPPP PPP Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPP 148 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP P P Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPPPP PP P Sbjct: 77 PQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP P P P PP PPPPPP PPP Sbjct: 79 PPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPP 113 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP P PPPP PPPP Sbjct: 85 PSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P SP PP PPP PPPRP P PP PPP PPP Sbjct: 169 PPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPP 202 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P SP PP PPPRPPP P P PP PPP PPP Sbjct: 173 PPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPP 206 [108][TOP] >UniRef100_A9S1L9 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9S1L9_PHYPA Length = 187 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/52 (57%), Positives = 32/52 (61%), Gaps = 12/52 (23%) Frame = -3 Query: 120 GGGYGGGGGGYGGVG-RGGGRGGGGGG-----------CYNCGESGHMARDC 1 GGG GGG G+GG G RG GRGG G G CYNCGE GH+ARDC Sbjct: 96 GGGGDGGGRGFGGSGARGRGRGGRGSGGFGGVGGGDRPCYNCGEGGHIARDC 147 [109][TOP] >UniRef100_A9J0E5 DEAD box helicase n=1 Tax=Macrostomum lignano RepID=A9J0E5_9TURB Length = 929 Score = 60.1 bits (144), Expect = 8e-08 Identities = 30/52 (57%), Positives = 34/52 (65%), Gaps = 11/52 (21%) Frame = -3 Query: 123 GGGGYGGGGGGYG--GVGRGG-------GRGGGGGG--CYNCGESGHMARDC 1 GGGG+G GGG+G G GRGG G GGGGGG CY C +SGH AR+C Sbjct: 354 GGGGFGSRGGGFGSRGGGRGGFGASADDGAGGGGGGSVCYKCKQSGHFAREC 405 [110][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +2 Query: 8 LAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 L + P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1400 LTLTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP PTPP PPPPP PPPP Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PP PPP PPPP Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPP PP PPPP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPP P PPPP Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 [111][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPP PPP P PP PPPP P PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPTPPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPP PP PP P+ Sbjct: 47 PPPPPPPPPPPPPPPPPPPTPPPPPLPK 74 [112][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPP 70 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPP PPP P PP PPPP P PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPTPPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPP PP PP P+ Sbjct: 47 PPPPPPPPPPPPPPPPPPPTPPPPPLPK 74 [113][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 434 PPPPPPPPPPPPPPPTPPPPPPRPPPP 460 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP PTPP PPP PP PPPP Sbjct: 437 PPPPPPPPPPPPTPPPPPPRPPPPPPP 463 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP P PPPP PPPP Sbjct: 439 PPPPPPPPPPTPPPPPPRPPPPPPPPP 465 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 A P P PPPPPP P P P PP PPPPPP PPP Sbjct: 430 ASTPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPPPP 466 [114][TOP] >UniRef100_Q6ASX7 Glycine-rich RNA binding protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ASX7_ORYSJ Length = 162 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGH 16 GGGGYGGGGGGYGG GGG GGGGGG Y E G+ Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGY 127 [115][TOP] >UniRef100_Q10FE7 Os03g0670700 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10FE7_ORYSJ Length = 196 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGH 16 GGGGYGGGGGGYGG GGG GGGGGG Y E G+ Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGY 127 [116][TOP] >UniRef100_O22384 Glycine-rich protein n=1 Tax=Oryza sativa RepID=O22384_ORYSA Length = 162 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGH 16 GGGGYGGGGGGYGG GGG GGGGGG Y E G+ Sbjct: 92 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGY 127 [117][TOP] >UniRef100_B9T6D3 Cellular nucleic acid binding protein, putative n=1 Tax=Ricinus communis RepID=B9T6D3_RICCO Length = 266 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 7/49 (14%) Frame = -3 Query: 126 RGGGGYGGG--GGGYGGVG-----RGGGRGGGGGGCYNCGESGHMARDC 1 RGGGG G GGG+GG R GGGGGGCYNCG SGH+AR+C Sbjct: 96 RGGGGDGPAKRGGGFGGSWSSSSTRRNNNGGGGGGCYNCGGSGHIAREC 144 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RG G G GGG +GG G G GGGGC+NCGE GH AR+C Sbjct: 226 RGASGGGAGGGRFGGKG-----GSGGGGCFNCGEEGHFAREC 262 [118][TOP] >UniRef100_B8AP37 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AP37_ORYSI Length = 139 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGH 16 GGGGYGGGGGGYGG GGG GGGGGG Y E G+ Sbjct: 94 GGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGY 129 [119][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P+ + PPPPPP PPP P PP PPPPPP PPPP Sbjct: 36 PEVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [120][TOP] >UniRef100_Q9V3V0 Xl6 n=1 Tax=Drosophila melanogaster RepID=Q9V3V0_DROME Length = 258 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 4/46 (8%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGG-GRGGGGGG---CYNCGESGHMARDC 1 R GGG GGGGGG GG G GG RGGGG G CY CG GH AR C Sbjct: 85 RSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHC 130 [121][TOP] >UniRef100_Q6TEC0 Vasa-like protein n=1 Tax=Crassostrea gigas RepID=Q6TEC0_CRAGI Length = 758 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/53 (58%), Positives = 34/53 (64%), Gaps = 12/53 (22%) Frame = -3 Query: 123 GGGGYG--------GGGGGYGGVGR---GGGRGGGGG-GCYNCGESGHMARDC 1 GGGG+G G GGG+GG R GGG GGGGG GC NCGE GH AR+C Sbjct: 121 GGGGFGSKNDGESSGFGGGFGGGDRPPRGGGFGGGGGSGCRNCGEEGHFAREC 173 [122][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPPPP PPPP+ Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPQ 81 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P PPPP PPP P PP PPPPPP PPPP Sbjct: 51 PAPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = +2 Query: 2 QSLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 Q + P P PPPPPP PPP P PP PPPPPP P P Sbjct: 45 QPICCVPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQPLP 85 [123][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPPRPPP P PP PPPPPP PPP Sbjct: 336 PPPPPPRPPPPPPPPPPPPPPPPPPP 361 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 53 PPPRPPPRPTPP*PPPPPPYPPPP 124 PPP PPPRP PP PPPPPP PPPP Sbjct: 335 PPPPPPPRPPPPPPPPPPPPPPPP 358 [124][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PQ+ P PPPP PPP P PP PPPPPP PPPP Sbjct: 418 PQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPP 456 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPP PPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPLLPPPP 457 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 Q PPPPP PPP P PP PPPPPP P PP+ Sbjct: 144 QTPPPPPPPPPPPPPPPPPPPPPPPKPPK 172 [125][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 2342 QPPPPPPPPPPPPPPPPPPPPPPLPPP 2368 [126][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 1280 QPPPPPPPPPPPPPPPPPPPPPPLPPP 1306 [127][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 2342 QPPPPPPPPPPPPPPPPPPPPPPLPPP 2368 [128][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 2345 QPPPPPPPPPPPPPPPPPPPPPPLPPP 2371 [129][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 2404 QPPPPPPPPPPPPPPPPPPPPPPLPPP 2430 [130][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 2404 QPPPPPPPPPPPPPPPPPPPPPPLPPP 2430 [131][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPP 248 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP P P Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPTTP 251 [132][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPP 242 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 219 PPPPPPPPPPPPPPPPPPPPPPPPPPP 245 [133][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPPPPP 678 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPPPPPP 679 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPP 680 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPP 681 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 657 PPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 658 PPPPPPPPPPPPPPPPPPPPPPPPPPP 684 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPP 118 P P PPPPPP PPP P PP PPPPPP PP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 [134][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 SP PPPPPP PPP P PP PPPPPP PPP Sbjct: 305 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [135][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 SP PPPPPP PPP P PP PPPPPP PPP Sbjct: 467 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 [136][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPP 118 SP PPPPPP PPP P PP PPPPPP PP Sbjct: 258 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 [137][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 224 PPPPPPPPPPPPPPPPPPPPPPPPPPP 250 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPPPP 251 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPPP 252 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 227 PPPPPPPPPPPPPPPPPPPPPPPPPPP 253 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 228 PPPPPPPPPPPPPPPPPPPPPPPPPPP 254 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = +2 Query: 23 DSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 ++P PPPPPP PPP P PP PPPPPP PPP Sbjct: 222 EAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 + PPPPP PPP P PP PPPPPP PPPP Sbjct: 222 EAPPPPPPPPPPPPPPPPPPPPPPPPPP 249 [138][TOP] >UniRef100_C1E508 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E508_9CHLO Length = 867 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 8/50 (16%) Frame = -3 Query: 126 RGGGGYGGG--------GGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 +GGGG GG GGG+GG G GGG GG G C+ CG++GH RDC Sbjct: 741 QGGGGAGGNYNNYGGDAGGGWGGGGGGGGGGGQSGQCFTCGQTGHWTRDC 790 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGG YGGGGG RGGG GG G C+ CG+ GH ARDC Sbjct: 796 GGGQYGGGGG------RGGGSGGKSGKCHKCGQLGHWARDC 830 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGG 46 GGGGYGGGGGGYGG G GGG GGGGG Sbjct: 840 GGGGYGGGGGGYGGGGGGGGWGGGGG 865 [139][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P PPPP PPP P PP PPPPPP PPPP Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPP 69 [140][TOP] >UniRef100_A4RU01 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RU01_OSTLU Length = 413 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMAR 7 GGGG+GGGGGG+GG G GGG GGGGGG + SGHM R Sbjct: 229 GGGGFGGGGGGFGGGGFGGGGGGGGGGPF----SGHMER 263 [141][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 [142][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPP 524 [143][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 [144][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPP 146 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPPPP 147 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPPPP PP PR Sbjct: 123 PPPPPPPPPPPPPPPPPPPPPPPPPTPR 150 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD P P PPP PPP P PP PPPPPP PPPP Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPP 143 [145][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 CP P PPPPPP PPP P PP PPPPPP PP P Sbjct: 37 CPPPP----PPPPPPPPPPPPPPPPPPPPPPPPPAP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = +2 Query: 2 QSLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 Q L P P PPPPPP PPP P PP PPPP PY P R Sbjct: 33 QCLCCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAPYVYPRR 74 [146][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 841 PPPPPPPPPPPPPPPPPPPPPPPPPPP 867 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 12/50 (24%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PP------------PPPPYPPPP 124 A P P PPPPPP PPP P PP PP PPPP PPPP Sbjct: 838 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 887 [147][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 12/50 (24%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PP------------PPPPYPPPP 124 A P P PPPPPP PPP P PP PP PPPP PPPP Sbjct: 916 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 [148][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 12/50 (24%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PP------------PPPPYPPPP 124 A P P PPPPPP PPP P PP PP PPPP PPPP Sbjct: 916 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 [149][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPP 2361 [150][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 6/44 (13%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PP------PPPPYPPPP 124 A+ P P PPPPPP PPP P PP PP PPPP PPPP Sbjct: 1031 AVPPPPPPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPP 1074 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/40 (60%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*-----PPPPPPYPPPP 124 P P PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1037 PPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPP 1076 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 6/41 (14%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*P------PPPPPYPPPP 124 P P PPPPPP PPP P PP P PPPPP PPPP Sbjct: 1035 PPPPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPP 1075 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 6/41 (14%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTP------P*PPPPPPYPPPP 124 P P PPPPPP PPP P P P PPPPPP PPPP Sbjct: 1038 PPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPP 1078 [151][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P PPPP PPP P PP PPPPPP PPPP Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYP---PPP 124 P P PPPPPP PPP P PP PPPPPP P PPP Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFILPPP 305 [152][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 985 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1011 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 986 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1012 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 987 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1013 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PPPP Sbjct: 988 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1014 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPP 118 SP PPPPPP PPP P PP PPPPPP PP Sbjct: 984 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1014 [153][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPP 2361 [154][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 QPPPPPP PPP P PP PPPPPP PPP Sbjct: 2335 QPPPPPPPPPPPPPPPPPPPPPPLPPP 2361 [155][TOP] >UniRef100_UPI0000E468D6 PREDICTED: similar to laminin alpha chain n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E468D6 Length = 3053 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGE 25 GGGG GGGGGG GG G GGG GGGGGGCY+ G+ Sbjct: 1939 GGGGGGGGGGGGGGGGGGGGGGGGGGGCYSGGD 1971 [156][TOP] >UniRef100_UPI00005A3A5F PREDICTED: similar to zinc finger protein 312 isoform 4 n=1 Tax=Canis lupus familiaris RepID=UPI00005A3A5F Length = 470 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGG GGGGGG GG G GGG GGGGGG CG SG +C Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGGGAPVCGASGLCKTNC 142 [157][TOP] >UniRef100_UPI00006A0DA0 zinc finger homeodomain 4 n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A0DA0 Length = 1612 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 11/48 (22%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPRPPPRPT-----------PP*PPPPPPYPPPP 124 + P SP+ PPPPPP PPP PT PP PPPPPP PPPP Sbjct: 23 IAPSSPETPPPPPPPPPPPPPPTSLPAQALPPAPPPTPPPPPPPPPPP 70 [158][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 +L P P L PPPPP PPP P PP PPPPPP PPPP Sbjct: 72 TLGSVPPPPPL---PPPPPLPPPPPLPPPPPPPPPLPPPP 108 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP P PP PPPPPP PPP Sbjct: 90 PPPPLPPPPPPPPPLPPPPPLPP-PPPPPPLPPP 122 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPP-PPPRPPPRPTPP*PPPPPPYPPPP 124 P P L PPP PPP PPP P PP PP PPP PPPP Sbjct: 83 PPPPPLPPPPPLPPPPPPPPPLPPPPPLPPPPPPPP 118 [159][TOP] >UniRef100_Q3MC83 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC 29413 RepID=Q3MC83_ANAVT Length = 387 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD+P PPPPPP PPP P P PPPPPP PPPP Sbjct: 313 PDNPD---PPPPPPDPPPPPPPDPPPPPPPDPPPP 344 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 318 PPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPP 352 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 326 PPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPP 360 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 334 PPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPP 368 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 342 PPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPP 376 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 350 PPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPP 384 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD P PPPP P PPP P PP PPPP P PPPP Sbjct: 323 PDPPP---PPPPDPPPPPPPDPPPPPPPDPPPPPP 354 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPP Sbjct: 325 PPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 359 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD P PPPP P PPP P PP PPPP P PPPP Sbjct: 331 PDPPP---PPPPDPPPPPPPDPPPPPPPDPPPPPP 362 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPP Sbjct: 333 PPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 367 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD P PPPP P PPP P PP PPPP P PPPP Sbjct: 339 PDPPP---PPPPDPPPPPPPDPPPPPPPDPPPPPP 370 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPP Sbjct: 341 PPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 375 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD P PPPP P PPP P PP PPPP P PPPP Sbjct: 347 PDPPP---PPPPDPPPPPPPDPPPPPPPDPPPPPP 378 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPP Sbjct: 349 PPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 383 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD P PPPP P PPP P PP PPPP P PPPP Sbjct: 355 PDPPP---PPPPDPPPPPPPDPPPPPPPDPPPPPP 386 [160][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGYGG G GGG GGGGGG Y G G Sbjct: 90 GGGGYGGGGGGYGG-GGGGGYGGGGGGGYGGGGGG 123 [161][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGYGG G GGG GGGGGG Y G G Sbjct: 119 GGGGYGGGGGGYGG-GGGGGYGGGGGGGYGGGGGG 152 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGG G G GGG GGGGGG Y G G Sbjct: 126 GGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGGGGG 160 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGG G G GGG GGGGGG Y G G Sbjct: 134 GGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGGGGG 168 [162][TOP] >UniRef100_C1ZIK1 RRM domain-containing RNA-binding protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZIK1_PLALI Length = 146 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGYGG G GGG GGGGGG Y G G Sbjct: 111 GGGGYGGGGGGYGGGGGGGGYGGGGGG-YGGGGGG 144 [163][TOP] >UniRef100_A8JAG8 Argonaute-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JAG8_CHLRE Length = 1037 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 6/39 (15%) Frame = -3 Query: 126 RGGGGYGGGG------GGYGGVGRGGGRGGGGGGCYNCG 28 RGGGGYGGGG GGYGG G GGGRGGGGGG Y G Sbjct: 38 RGGGGYGGGGRGGGGGGGYGGGGGGGGRGGGGGGGYGGG 76 [164][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP PPPPPP PPPP Sbjct: 1549 PSPPPSPPPPSPPPSPPPPPPPPSPPPPPPSPPPP 1583 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P SP PPP PP PPP P+PP PPP PP PPP Sbjct: 1552 PPSPPPPSPPPSPPPPPPPPSPPPPPPSPPPPPP 1585 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P SP PPPPPP P P P PP PPPPPP PPP Sbjct: 1557 PPSPPP-SPPPPPPPPSPPPPPPSPPPPPPSPPP 1589 [165][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 7/42 (16%) Frame = +2 Query: 20 PDSPQL*QPPPPPP-------RPPPRPTPP*PPPPPPYPPPP 124 P SP+ PPPPPP +P P PTPP PPPPPP PPPP Sbjct: 779 PSSPETPPPPPPPPPLPPAPPQPAPAPTPPPPPPPPPPPPPP 820 [166][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P SP PPPPPP PPP P PP PP PPPP PPPP Sbjct: 305 PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP 342 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P SP PPPPPP PPP P PP PP PPPP PPPP Sbjct: 361 PPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP 398 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P+PP PPPPPP PPPP Sbjct: 134 PPPPSPPPPSPPPPSPPPPPSPP-PPPPPPSPPPP 167 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPP-PPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP PP PPP P+PP P PPPP PPPP Sbjct: 246 PPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPP 281 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRP-PPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP P PP P+PP P PPPP PPPP Sbjct: 251 PPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPP 286 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P+PP P PPPP PPPP Sbjct: 400 PPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPP 434 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPP--PRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPP P PPP P+PP P PPPP PPPP Sbjct: 141 PPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPP 177 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP-PPYPPPP 124 P SP PPPPP PPP P PP PPPP PP PPPP Sbjct: 407 PPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPP 442 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP--PPPPYPPPP 124 P SP PPPP P PPP P PP PP PPPP PPPP Sbjct: 136 PPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPP 172 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P+PP P PPPP PPPP Sbjct: 149 PPPPPSPPPPPPPPSPPP-PSPPPPSPPPPSPPPP 182 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRP-PPRPTPP*PPPPPPYPPPP 124 P SP QPPP PP P PP P+PP P PPPP PPPP Sbjct: 117 PPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPP 152 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P+PP P PPPP PPPP Sbjct: 418 PPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPP 452 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P+PP P PPPP PPPP Sbjct: 423 PPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPP 457 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP P PPPP PPPP Sbjct: 428 PPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPP 462 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP P PPPP PPPP Sbjct: 433 PPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 467 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P PP PPPP P PP P Sbjct: 402 PPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSP 436 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P PP PPPPPP P PP Sbjct: 131 PPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPP 165 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/38 (60%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P P PPPPP PPP P PP PP PPPP PPPP Sbjct: 150 PPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 187 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/38 (60%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P P PPPPP PPP P PP PP PPPP PPPP Sbjct: 254 PPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 291 [167][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 253 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPP 287 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP-PPYPPPPR 127 P SP PPPP P PPP P+PP PPPP PP PPPPR Sbjct: 247 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPR 283 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 261 PPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPP 295 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P SP PP PPP PPPRP PP PP PPPP PPPP Sbjct: 265 PPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPP 300 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPP--PPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP PP PPPRP PP PPPP P PPPP Sbjct: 299 PPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPP 335 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P P PPPPPP PPP P+PP PP PPPP PPPP Sbjct: 323 PSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPP 360 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPPRPPP P+PP P PPPP PPPP Sbjct: 341 PPSP----PPPPPPRPPP-PSPPPPSPPPPSPPPP 370 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P SP PP PPP PPPRP PP PP PPPP PPPP Sbjct: 369 PPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 406 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P SP PP PPP PPPRP PP PP PPPP PPPP Sbjct: 400 PPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 437 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P PP PPPPPP PPP Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPP 286 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRP--TPP*PPPPPPYPPPP 124 P P PPPPPPRPPP P +PP P PPPP PPPP Sbjct: 269 PPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P +PPPPPP PP P+PP P PPPP PPPP Sbjct: 276 PPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPP 310 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPR-PPPRPTPP*PPPPPPYPPPP 124 P P PPPPPPR PPP P PP PPPPPP PPP Sbjct: 305 PSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPP 340 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPP-RPTPP*PPPPPPYPPPP 124 P P PPPPPPRPPP P PP PPPP P PPPP Sbjct: 373 PPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPPP 408 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 245 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 279 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 357 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P SP PPPP P PPP P+PP PP PPPP PPPP Sbjct: 359 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPP 396 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 388 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPP 422 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P SP PPPP P PPP P+PP PP PPPP PPPP Sbjct: 390 PPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPP 427 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP PPPP P PPPP Sbjct: 255 PPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPP 289 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P PP P PPPP PPPP Sbjct: 367 PPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPP 401 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P PP P PPPP PPPP Sbjct: 398 PPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPP 432 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPP Sbjct: 260 PPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPP 294 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P PPPP P PPP P+PP PPP PP PPPPR Sbjct: 317 PPRPPPPSPPPPSPPPPPPPSPP-PPPSPPPPPPPR 351 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P+ P PPPP PPP PP PPP PP PPPPR Sbjct: 383 PPPPRPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPR 418 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P PPPPPP PPPP Sbjct: 237 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 271 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P PPPPPP PPPP Sbjct: 289 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPP 323 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P P P PPPP PPP PP PPP PP PPPPR Sbjct: 352 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPR 387 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/42 (57%), Positives = 24/42 (57%), Gaps = 6/42 (14%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP------PPYPPPPR 127 P P PPPPP PPP P PP PPPP PP PPPPR Sbjct: 278 PPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPR 319 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P PP P PPPP PPPP Sbjct: 294 PPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPP 328 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPP-PRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP P PPP P PP P PPPP PPPP Sbjct: 330 PPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPP 365 [168][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 266 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 300 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 323 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 367 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 421 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 455 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 481 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 463 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 437 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP P PPPP PPPP Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP P PPPP PPPP Sbjct: 242 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP P PPPP PPPP Sbjct: 294 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P+PP P PPPP PPPP Sbjct: 299 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 333 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP P PPPP PPPP Sbjct: 524 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP PPPP P PPPP Sbjct: 260 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP PPPP P PPPP Sbjct: 317 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP PPPP P PPPP Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP PPPP P PPPP Sbjct: 415 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP PPPP P PPPP Sbjct: 475 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P PP PPPPPP PPP Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 299 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPP P PPPP Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P PP PPPPPP PPP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P PP PPPPPP PPP Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 400 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P PP PPPPPP PPP Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 454 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P PP PPPPPP PPP Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 514 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP P PPPP PPPP Sbjct: 276 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP P PPPP PPPP Sbjct: 333 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P+PP P PPPP PPPP Sbjct: 338 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 372 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP P PPPP PPPP Sbjct: 377 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P+PP P PPPP PPPP Sbjct: 382 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP P PPPP PPPP Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 481 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P+PP P PPPP PPPP Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 486 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP P PPPP PPPP Sbjct: 491 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P+PP P PPPP PPPP Sbjct: 496 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 530 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP---*PPPPPPYPPPP 124 P SP PPPPPP PP P+PP PPPPPP PPPP Sbjct: 229 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP---*PPPPPPYPPPP 124 P SP PPPPPP PP P+PP PPPPPP PPPP Sbjct: 247 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 284 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 258 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 292 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P SP PP PPP PPP P PP PP PPPP PPPP Sbjct: 270 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 349 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P SP PP PPP PPP P PP PP PPPP PPPP Sbjct: 327 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 362 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 393 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P SP PP PPP PPP P PP PP PPPP PPPP Sbjct: 371 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 406 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 447 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP PPPP P PPPP Sbjct: 423 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP PPPP P PPPP Sbjct: 431 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P SP PP PPP PPP P PP PP PPPP PPPP Sbjct: 441 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 473 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 507 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P SP PP PPP PPP P PP PP PPPP PPPP Sbjct: 485 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 520 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPP Sbjct: 283 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 317 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 462 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPP Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 470 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP P PPPP PPPP Sbjct: 343 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 377 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP P PPPP PPPP Sbjct: 387 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP P PPPP PPPP Sbjct: 457 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 491 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP P PPPP PPPP Sbjct: 501 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 535 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P PPPPPP PPPP Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P PP P PPPP PPPP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP PPPP P PPPP Sbjct: 252 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P PPPPPP PPPP Sbjct: 351 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P PPPPPP PPPP Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P PPPPPP PPPP Sbjct: 465 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P PPPPPP PPPP Sbjct: 514 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P PP P PPPP PPPP Sbjct: 519 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP---*PPPPPPYPPPP 124 P P PPPPPP PP P+PP PPPPPP PPPP Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318 [169][TOP] >UniRef100_O23646 RSZp22 protein n=1 Tax=Arabidopsis thaliana RepID=O23646_ARATH Length = 200 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RGGGG GG GG GG GRGG RGG CY CGE+GH AR+C Sbjct: 75 RGGGGRGGDRGG-GGAGRGG-RGGSDLKCYECGETGHFAREC 114 [170][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/39 (64%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = +2 Query: 14 MCPDSPQL*QPPPPPPR--PPPRPTPP*PPPPPPYPPPP 124 + P P L PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1207 LTPPPPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPPPPP 1245 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 47 PPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPP PPP P PP PPPPPP PPPP Sbjct: 1203 PPPPLTPPPPPLPPPPPPPPPLPPPP 1228 [171][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 QPPPPPP PP P PP PPPPPP PPPP Sbjct: 41 QPPPPPPPPPASPPPPPPPPPPPPPPPP 68 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PP P PP PPPPPP PPPP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPP 71 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/40 (60%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPP-----PYPPPP 124 P P PPPPPP PPP P PP PPPPP P PPPP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/37 (62%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPP--YPPPP 124 P P PPPPPP PPP PP PPPPPP PPPP Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPP 1978 [172][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 QPPPPPP PP P PP PPPPPP PPPP Sbjct: 41 QPPPPPPPPPASPPPPPPPPPPPPPPPP 68 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PP P PP PPPPPP PPPP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPP 71 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPP PPP P PP PPPPPP PPPP Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/40 (60%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPP-----PYPPPP 124 P P PPPPPP PPP P PP PPPPP P PPPP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/37 (62%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPP--YPPPP 124 P P PPPPPP PPP PP PPPPPP PPPP Sbjct: 1845 PPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPP 1881 [173][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +2 Query: 23 DSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 D+P+L PPPPPP PPP P PP PP PPP PPP Sbjct: 347 DAPKLMPPPPPPPPPPPPPPPPPPPRPPPPPPP 379 [174][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PPP P P PPPPPP PPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPP 308 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPP---PRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P P PP PPPPPP PPPP Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPP 315 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPP PP P PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPSPPAPAPP 299 [175][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPP P PPPPR Sbjct: 420 PPPPPPPPPPPPPPPPPPPPTPPPPPPR 447 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 47 PPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPP PPP P PP PPPPPP PPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPTPPPP 444 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P P PPPPPP PPP PTPP PPP PP PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPTPPPPPPRPPSPPP 453 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PP P Sbjct: 425 PPPPPPPPPPPPPPPTPPPPPPRPPSP 451 [176][TOP] >UniRef100_C4J159 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4J159_MAIZE Length = 261 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGYGG G GGG GGG GG Y G SG Sbjct: 121 GGGGYGGGGGGYGGGGYGGGYGGGSGG-YGGGGSG 154 [177][TOP] >UniRef100_C4QPC6 Cellular nucleic acid binding protein, putative n=1 Tax=Schistosoma mansoni RepID=C4QPC6_SCHMA Length = 141 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/63 (47%), Positives = 33/63 (52%), Gaps = 22/63 (34%) Frame = -3 Query: 123 GGGGYGGGGG-----GYGGVGR-----------------GGGRGGGGGGCYNCGESGHMA 10 GGGGYGG GG GG G GGG GGGGG CY+CGESGH+ Sbjct: 30 GGGGYGGYGGRDKCFNCGGTGHFARDCTNDGQRGDSGYNGGGGGGGGGRCYSCGESGHIV 89 Query: 9 RDC 1 R+C Sbjct: 90 RNC 92 [178][TOP] >UniRef100_C4QPC5 Cellular nucleic acid binding protein, putative n=1 Tax=Schistosoma mansoni RepID=C4QPC5_SCHMA Length = 190 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/63 (47%), Positives = 33/63 (52%), Gaps = 22/63 (34%) Frame = -3 Query: 123 GGGGYGGGGG-----GYGGVGR-----------------GGGRGGGGGGCYNCGESGHMA 10 GGGGYGG GG GG G GGG GGGGG CY+CGESGH+ Sbjct: 79 GGGGYGGYGGRDKCFNCGGTGHFARDCTNDGQRGDSGYNGGGGGGGGGRCYSCGESGHIV 138 Query: 9 RDC 1 R+C Sbjct: 139 RNC 141 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGRGGGRG-----GGGGGCYNCGESGHMARDC 1 GGG GGGGG GG G GGGR G GC+NCG H ARDC Sbjct: 24 GGGRGGGGGYRGGRGGGGGRDRDNNDGRRDGCFNCGGLDHYARDC 68 [179][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 QPPPPPP PPP P PP PPP PP PPPP Sbjct: 271 QPPPPPPPPPPLPPPPPPPPLPPQPPPP 298 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PP PPP PPPP Sbjct: 276 PPPPPPLPPPPPPPPLPPQPPPPPPPP 302 [180][TOP] >UniRef100_A7SMB3 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SMB3_NEMVE Length = 218 Score = 58.2 bits (139), Expect = 3e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGYGG G GGG G GGGG Y G SG Sbjct: 161 GGGGYGGGGGGYGGSGYGGGGGYGGGG-YGGGRSG 194 [181][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 23 DSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 D P PPPPPP PPP P PP P PPPP PPPP Sbjct: 201 DFPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPP 234 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P L PPPPPP PPP P PP PPPPPP PPP Sbjct: 209 PPPPPL--PPPPPPPPPPSPPPPSPPPPPPPSPPP 241 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PP P+PP PPPP P PPPP Sbjct: 223 PPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPP PPP P PP PPPP P PPPP Sbjct: 1178 PPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPP 1212 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PPP P PP PPPPPP PPP Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPP 254 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 PPPPPP PPP P PP PP PPPP PPPP Sbjct: 2286 PPPPPPTPPPSPPPPSPPPPSPPPPSPPPP 2315 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP---PPYPPPP 124 P SP PP PPP PPP P PP PPPP PP PPPP Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPP 2563 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPP PP PP P+PP P PPPP PPPP Sbjct: 2677 PPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPP 2711 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP---*PPPPPPYPPPP 124 P P PPPP P PPP P+PP PPPPPP PPPP Sbjct: 218 PPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPP 255 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP---PPYPPPP 124 P P PPPP P PPP P PP PPPP PP PPPP Sbjct: 1173 PSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPP 1210 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP---PPYPPPP 124 P P P PPPP PPP P PP PPPP PP PPPP Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPP 2735 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SP PPPP P PPP P PP PPPP P PPPP Sbjct: 204 SPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPP 236 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/27 (77%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = +2 Query: 47 PPPPPRPPPRPTPP*PPP-PPPYPPPP 124 PPPPP PPP P PP PPP PPP PPPP Sbjct: 2670 PPPPPSPPPSPPPPSPPPSPPPSPPPP 2696 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/36 (63%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPP-PRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P+PP P PPPP PPPP Sbjct: 2695 PPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPP 2730 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/36 (63%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRP-PPRPTPP*PPPPPPYPPPP 124 P SP PPP PP P PP P+PP P PPPP PPPP Sbjct: 2705 PPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2740 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PP P+PP P PPPP PPPP Sbjct: 2711 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2745 [182][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 90 PPPPPPPPPPPPPSPPPPSPPPPSPPPPPPPPPPP 124 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP PPP P PP PPPPPP PPPP Sbjct: 95 PPPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPP 129 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P P P PPPP PPP P PP PP PPPP PPPP Sbjct: 99 PPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPP 134 [183][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P+PP P PPPP PPPP Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP P PPPP PPPP Sbjct: 196 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 230 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P+PP P PPPP PPPP Sbjct: 201 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 235 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P P PPPPPP PPPP Sbjct: 186 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 220 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P SP PPPP P PPP P+PP PP PPPP PPPP Sbjct: 188 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 225 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 211 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/38 (60%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPR--PPPRPTPP*PPPPPPYPPPP 124 CP + PPPPPP PPP P+PP P PPPP PPPP Sbjct: 167 CPVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 204 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SP PP PPP PPP P PP PPPP P PPPP Sbjct: 174 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 206 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP P PPPP PPPP Sbjct: 206 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P+PP PPPP P PPPP Sbjct: 180 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 214 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P P PPPPPP PPPP Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PP P PP P PPPP PPPP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP---*PPPPPPYPPPP 124 P P PPPPPP PP P+PP PPPPPP PPPP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 212 [184][TOP] >UniRef100_A9TWI4 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWI4_PHYPA Length = 818 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 C P PPPP P PPP P PP PPPPPP PPPP Sbjct: 477 CTLPPPPPSPPPPSPPPPPSPPPPSPPPPPPSPPPP 512 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPR--PTPP*PPPPPPYPPPP 124 P SP PPPPP PPP P PP PPPPPP PPPP Sbjct: 483 PPSPPPPSPPPPPSPPPPSPPPPPPSPPPPPPSPPPP 519 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPP PP PPP P PP P PPPP PPPP Sbjct: 494 PPSP----PPPSPPPPPPSPPPPPPSPPPPSPPPP 524 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPP-PYPPPP 124 P P PPP PP PPP P PP PPPPP P PPPP Sbjct: 497 PPPPSPPPPPPSPPPPPPSPPPPSPPPPPSPSPPPP 532 [185][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPP P PP PPPPPP PPPP Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD P P PPP PPP P PP PPPPPP PPPP Sbjct: 109 PDPPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPP 143 [186][TOP] >UniRef100_A9J0E2 DEAD box helicase n=1 Tax=Macrostomum lignano RepID=A9J0E2_9TURB Length = 860 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/44 (56%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGR----GGGRGGGGGGCYNCGESGHMARDC 1 GGG+G GGG GG G G G GGGG CY C +SGH AR+C Sbjct: 266 GGGFGSRGGGRGGFGASADDGAGGGGGGSVCYKCNQSGHFAREC 309 [187][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP+ PP PPPPPP PPPP Sbjct: 366 PPPPPPPPPPKGAPPPPPPPPPPPPPP 392 [188][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/40 (62%), Positives = 26/40 (65%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SL+ P P L PPPPPP PPP P PPPPPP PPPP Sbjct: 3055 SLSSAPSKPLLQTPPPPPPPPPPPP----PPPPPPPPPPP 3090 [189][TOP] >UniRef100_A2C5L0 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9303 RepID=A2C5L0_PROM3 Length = 202 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 123 GGGGYGGGGGGY--GGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGY GG G GGG GGGGGG Y G G Sbjct: 109 GGGGYGGGGGGYGGGGGGYGGGGGGGGGGGYGGGGGG 145 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 4/40 (10%) Frame = -3 Query: 123 GGGGYGGGGGGY----GGVGRGGGRGGGGGGCYNCGESGH 16 GGGGYGGGGGGY GG G GGG GGGGG Y G G+ Sbjct: 88 GGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGY 127 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 123 GGGGYGGGGGGY----GGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGY GG G GGG GGGGG Y G G Sbjct: 95 GGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 133 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGR-GGGGGGCYNCGESGHMAR 7 GGGGYGGGGGGYGG G GGG G GGGG G+ G AR Sbjct: 116 GGGGYGGGGGGYGGGGGGGGGGGYGGGGGGGGGDRGSGAR 155 [190][TOP] >UniRef100_C4B111 Intracellular motility protein A n=4 Tax=Burkholderia mallei RepID=C4B111_BURMA Length = 373 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P+PP P PPPP PPPP Sbjct: 96 PPPPPPPPPPPPSPPPPSPPPPSPPPP 122 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP P PPPP PPPP Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPP 117 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP---PPYPPPP 124 P P PPPPPP PPP P PP PPPP PP PPPP Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPP 127 [191][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 123 GGGGY--GGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGY GGGGGGYGG G GGG GGGGG Y G SG Sbjct: 121 GGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSG 157 [192][TOP] >UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y7_VOLCA Length = 687 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 6/41 (14%) Frame = +2 Query: 20 PDSPQL*QPPP------PPPRPPPRPTPP*PPPPPPYPPPP 124 P SP+ PPP PPPRPPPRP+ P PPPP P PPPP Sbjct: 509 PPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPP 549 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD P P PPPP PPP P PP P PPPP PPPP Sbjct: 587 PDPPSAPPPSPPPPSPPP-PNPPPPSPPPPNPPPP 620 [193][TOP] >UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE Length = 3889 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPRPPPRP PP PPPPPP PP P Sbjct: 731 PPKPSPPPRPSPPPRPPPRPLPPSPPPPPPLPPNP 765 [194][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P SP PPPPP PPP PTPP PP PPP PPP Sbjct: 847 PPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP 880 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*P--PPPPPYPPPP 124 P P PPPPPP PPP P PP P PPPPP PPPP Sbjct: 799 PPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPP 835 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +2 Query: 8 LAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 L SP PPP PP PPP P+PP PPPPP PPPP Sbjct: 780 LGQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPP 818 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPP PP PP PTPP PPPPP PPPP Sbjct: 802 PPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPP 836 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P +P PP PPP PPP P PP PPPPP PPP Sbjct: 863 PPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPP 896 [195][TOP] >UniRef100_O81126 9G8-like SR protein n=1 Tax=Arabidopsis thaliana RepID=O81126_ARATH Length = 200 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RGGGG GG GG GG GRGG RGG CY CGE+GH AR+C Sbjct: 75 RGGGGRGGDRGGGGG-GRGG-RGGSDLKCYECGETGHFAREC 114 [196][TOP] >UniRef100_A9SQ74 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SQ74_PHYPA Length = 178 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/55 (50%), Positives = 30/55 (54%), Gaps = 15/55 (27%) Frame = -3 Query: 120 GGGYGGGGGGYGGVGRGGGRGGGGGG---------------CYNCGESGHMARDC 1 G G GGG G GG GRG GRGG G G CYNCGE GH+AR+C Sbjct: 90 GAGEGGGRGTVGGAGRGRGRGGRGVGGFVGERSGAAGGERTCYNCGEGGHIAREC 144 [197][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PPPPPP PP P Sbjct: 256 PPSP----PPPPPPSPPPPPPPPPPPPPPPPPPSP 286 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPPPP PPPP Sbjct: 251 PPSPL---PPSPPPPPPPSPPPPPPPPPPPPPPPP 282 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP P PP P PPP P+PP PPPPPP PPPP Sbjct: 246 PPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPP 280 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PPP P PP PPPP P PPPP Sbjct: 257 PSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPP 291 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPP---PPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP PP PPP P P PPPPPP PPPP Sbjct: 241 PPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPP 278 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P P PPPP PP P PP PPPPPP PPPP Sbjct: 249 PPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPP 283 [198][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P +P PPPPPP PPP P PP PP PPPP PPPP Sbjct: 417 PPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPP 452 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP-PPYPPPP 124 P SP PP PPP PPP P PP PPPP PP+PPPP Sbjct: 412 PPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPP 447 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPPPP PPP P PP PPPP P PP P Sbjct: 420 PPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSP 454 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPP-PPYPPPP 124 P SP PPPPPP PPP P PP P PP PP PPPP Sbjct: 456 PPSPAPPSPPPPPPPPPPSPYPPSPAPPLPPSPPPP 491 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP P PP P PP P+PP PPPPPP PPPP Sbjct: 402 PPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPP 436 [199][TOP] >UniRef100_A7Z068 LMOD2 protein n=1 Tax=Bos taurus RepID=A7Z068_BOVIN Length = 553 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/47 (55%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Frame = +2 Query: 2 QSLAMCPDSPQL*QPPPPPPRPPPRPTPP*P------PPPPPYPPPP 124 Q++ P SP PPPPPP PPP P PP P PPPPP PPPP Sbjct: 408 QTVRSRPPSPAAPPPPPPPPPPPPPPPPPPPLAPQRLPPPPPPPPPP 454 [200][TOP] >UniRef100_B3NWD3 GG19108 n=1 Tax=Drosophila erecta RepID=B3NWD3_DROER Length = 176 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGH 16 GGGGYGGGGGG GG G GGG GGG GG G GH Sbjct: 28 GGGGYGGGGGGQGGYGGGGGGGGGQGGYQKNGGGGH 63 [201][TOP] >UniRef100_C5FRH2 Zinc knuckle domain-containing protein n=1 Tax=Microsporum canis CBS 113480 RepID=C5FRH2_NANOT Length = 185 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 +GG GYG GG G G G GG GG GG CY+CG GHMARDC Sbjct: 106 QGGSGYGSGGYGNSGSGSYGGGGGYGGRSQTCYSCGGYGHMARDC 150 [202][TOP] >UniRef100_Q9S8M0 Chitin-binding lectin 1 n=1 Tax=Solanum tuberosum RepID=LECT_SOLTU Length = 323 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPP P PPPP Sbjct: 163 PPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPP 197 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRP-PPRPTPP*PPPPPPYPPPP 124 C +L PPPPPP P PP P+PP PPPP P PPPP Sbjct: 143 CQSQCKLPSPPPPPPPPSPPPPSPPSPPPPSPPPPPP 179 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = +2 Query: 2 QSLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 QS P P PP PPP PP P PP PPPPPP PPP Sbjct: 144 QSQCKLPSPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPP 184 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPP P PPP P+PP P PPPP P PP Sbjct: 161 PPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPP 195 [203][TOP] >UniRef100_Q99070 Glycine-rich RNA-binding protein 2 n=1 Tax=Sorghum bicolor RepID=GRP2_SORBI Length = 168 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGYGG GGG GGGGG N G+SG Sbjct: 129 GGGGYGGGGGGYGGREGGGGYGGGGGYGGNRGDSG 163 [204][TOP] >UniRef100_UPI0000E7FF28 PREDICTED: similar to zinc-finger homeodomain protein 4 isoform 2 n=1 Tax=Gallus gallus RepID=UPI0000E7FF28 Length = 3618 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPP 109 SL+ P P L PPPPPP PPP P PP PPPPPP Sbjct: 3139 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPP 3173 [205][TOP] >UniRef100_UPI0000ECD10B Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10B Length = 3578 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPP 109 SL+ P P L PPPPPP PPP P PP PPPPPP Sbjct: 3099 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPP 3133 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/52 (48%), Positives = 26/52 (50%), Gaps = 17/52 (32%) Frame = +2 Query: 20 PDSPQL*QPPPPPPR-----------------PPPRPTPP*PPPPPPYPPPP 124 P SP+ PPPPPP PPP P PP PPPPPP PPPP Sbjct: 1956 PSSPETPPPPPPPPSSAGAGKIQNTTPTPLQAPPPTPPPPPPPPPPPPPPPP 2007 [206][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P P PPPPPP PPPP Sbjct: 128 PPPPPPAPPPAPPAPPPPPPPPPPPPP 154 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP P P P PP PPPPPP PPPP Sbjct: 118 PAPPPAPPAPPPPPPPAPPPAPPAPPPPPPPPPPP 152 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P +P PPPPP PP P PP PPPPPP PPP Sbjct: 121 PPAPPAPPPPPPPAPPPAPPAPPPPPPPPPPPPP 154 [207][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 +P +P PPPP PPP P PP PPPPPP PPPP Sbjct: 56 APAQARPTPPPPPPPPPPPPPPPPPPPPPPPPP 88 [208][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 PPPPPP PPP P PP PPPPPP PPP + Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPAK 272 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 +P PPP PPP P PP PPPPPP PPPP Sbjct: 241 EPAAPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPAKP 273 [209][TOP] >UniRef100_Q9SJA6 Putative RSZp22 splicing factor n=1 Tax=Arabidopsis thaliana RepID=Q9SJA6_ARATH Length = 196 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 RGGGG G GGG GG G GRGG CY CGESGH AR+C Sbjct: 72 RGGGG--GRGGGRGGGDGGRGRGGSDLKCYECGESGHFAREC 111 [210][TOP] >UniRef100_Q2QKC3 Pre-mRNA processing factor n=1 Tax=Triticum aestivum RepID=Q2QKC3_WHEAT Length = 194 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 117 GGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GG GGGGGG GG G GRGG CY CGESGH AR+C Sbjct: 77 GGRGGGGGGGGG---GRGRGGSDMKCYECGESGHFAREC 112 [211][TOP] >UniRef100_B9RS81 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RS81_RICCO Length = 516 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 SP L PPPPP PPP P+PP PPPPP PPPP Sbjct: 409 SPPLSSPPPPPFSPPPPPSPPLSPPPPPPPPPP 441 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/37 (62%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPY--PPPP 124 P P PPPPPP PPP P+P PPPPPP+ PPPP Sbjct: 426 PSPPLSPPPPPPPPPPPPSPSPLPPPPPPPFYSPPPP 462 [212][TOP] >UniRef100_A8J4I2 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8J4I2_CHLRE Length = 200 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -3 Query: 108 GGGGGGYGGVGRGGGRGGGGGGCYNCGESGHMARDC 1 GGGGGG+GG G GG GG CY CGE GH+ARDC Sbjct: 82 GGGGGGFGGGGGPGGPGGREMRCYECGEIGHIARDC 117 [213][TOP] >UniRef100_B7PW62 Cellular nucleic acid binding protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PW62_IXOSC Length = 189 Score = 57.0 bits (136), Expect = 6e-07 Identities = 32/83 (38%), Positives = 36/83 (43%), Gaps = 42/83 (50%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGG--------------RGGGGGG------------------- 43 GGG YGGGG GYGG G GGG RGG GGG Sbjct: 83 GGGSYGGGGAGYGGGGYGGGGSFGSSYRSGGYGSRGGRGGGGSPGGPGGMRGGSTRMGDS 142 Query: 42 ---------CYNCGESGHMARDC 1 CYNCG++GH+AR+C Sbjct: 143 RSFSSGPMSCYNCGKTGHIAREC 165 [214][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPP-PPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP PTPP PPPPPP PPPP Sbjct: 304 PPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPPP 339 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPP--PP 124 P P L PPPPPP PPP P PP PPPPPP PP PP Sbjct: 311 PPPPPLPSPPPPPPTPPPPPPPP-PPPPPPNPPFIPP 346 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPPPP P P P PP P PPPP PPPP Sbjct: 300 PATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPP 334 [215][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPP 118 P S L QPPPPPP PPP PP PPPPPP PP Sbjct: 146 PSSAPLPQPPPPPPPPPPASAPPPPPPPPPPPP 178 [216][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 +P PPPP PPP P PP PPPPPP PPPP Sbjct: 143 EPAPPPPPPPPPPPPPPPPPPPPPPPPP 170 [217][TOP] >UniRef100_A5DRR5 Putative uncharacterized protein n=1 Tax=Lodderomyces elongisporus RepID=A5DRR5_LODEL Length = 996 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/42 (59%), Positives = 25/42 (59%), Gaps = 7/42 (16%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPP-------RPTPP*PPPPPPYPPPP 124 P PQ PPPPPP PPP P PP PPPPPP PPPP Sbjct: 935 PPQPQPPSPPPPPPPPPPSLIPFGASPPPPPPPPPPPPPPPP 976 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/41 (58%), Positives = 25/41 (60%), Gaps = 8/41 (19%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRP--------TPP*PPPPPPYPPPP 124 SP QPP PPP PPP P +PP PPPPPP PPPP Sbjct: 934 SPPQPQPPSPPPPPPPPPPSLIPFGASPPPPPPPPPPPPPP 974 [218][TOP] >UniRef100_O73590 Zinc finger homeobox protein 4 n=1 Tax=Gallus gallus RepID=ZFHX4_CHICK Length = 3573 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 SLAMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPP 109 SL+ P P L PPPPPP PPP P PP PPPPPP Sbjct: 3094 SLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPP 3128 [219][TOP] >UniRef100_P49310 Glycine-rich RNA-binding protein GRP1A n=1 Tax=Sinapis alba RepID=GRP1_SINAL Length = 166 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGGGGGYGG GR GG GGGGG + G G Sbjct: 106 GGGGYGGGGGGYGGGGREGGYSGGGGGYSSRGGGG 140 [220][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [221][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [222][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPP PPP P PP PPPPPP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 47 PPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPP PPP P PP PPPPPP PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 10/48 (20%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PP----------PPPPYPPPP 124 A P P PPPPPP PPP P PP PP PPPP PPPP Sbjct: 457 ASLPPPPPPPPPPPPPPPPPPPPPPPPPPLDVGEASNLQPPPPLPPPP 504 [223][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 1492 QPPPPPPPPPPPPPPPPPPPPPPLPP 1517 [224][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 1488 QPPPPPPPPPPPPPPPPPPPPPPLPP 1513 [225][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 1488 QPPPPPPPPPPPPPPPPPPPPPPLPP 1513 [226][TOP] >UniRef100_UPI0000DBF4CE UPI0000DBF4CE related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DBF4CE Length = 58 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGE 25 GGGG GGGGGG GG GRGGGRGGGGGG GE Sbjct: 19 GGGGGGGGGGGGGGGGRGGGRGGGGGGGGGGGE 51 [227][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPP 2329 [228][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [229][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPP 2329 [230][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/39 (61%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*P----PPPPPYPPPP 124 P +P PPPPPP PPP P PP P PPPPP PPPP Sbjct: 621 PPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAPPPP 659 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPPP P P P PP PPPPPP PPPP Sbjct: 647 PPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPP 681 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPPP PPP P PP PPPPP PPPP Sbjct: 659 PPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPP 693 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/47 (53%), Positives = 26/47 (55%), Gaps = 9/47 (19%) Frame = +2 Query: 11 AMCPDSPQL*QPP---------PPPPRPPPRPTPP*PPPPPPYPPPP 124 +M P SP PP PP P PPP P PP PPPPPP PPPP Sbjct: 593 SMMPQSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPP 639 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPPP PP P PP PPPPPP PPP Sbjct: 618 PAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPP 652 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/42 (57%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP----*PPPPPPYPPPP 124 A P +P PPPPP PPP P PP PPPPPP PPPP Sbjct: 612 APAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPP 653 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPP---PPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPP PPP PPP P PP PPPPP PPPP Sbjct: 650 PPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPPPP 687 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PP-------PPPPYPPPP 124 PPPPPP PPP P PP PP PPPP PPPP Sbjct: 643 PPPPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPP 676 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PP P PP PPPPP PPPP Sbjct: 668 PPPPPPPPPAPPPPPAPPPPPAPPPPP 694 [231][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP P PPPP PPPP Sbjct: 1582 PPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPP 1616 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP---PPPPYPPPP 124 P SP PP PPP PPP P PP PP PPPP PPPP Sbjct: 962 PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPP 999 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 4/36 (11%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPR----PTPP*PPPPPPYPPPP 124 P + PP PPP PPP+ P+PP PPPPPP PPPP Sbjct: 2187 PPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPP 2222 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPP PP PP PTPP P PPPP PPPP Sbjct: 787 PPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPP 821 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPP PP PP PTPP P PPPP PPPP Sbjct: 878 PPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 912 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPP PP PP PTPP P PPPP PPPP Sbjct: 1056 PPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 1090 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPP PP PP PTPP P PPPP PPPP Sbjct: 1147 PPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPP 1181 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/38 (55%), Positives = 23/38 (60%) Frame = +2 Query: 11 AMCPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 ++ P P PP PPP PP P PP P PPPP PPPP Sbjct: 363 SLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPPPP 400 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPP P PP P Sbjct: 761 PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTP 795 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPP P PP P Sbjct: 852 PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAP 886 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPP P PP P Sbjct: 1030 PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAP 1064 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPP P PP P Sbjct: 1121 PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAP 1155 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P PP PPPP P PP P Sbjct: 1233 PPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTP 1267 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PP--PPPPYPPPP 124 SP PPPP P PPP P PP PP PPPP PPPP Sbjct: 679 SPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPP 713 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PP PPP PP P PP P PPPP PPPP Sbjct: 970 PPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPP 1004 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +2 Query: 26 SPQL*QPPPPPPRPPPRPTPP*PP--PPPPYPPPP 124 SP PPPP P PPP P PP PP PPPP PPPP Sbjct: 1535 SPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPP 1569 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPP-PPPYPPPP 124 P + PP PPP PPP P PP PPP PPP PPPP Sbjct: 2121 PPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPP 2153 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPP P P P P+PP P PPPP PPPP Sbjct: 782 PPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPP 816 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P PP PPPP P PPPP Sbjct: 800 PPSPPPPTPPPPAP-PPPNPPPPSPPPPLPLPPPP 833 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPP P P P P+PP P PPPP PPPP Sbjct: 873 PPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP 907 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P PP PPPP P PPPP Sbjct: 891 PPSPPPPTPPPPAP-PPPNPPPPSPPPPLPLPPPP 924 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P PP PPPP P PPPP Sbjct: 978 PPSPPPPTPPPPAP-PPPNPPPPSPPPPLPLPPPP 1011 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPP P P P P+PP P PPPP PPPP Sbjct: 1051 PPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP 1085 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P PP PPPP P PPPP Sbjct: 1069 PPSPPPPTPPPPAP-PPPNPPPPSPPPPLPLPPPP 1102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P +P PPPP P P P P+PP P PPPP PPPP Sbjct: 1142 PPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPP 1176 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PP PPP PP P PP P PPPP PPPP Sbjct: 1157 PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPP 1191 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P L PP PPP PPP P P PP PPP PPPP Sbjct: 1224 PPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPP 1255 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPR--PTPP*PPPPPPYPPPP 124 P SP PP PPP PPP P+PP P PPPP PPPP Sbjct: 1229 PPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 1265 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/36 (63%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRP-PPRPTPP*PPPPPPYPPPP 124 P SP PPP PP P PP P+PP P PPPP PPPP Sbjct: 1659 PPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPP 1694 [232][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPP PPP P PP PPPPPP PPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 47 PPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPP PPP P PP PPPPPP PPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PP PPP PPP P PP PPPPPP PPPP Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P PPPP PPP P PP PPPPPP PPPP Sbjct: 232 PAPPPPPPPPPPPPPPPPPPPPPPPPP 258 [233][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPP PPP P PP PPPPPP PPP Sbjct: 215 PPPPPPPPPPPPPPPPPPPPPPPPPP 240 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 47 PPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPP PPP P PP PPPPPP PPPP Sbjct: 215 PPPPPPPPPPPPPPPPPPPPPPPPPP 240 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PP P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPAP 242 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P PPPP PPP P PP PPPPPP PPPP Sbjct: 213 PVPPPPPPPPPPPPPPPPPPPPPPPPP 239 [234][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPP PPP P PP PPPPPP PPP Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 47 PPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPP PPP P PP PPPPPP PPPP Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP PP P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPAP 258 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 Q PPPP PPP P PP PPPPPP PPPP Sbjct: 228 QDAPPPPPPPPPPPPPPPPPPPPPPPPP 255 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPP PPP P PP PPPPPP P P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPAPEP 260 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PPPPPP PPP P PP PPPPPP P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPAPEP 260 [235][TOP] >UniRef100_Q00X46 Chromosome 13 contig 1, DNA sequence n=1 Tax=Ostreococcus tauri RepID=Q00X46_OSTTA Length = 1990 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P+ P L PPPP P PPP PTPP PPPP P+PPP Sbjct: 788 PNPPPLPSPPPPSP-PPPSPTPPLPPPPSPFPPP 820 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +2 Query: 17 CPDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 C SP P PPPP PPP P+PP P PPPP P PP Sbjct: 777 CVSSPP---PSPPPPNPPPLPSPPPPSPPPPSPTPP 809 [236][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 PD+P PPPPPP PPP P P PPPP P PPPP Sbjct: 1143 PDAPPP-SPPPPPPSPPPSPPPSPPPPPSPMPPPP 1176 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/36 (66%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*P-PPPPPYPPPP 124 P SP PPPP P PPP P+PP P PPPPP PPPP Sbjct: 1158 PPSPPPSPPPPPSPMPPPPPSPPPPRPPPPPSPPPP 1193 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PP-PPPPYPPPP 124 P P PP PPP PPP P PP PP PPPP PPPP Sbjct: 1083 PSPPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPP 1118 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/42 (57%), Positives = 25/42 (59%), Gaps = 7/42 (16%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*P-------PPPPPYPPPP 124 P P P PPPPRPPP P+PP P PPPPP PPPP Sbjct: 1100 PSPPPPPPPSPPPPRPPPPPSPPPPVHEPPPSPPPPPSPPPP 1141 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPP 121 P SP PP PPP PPP P PP PPPPP PPP Sbjct: 1091 PPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPP 1124 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPPR 127 P SP PP PP PPP P P PPPPPP PPPPR Sbjct: 1082 PPSPP---SPPSPPSPPPPPPPSPPPPPPPSPPPPR 1114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*P----PPPPPYPPPP 124 P P PPPPPP PP P PP P PPPPP PPPP Sbjct: 1086 PSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPP 1124 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P PPPPP PPPRP PP PPPP + PPP Sbjct: 1165 PPPPPSPMPPPPPSPPPPRPPPPPSPPPPVHEPPP 1199 [237][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P + PPPPPP PPP P P PPPPP PPPP Sbjct: 292 PPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPP 326 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP--*PPPPPPYPPPP 124 P P + PPPPP PPP P PP PPPPPP PPPP Sbjct: 309 PPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPP 345 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P P + PPPPPP PPP P PPPPP Y PPP Sbjct: 259 PPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPP 293 [238][TOP] >UniRef100_B9N668 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N668_POPTR Length = 187 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = -3 Query: 102 GGGGYGGVGRGGGRGGGGGG---CYNCGESGHMARDC 1 GGGG GG GRGGGRG GG CY CGE GH AR+C Sbjct: 74 GGGGGGGGGRGGGRGRSGGSDLKCYECGEPGHFAREC 110 [239][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P PP PPP PPP P PP PPPPPP PPPP Sbjct: 44 PPFPPPPSPPPPPPPLPPPPSPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PDSPQL*QPPPPPPRPPPRPTPP*PPPPPPYPPPP 124 P SP PPPP P PPP P PP P PPPP PPPP Sbjct: 39 PPSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPPPP 73 [240][TOP] >UniRef100_C4MLW6 Vasa protein n=1 Tax=Parhyale hawaiensis RepID=C4MLW6_9CRUS Length = 707 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/62 (46%), Positives = 33/62 (53%), Gaps = 20/62 (32%) Frame = -3 Query: 126 RGGGGYGGGGGGYGGVGRGGGRG----------------GGGGG----CYNCGESGHMAR 7 RG GG+GGGG G G GRGG G GGGGG C+ CGE GHM+R Sbjct: 33 RGRGGFGGGGRGRGRGGRGGSTGCRKCGEEGHRAFECTSGGGGGGNRACFKCGEEGHMSR 92 Query: 6 DC 1 +C Sbjct: 93 EC 94 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Frame = -3 Query: 114 GYGGGG---GGYGGVGRGGGRGGGGG--GCYNCGESGHMARDC 1 GYG G GG+GG GRG GRGG GG GC CGE GH A +C Sbjct: 27 GYGSGSRGRGGFGGGGRGRGRGGRGGSTGCRKCGEEGHRAFEC 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/57 (43%), Positives = 29/57 (50%), Gaps = 16/57 (28%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGR----------------GGGRGGGGGGCYNCGESGHMARDC 1 GG +GGGGGG G + GGG GG GC+ CGE GHM+RDC Sbjct: 98 GGQSFGGGGGGNRGCFKCGEEGHMSRDCPNSVNGGGGASGGKGCFKCGEEGHMSRDC 154 [241][TOP] >UniRef100_B9Q6L7 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii VEG RepID=B9Q6L7_TOXGO Length = 510 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGG 46 GGGGYGGGGGGYGG G GGG GGGGG Sbjct: 356 GGGGYGGGGGGYGGYGGGGGYGGGGG 381 [242][TOP] >UniRef100_B9PW07 RNA recognition motif-containing protein, putative n=1 Tax=Toxoplasma gondii GT1 RepID=B9PW07_TOXGO Length = 508 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGG 46 GGGGYGGGGGGYGG G GGG GGGGG Sbjct: 354 GGGGYGGGGGGYGGYGGGGGYGGGGG 379 [243][TOP] >UniRef100_B6KME4 RRM domain-containing protein n=1 Tax=Toxoplasma gondii ME49 RepID=B6KME4_TOXGO Length = 513 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGG 46 GGGGYGGGGGGYGG G GGG GGGGG Sbjct: 359 GGGGYGGGGGGYGGYGGGGGYGGGGG 384 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCGESG 19 GGGGYGGG GGYGG G GGG GGGGGG G G Sbjct: 344 GGGGYGGGNGGYGG-GGGGGYGGGGGGYGGYGGGG 377 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 11/47 (23%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRG-----------GGRGGGGGGCYNCGESGH 16 GGGGYGGG GGYGG G G GG GGGGGG Y G G+ Sbjct: 324 GGGGYGGGNGGYGGGGNGGYGGGGYGGGNGGYGGGGGGGYGGGGGGY 370 [244][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 44 PPPPPPRPPPRPTPP*PPPPPPYPPP 121 PPPPPP PPP P PP PPPPPP PPP Sbjct: 471 PPPPPPLPPPPPPPPPPPPPPPPPPP 496 [245][TOP] >UniRef100_B2AKS1 Translation initiation factor IF-2 n=1 Tax=Podospora anserina RepID=B2AKS1_PODAN Length = 1038 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 5/38 (13%) Frame = +2 Query: 29 PQL*QPPPPPPRPPPRPTPP*P-----PPPPPYPPPPR 127 P+ +PPPPPP PPP P PP P PPPPP PPPPR Sbjct: 116 PRAPKPPPPPPPPPPPPPPPPPKASTPPPPPPPPPPPR 153 [246][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPP 2329 [247][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [248][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2334 QPPPPPPPPPPPPPPPPPPPPPPLPP 2359 [249][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = +2 Query: 41 QPPPPPPRPPPRPTPP*PPPPPPYPP 118 QPPPPPP PPP P PP PPPPPP PP Sbjct: 2304 QPPPPPPPPPPPPPPPPPPPPPPLPP 2329 [250][TOP] >UniRef100_UPI0001862007 hypothetical protein BRAFLDRAFT_58365 n=1 Tax=Branchiostoma floridae RepID=UPI0001862007 Length = 178 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 123 GGGGYGGGGGGYGGVGRGGGRGGGGGGCYNCG 28 GGGGYGGGGG YGG G GGG GGGGG Y G Sbjct: 131 GGGGYGGGGGSYGGGGYGGGSYGGGGGSYGGG 162