[UP]
[1][TOP] >UniRef100_Q8S8M0 UPF0467 protein At2g41420 n=1 Tax=Arabidopsis thaliana RepID=U647A_ARATH Length = 98 Score = 171 bits (432), Expect = 3e-41 Identities = 80/115 (69%), Positives = 81/115 (70%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MS YNQ PPVG PPPQGYPPEGY K+ YPP GYPP GYP QGYPPQGYP GYP QGYP Sbjct: 1 MSQYNQ--PPVGVPPPQGYPPEGYPKDAYPPQGYPPQGYPQQGYPPQGYPQQGYPQQGYP 58 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 PP YAPQY PPPP H SSPG LEGC AALCCCCLLDACF Sbjct: 59 PP----------YAPQY--PPPPQHQQQQ---SSPGFLEGCLAALCCCCLLDACF 98 [2][TOP] >UniRef100_A9NLR5 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NLR5_PICSI Length = 95 Score = 167 bits (422), Expect = 4e-40 Identities = 78/115 (67%), Positives = 81/115 (70%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYYNQQQPPVG PPPQGYPPEGY K+ YPPPGYPP GY PQGYPPQGYP GYP QGY Sbjct: 1 MSYYNQQQPPVGVPPPQGYPPEGYPKDAYPPPGYPPQGY-PQGYPPQGYPAQGYPQQGYG 59 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 PP PPQYA Q Q +SSP +EGC AALCCCCLLDACF Sbjct: 60 PP-------PPQYAQQQQQ------------NSSPSFMEGCLAALCCCCLLDACF 95 [3][TOP] >UniRef100_C5WVH5 Putative uncharacterized protein Sb01g031530 n=1 Tax=Sorghum bicolor RepID=C5WVH5_SORBI Length = 102 Score = 165 bits (418), Expect = 1e-39 Identities = 80/117 (68%), Positives = 83/117 (70%), Gaps = 2/117 (1%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQ-GY 231 MSYY QQQPPVG PPPQGYP GK+ YPPPGYPP GYPP P QGYPP GYPPQ GY Sbjct: 1 MSYYGQQQPPVGVPPPQGYP----GKDAYPPPGYPPAGYPP---PAQGYPPQGYPPQQGY 53 Query: 232 PPPPYSAQGYPPQ-YAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 PP QGYP Q Y P YAQPPPP H SS P +EGC AALCCCCLL+ACF Sbjct: 54 PPQ----QGYPQQGYPPPYAQPPPPQQHQ----SSGPSFMEGCLAALCCCCLLEACF 102 [4][TOP] >UniRef100_Q75KQ4 Os03g0431100 protein n=2 Tax=Oryza sativa RepID=Q75KQ4_ORYSJ Length = 98 Score = 152 bits (385), Expect = 9e-36 Identities = 75/117 (64%), Positives = 80/117 (68%), Gaps = 2/117 (1%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYY QQ PPVG PPPQGYP GK+ YPPPGYPP GYPP P QGYPP GYPPQ Sbjct: 1 MSYYGQQ-PPVGAPPPQGYP----GKDAYPPPGYPPAGYPP---PAQGYPPQGYPPQ--- 49 Query: 235 PPPYSAQGYPPQ--YAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QGYPPQ Y P YAQPPPP + +SS P +EGC AALCCCCLL+ACF Sbjct: 50 ------QGYPPQQGYPPPYAQPPPPQQQQH--HSSGPSFMEGCLAALCCCCLLEACF 98 [5][TOP] >UniRef100_UPI0001739304 unknown protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001739304 Length = 124 Score = 151 bits (381), Expect = 3e-35 Identities = 74/125 (59%), Positives = 79/125 (63%), Gaps = 13/125 (10%) Frame = +1 Query: 64 YNQQQPPVGTPPPQGYPP-EGYGKEGYPPP-GYPPPGYPPQGYPPQGYPPP------GYP 219 Y Q PV PPPQGYPP EGY GYPPP GYPPP YP GYPP GYPPP GYP Sbjct: 3 YQDPQHPVSAPPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYP 62 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPPHH-----HNNSNNSSSPGCLEGCCAALCCCCL 384 QGYPPP Y QG+PPQY Y PPPPH+ N + S G +EGC A LCCC L Sbjct: 63 AQGYPPPQY-PQGHPPQY--PYQGPPPPHYGQAPPKNKKDKKDSGGFMEGCLAMLCCCVL 119 Query: 385 LDACF 399 L+ACF Sbjct: 120 LEACF 124 [6][TOP] >UniRef100_Q9M2X4 Putative uncharacterized protein T16K5.190 n=1 Tax=Arabidopsis thaliana RepID=Q9M2X4_ARATH Length = 651 Score = 151 bits (381), Expect = 3e-35 Identities = 74/125 (59%), Positives = 79/125 (63%), Gaps = 13/125 (10%) Frame = +1 Query: 64 YNQQQPPVGTPPPQGYPP-EGYGKEGYPPP-GYPPPGYPPQGYPPQGYPPP------GYP 219 Y Q PV PPPQGYPP EGY GYPPP GYPPP YP GYPP GYPPP GYP Sbjct: 530 YQDPQHPVSAPPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYP 589 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPPHH-----HNNSNNSSSPGCLEGCCAALCCCCL 384 QGYPPP Y QG+PPQY Y PPPPH+ N + S G +EGC A LCCC L Sbjct: 590 AQGYPPPQY-PQGHPPQY--PYQGPPPPHYGQAPPKNKKDKKDSGGFMEGCLAMLCCCVL 646 Query: 385 LDACF 399 L+ACF Sbjct: 647 LEACF 651 [7][TOP] >UniRef100_B4FEM0 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FEM0_MAIZE Length = 102 Score = 150 bits (378), Expect = 6e-35 Identities = 73/119 (61%), Positives = 77/119 (64%), Gaps = 4/119 (3%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYP-PEGYGKEGYPPPGYPPP--GYPPQGYPPQGYPP-PGYPP 222 MSYY QQQPPV PP QGYP + Y GYPP GYPPP GYPPQGYPPQGYPP GYP Sbjct: 1 MSYYGQQQPPVSAPPAQGYPGKDAYPPPGYPPAGYPPPAQGYPPQGYPPQGYPPQQGYPQ 60 Query: 223 QGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QGYP PQY+QPPPP SS P +EGC AALCCCCLL+ACF Sbjct: 61 QGYP--------------PQYSQPPPP---PRQQQSSGPSFMEGCLAALCCCCLLEACF 102 [8][TOP] >UniRef100_B6T850 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6T850_MAIZE Length = 102 Score = 147 bits (371), Expect = 4e-34 Identities = 72/119 (60%), Positives = 76/119 (63%), Gaps = 4/119 (3%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYP-PEGYGKEGYPPPGYPPP--GYPPQGYPPQGYPP-PGYPP 222 MSYY QQQPPV PP GYP + Y GYPP GYPPP GYPPQGYPPQGYPP GYP Sbjct: 1 MSYYGQQQPPVSAPPAXGYPGKDAYPPPGYPPAGYPPPAQGYPPQGYPPQGYPPQQGYPQ 60 Query: 223 QGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QGYP PQY+QPPPP SS P +EGC AALCCCCLL+ACF Sbjct: 61 QGYP--------------PQYSQPPPP---PXQQQSSGPSFMEGCLAALCCCCLLEACF 102 [9][TOP] >UniRef100_A7QL85 Chromosome chr3 scaffold_117, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QL85_VITVI Length = 88 Score = 140 bits (353), Expect = 4e-32 Identities = 67/115 (58%), Positives = 70/115 (60%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYYNQQQPPVG PP QGYPPEGY K+ YPP GYPP GYP QGYP Sbjct: 1 MSYYNQQQPPVGVPPQQGYPPEGYPKDAYPPAGYPPQGYPQQGYP--------------- 45 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 PQYAPQY QP P ++SS G LEGC AALCCCCLLDACF Sbjct: 46 ----------PQYAPQYGQPQPQPQQQQQSHSS--GLLEGCLAALCCCCLLDACF 88 [10][TOP] >UniRef100_Q0WPY7 Putative uncharacterized protein At3g49840 (Fragment) n=1 Tax=Arabidopsis thaliana RepID=Q0WPY7_ARATH Length = 111 Score = 136 bits (343), Expect = 6e-31 Identities = 66/117 (56%), Positives = 72/117 (61%), Gaps = 11/117 (9%) Frame = +1 Query: 82 PVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP------GYPPQGYPPPP 243 P G PP +GYPP GY PP GYPPP YP GYPP GYPPP GYP QGYPPP Sbjct: 2 PQGYPPKEGYPPAGYP----PPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQ 57 Query: 244 YSAQGYPPQYAPQYAQPPPPHH-----HNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 Y QG+PPQY Y PPPPH+ N + S G +EGC A LCCC LL+ACF Sbjct: 58 Y-PQGHPPQY--PYQGPPPPHYGQAPPKNKKDKKDSGGFMEGCLAMLCCCVLLEACF 111 [11][TOP] >UniRef100_B6SHN0 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6SHN0_MAIZE Length = 93 Score = 135 bits (340), Expect = 1e-30 Identities = 69/118 (58%), Positives = 71/118 (60%), Gaps = 3/118 (2%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYP-PEGYGKEGYPPPGYPPP--GYPPQGYPPQGYPPPGYPPQ 225 MSYY QQ PPVG PP QGYP +GY GYPP GYPPP GYPPQGYP QGYP GYPP Sbjct: 1 MSYYGQQ-PPVGVPPQQGYPGKDGYPPAGYPPAGYPPPAQGYPPQGYPQQGYPQQGYPP- 58 Query: 226 GYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QYAQPPP SS P +EGC AALCCCCLLDACF Sbjct: 59 ------------------QYAQPPP-----QQQQSSGPSFMEGCLAALCCCCLLDACF 93 [12][TOP] >UniRef100_B9F962 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9F962_ORYSJ Length = 91 Score = 132 bits (332), Expect = 1e-29 Identities = 68/117 (58%), Positives = 73/117 (62%), Gaps = 2/117 (1%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYY QQ P GTP GK+ YPPPGYPP GYPP P QGYPP GYPPQ Sbjct: 1 MSYYGQQPP--GTP----------GKDAYPPPGYPPAGYPP---PAQGYPPQGYPPQ--- 42 Query: 235 PPPYSAQGYPPQ--YAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QGYPPQ Y P YAQPPPP ++SS P +EGC AALCCCCLL+ACF Sbjct: 43 ------QGYPPQQGYPPPYAQPPPP--QQQQHHSSGPSFMEGCLAALCCCCLLEACF 91 [13][TOP] >UniRef100_B6SHT2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B6SHT2_MAIZE Length = 84 Score = 131 bits (329), Expect = 3e-29 Identities = 67/115 (58%), Positives = 69/115 (60%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYY QQ PPVG PP QGYP GK+GYPP GYPP GYPP P QGYPP GYPP Sbjct: 1 MSYYGQQ-PPVGVPPQQGYP----GKDGYPPAGYPPAGYPP---PAQGYPPQGYPP---- 48 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QYAQPPPP SS P +EGC AALCCCCLLDACF Sbjct: 49 ---------------QYAQPPPP----QQQQSSGPSFMEGCLAALCCCCLLDACF 84 [14][TOP] >UniRef100_B6T2F1 Rhodopsin n=1 Tax=Zea mays RepID=B6T2F1_MAIZE Length = 84 Score = 128 bits (322), Expect = 2e-28 Identities = 66/115 (57%), Positives = 68/115 (59%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYY QQ PPV PP QGYP GK+GYPP GYPP GYPP P QGYPP GYPP Sbjct: 1 MSYYGQQ-PPVXVPPQQGYP----GKDGYPPAGYPPAGYPP---PAQGYPPQGYPP---- 48 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QYAQPPPP SS P +EGC AALCCCCLLDACF Sbjct: 49 ---------------QYAQPPPP----QQQQSSGPSFMEGCLAALCCCCLLDACF 84 [15][TOP] >UniRef100_C5XD15 Putative uncharacterized protein Sb02g037750 n=1 Tax=Sorghum bicolor RepID=C5XD15_SORBI Length = 88 Score = 127 bits (320), Expect = 3e-28 Identities = 66/116 (56%), Positives = 68/116 (58%), Gaps = 1/116 (0%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYP-PEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGY 231 MSYY QQ PPVG PP QGYP +GY GYPP GYPPP QGYPPQGYP GYPP Sbjct: 1 MSYYGQQ-PPVGVPPQQGYPGKDGYPPAGYPPAGYPPPA---QGYPPQGYPQQGYPP--- 53 Query: 232 PPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QYAQPPP SS P +EGC AALCCCCLLDACF Sbjct: 54 ----------------QYAQPPP-----QQQQSSGPSFMEGCLAALCCCCLLDACF 88 [16][TOP] >UniRef100_B9SH15 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9SH15_RICCO Length = 539 Score = 127 bits (320), Expect = 3e-28 Identities = 66/123 (53%), Positives = 69/123 (56%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP 210 + +P MSYYNQQQPPVG PPPQGYPP K+ YPPPGYP GY PQGYPPQGYPP Sbjct: 454 KNNPKPLSMSYYNQQQPPVGVPPPQGYPP----KDAYPPPGYPVQGY-PQGYPPQGYPPQ 508 Query: 211 GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLD 390 G YAQ PP G LEGC AALCCCCLLD Sbjct: 509 G-----------------------YAQQPP---------RKETGFLEGCLAALCCCCLLD 536 Query: 391 ACF 399 ACF Sbjct: 537 ACF 539 [17][TOP] >UniRef100_B9IBK5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IBK5_POPTR Length = 81 Score = 125 bits (313), Expect = 2e-27 Identities = 64/115 (55%), Positives = 66/115 (57%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYY+Q QPPV PP QGYP K+ YPPPGYP GY PQGYPPQGYPP GY Sbjct: 1 MSYYDQHQPPVSVPPQQGYP-----KDAYPPPGYPVQGY-PQGYPPQGYPPQGY------ 48 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 APQYA PPP G LEGC AALCCCCLLDACF Sbjct: 49 -------------APQYAAPPP---------RQETGFLEGCLAALCCCCLLDACF 81 [18][TOP] >UniRef100_UPI0001983A53 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983A53 Length = 79 Score = 124 bits (312), Expect = 3e-27 Identities = 63/115 (54%), Positives = 67/115 (58%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYY+QQQPPVG PPPQ GYP +GYP YPPPGYPPQ YP Sbjct: 1 MSYYSQQQPPVGVPPPQ--------------------GYPVEGYPKDAYPPPGYPPQAYP 40 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 PP Q YP PQYAQPPP + + G LEGC AALCCCCLLDACF Sbjct: 41 PP----QAYP----PQYAQPPP--------KNETGGFLEGCLAALCCCCLLDACF 79 [19][TOP] >UniRef100_Q7F1U6 cDNA clone:J023048B07, full insert sequence n=2 Tax=Oryza sativa RepID=Q7F1U6_ORYSJ Length = 89 Score = 124 bits (312), Expect = 3e-27 Identities = 66/116 (56%), Positives = 69/116 (59%), Gaps = 1/116 (0%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYP-PEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGY 231 MSYY QQ PPVG PP QGYP +GY GYPP GYP P QGYPP GYP P QGY Sbjct: 1 MSYYGQQ-PPVGVPPQQGYPGKDGYPPPGYPPAGYP----PAQGYPPAGYP----PQQGY 51 Query: 232 PPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 PPP YAQPPP +SS P +EGC AALCCCCLLDACF Sbjct: 52 PPP--------------YAQPPP----QQQQHSSGPSFMEGCLAALCCCCLLDACF 89 [20][TOP] >UniRef100_B6T9J1 Rhodopsin n=1 Tax=Zea mays RepID=B6T9J1_MAIZE Length = 88 Score = 124 bits (312), Expect = 3e-27 Identities = 65/116 (56%), Positives = 67/116 (57%), Gaps = 1/116 (0%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYP-PEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGY 231 MSYY QQ PPVG PP QGYP +GY GYPP GYPPP QGYP QGYP GYPP Sbjct: 1 MSYYGQQ-PPVGVPPQQGYPGKDGYPPAGYPPAGYPPPA---QGYPQQGYPQQGYPP--- 53 Query: 232 PPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 QYAQPPP SS P +EGC AALCCCCLLDACF Sbjct: 54 ----------------QYAQPPP-----QQQQSSGPSFMEGCLAALCCCCLLDACF 88 [21][TOP] >UniRef100_C4R4X2 Protein involved in positive regulation of both 1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway n=1 Tax=Pichia pastoris GS115 RepID=C4R4X2_PICPG Length = 1338 Score = 122 bits (305), Expect = 2e-26 Identities = 54/91 (59%), Positives = 58/91 (63%), Gaps = 3/91 (3%) Frame = +1 Query: 43 TTPPMSYYNQQQPPVGTPPP---QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 T PP +Y + PP G P Q Y P+GY EGYP GYPP GYPPQGYPPQGYPP G Sbjct: 957 TYPPQNYPPRDYPPRGYSPQANLQEYSPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQG 1016 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPH 306 YPPQGYPP Y QGYPP P + P P H Sbjct: 1017 YPPQGYPPQGYPPQGYPPSGFPPQSYPSPSH 1047 Score = 110 bits (274), Expect = 6e-23 Identities = 55/123 (44%), Positives = 65/123 (52%), Gaps = 22/123 (17%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP 210 RG+ + Y+ + P P QGYPP+GY +GYPP GYPP GYPPQGYPPQGYPP Sbjct: 971 RGYSPQANLQEYSPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQ 1030 Query: 211 GYPPQGYPPPPYSA----QG-------------YPPQYAPQYAQ-----PPPPHHHNNSN 324 GYPP G+PP Y + QG YPP QY Q PP P+ + Sbjct: 1031 GYPPSGFPPQSYPSPSHGQGRRIYHPVQGTQGYYPPPNQAQYQQTQFLHPPSPYQGGAGH 1090 Query: 325 NSS 333 SS Sbjct: 1091 QSS 1093 Score = 90.5 bits (223), Expect = 5e-17 Identities = 49/117 (41%), Positives = 53/117 (45%), Gaps = 27/117 (23%) Frame = +1 Query: 43 TTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP--------------- 177 T P +Y Q P + QG P G + YPP YPP YPP Sbjct: 929 TPSPQEHYPHQVYPNAS---QGPAPNGNSLQTYPPQNYPPRDYPPRGYSPQANLQEYSPK 985 Query: 178 ---------QGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP---PPHHH 312 QGYPPQGYPP GYPPQGYPP Y QGYPPQ P PP PP + Sbjct: 986 GYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPSGFPPQSY 1042 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/56 (51%), Positives = 30/56 (53%) Frame = -1 Query: 248 EYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*PCGGGVPTG 81 EY GYP G P GYP GYP GYP GYP GYP YP G P G P+G Sbjct: 981 EYSPKGYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPSG 1036 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/53 (50%), Positives = 27/53 (50%) Frame = -1 Query: 263 G*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*P 105 G P Y GYP G P GYP GYP GYP GYP GYP YP G P Sbjct: 986 GYPTEGYPSQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPSGFP 1038 [22][TOP] >UniRef100_Q9FJW3 Genomic DNA, chromosome 5, TAC clone: K9I9 n=1 Tax=Arabidopsis thaliana RepID=Q9FJW3_ARATH Length = 82 Score = 121 bits (304), Expect = 2e-26 Identities = 62/112 (55%), Positives = 66/112 (58%) Frame = +1 Query: 64 YNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPP 243 Y+Q+Q PVG PPPQGYPP K+GYPP GYPP GYPP GY GYP QGYPPP Sbjct: 2 YHQEQHPVGAPPPQGYPP----KDGYPPAGYPPAGYPPPGY------AQGYPAQGYPPPQ 51 Query: 244 YSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 YS APQ Q + G LEGC AALCCCCLLDACF Sbjct: 52 YS-------QAPQQKQ--------------NAGMLEGCLAALCCCCLLDACF 82 [23][TOP] >UniRef100_B7FMM9 Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=B7FMM9_MEDTR Length = 91 Score = 119 bits (299), Expect = 8e-26 Identities = 62/122 (50%), Positives = 68/122 (55%), Gaps = 7/122 (5%) Frame = +1 Query: 55 MSYYN-QQQPPVGTPPPQGYPPE------GYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 MSYY+ QQQPPVG PPPQGYPP+ GY ++GYP GYPP GYP QGYP QGYPP Sbjct: 1 MSYYDHQQQPPVGVPPPQGYPPKDAYPPPGYPQQGYPQQGYPPQGYPQQGYPQQGYPP-- 58 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDA 393 QYAQ P + G LEGC AALCCCC+LDA Sbjct: 59 ---------------------QQYAQQP--------QQNKEVGFLEGCLAALCCCCMLDA 89 Query: 394 CF 399 CF Sbjct: 90 CF 91 [24][TOP] >UniRef100_Q8LCL8 UPF0467 protein B n=1 Tax=Arabidopsis thaliana RepID=U647B_ARATH Length = 101 Score = 119 bits (297), Expect = 1e-25 Identities = 61/124 (49%), Positives = 65/124 (52%), Gaps = 13/124 (10%) Frame = +1 Query: 67 NQQQPPVGTPPPQGYPPEGYGKEGYPPPG-------YPPP------GYPPQGYPPQGYPP 207 +QQ P VG PP YP EG K+ YPPPG YPPP GYPPQGYPPQGYP Sbjct: 2 SQQPPAVGVPPSHAYPAEGPPKDAYPPPGQPYPQQGYPPPQGYPQQGYPPQGYPPQGYPE 61 Query: 208 PGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLL 387 GYP QGYPP Q + SPG LEGC AALCC C+L Sbjct: 62 QGYPQQGYPPQQQQQQKH------------------------SPGMLEGCIAALCCYCVL 97 Query: 388 DACF 399 DACF Sbjct: 98 DACF 101 [25][TOP] >UniRef100_Q8L8M2 Adhesive/proline-rich protein homolog n=1 Tax=Arabidopsis thaliana RepID=Q8L8M2_ARATH Length = 82 Score = 117 bits (293), Expect = 4e-25 Identities = 61/112 (54%), Positives = 65/112 (58%) Frame = +1 Query: 64 YNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPP 243 Y+Q+Q PVG PPPQGYPP K+GYPP GYPP GYPP GY GYP QGYPPP Sbjct: 2 YHQEQHPVGAPPPQGYPP----KDGYPPAGYPPAGYPPPGY------AQGYPAQGYPPPQ 51 Query: 244 YSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 YS APQ Q + G LEGC AALCC CLLDACF Sbjct: 52 YS-------QAPQQKQ--------------NAGMLEGCLAALCCFCLLDACF 82 [26][TOP] >UniRef100_O04820 Putative uncharacterized protein n=1 Tax=Sporobolus stapfianus RepID=O04820_SPOST Length = 86 Score = 116 bits (290), Expect = 9e-25 Identities = 62/116 (53%), Positives = 65/116 (56%), Gaps = 1/116 (0%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYP-PEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGY 231 MSYY QQ PPVG PP QGYP +GY +GYPP GYP P QGYPP GYP QGY Sbjct: 1 MSYYGQQ-PPVGVPPQQGYPGKDGYPPQGYPPAGYP---------PQQGYPPQGYPQQGY 50 Query: 232 PPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 PPP YA AQ S P +EGC AALCCCCLLDACF Sbjct: 51 PPP----------YAQAAAQ----------QQQSGPSFMEGCLAALCCCCLLDACF 86 [27][TOP] >UniRef100_Q0DU86 Os03g0200400 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0DU86_ORYSJ Length = 142 Score = 113 bits (282), Expect = 8e-24 Identities = 69/150 (46%), Positives = 72/150 (48%), Gaps = 35/150 (23%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPP---EGYGKEG-------------YPPPGYPPPGYPPQG- 183 MSYYN VG PPPQGYPP + YGK G YPP PPP G Sbjct: 1 MSYYNPHAH-VGVPPPQGYPPPPMDAYGKAGGVDDHHLHHQHHQYPPQ--PPPPMDAYGK 57 Query: 184 ---------------YPPQGYPPPGYP-PQGYPPPPYSAQGYPP--QYAPQYAQPPPPHH 309 YPPQ PP GYP YPPPP GYPP Y P YAQPPPP Sbjct: 58 AVGVDDHHLHHQHHQYPPQAPPPMGYPGAHPYPPPP-QPYGYPPPQMYPPPYAQPPPPPP 116 Query: 310 HNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 H + P +GC AALCCCCLLD CF Sbjct: 117 HRHER----PSFCQGCLAALCCCCLLDVCF 142 [28][TOP] >UniRef100_A5PLE2 UPF0467 protein C5orf32 homolog n=1 Tax=Danio rerio RepID=CE032_DANRE Length = 118 Score = 111 bits (278), Expect = 2e-23 Identities = 60/119 (50%), Positives = 65/119 (54%), Gaps = 11/119 (9%) Frame = +1 Query: 67 NQQQPPV--GTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP--PQGYP 234 N +QPP G P GYP +GY +GYP GYP GYPPQGYP QGYP GYP P G P Sbjct: 2 NYEQPPAYTGPGPAPGYPAQGYPAQGYPTQGYPAQGYPPQGYPAQGYPAQGYPNYPPG-P 60 Query: 235 PPPYSAQGYPPQYAPQYAQPPPP-------HHHNNSNNSSSPGCLEGCCAALCCCCLLD 390 P PY+AQ P Y Y QP PP + S CL C AALCCCCL D Sbjct: 61 PGPYTAQ---PGY-QGYPQPGPPTNTVYVVEQGRRDDQSGEQACLATCWAALCCCCLCD 115 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = -1 Query: 275 AY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFP 126 AY G P Y GYP G P GYP GYP GYP GYP GYP++P Sbjct: 8 AYTGPGPAPGYPAQGYPAQGYPTQGYPAQGYPPQGYPAQGYPAQGYPNYP 57 [29][TOP] >UniRef100_A9NZ64 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NZ64_PICSI Length = 218 Score = 111 bits (277), Expect = 3e-23 Identities = 58/121 (47%), Positives = 62/121 (51%), Gaps = 15/121 (12%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQ- 225 PP Y PP G PP GYPP GY GYPP GYPP GYP GYPP GYPP GYPPQ Sbjct: 32 PPSGYPPSGYPPSGYPP-SGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQG 90 Query: 226 GYPPPPYSA-QGYPPQYAPQYAQPPP-------------PHHHNNSNNSSSPGCLEGCCA 363 GYPPP ++A GYP P A P P PH +S + P G A Sbjct: 91 GYPPPAHNAPYGYPQHGPPPGAYPSPYGGYPPPGPSSGYPHQGQSSGHGIGPLLAGGAAA 150 Query: 364 A 366 A Sbjct: 151 A 151 Score = 109 bits (273), Expect = 8e-23 Identities = 45/69 (65%), Positives = 46/69 (66%), Gaps = 1/69 (1%) Frame = +1 Query: 106 GYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ-YAPQ 282 GYPP GY GYPP GYPP GYPP GYPP GYPP GYPP GYP Y GYPP Y PQ Sbjct: 30 GYPPSGYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQ 89 Query: 283 YAQPPPPHH 309 PPP H+ Sbjct: 90 GGYPPPAHN 98 Score = 80.1 bits (196), Expect = 7e-14 Identities = 45/93 (48%), Positives = 48/93 (51%), Gaps = 14/93 (15%) Frame = +1 Query: 34 GHPTT--PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPP-GYP------ 174 G+P + PP Y PP G PP P GYP GY GYPP GYPP GYP Sbjct: 40 GYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQGGYPPPAHNA 99 Query: 175 PQGYPPQGYPPPGYP-PQGYPPPPYSAQGYPPQ 270 P GYP G PP YP P G PPP + GYP Q Sbjct: 100 PYGYPQHGPPPGAYPSPYGGYPPPGPSSGYPHQ 132 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/62 (51%), Positives = 33/62 (53%) Frame = -1 Query: 263 G*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*PCGGGVPT 84 G P + Y GYP G P GYP GYP GYP GYP GYPS YP G P G P Sbjct: 30 GYPPSGYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQ 89 Query: 83 GG 78 GG Sbjct: 90 GG 91 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/59 (50%), Positives = 31/59 (52%) Frame = -1 Query: 263 G*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*PCGGGVP 87 G P + Y GYP G P GYP GYP GYP GYP GYP YP G P GG P Sbjct: 35 GYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGYPPSGYPSSGYPPSGYPPAGYPPQGGYP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = +1 Query: 166 GYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 G GYPP GYPP GYPP GYPP Y GYPP P PP Sbjct: 25 GLSSSGYPPSGYPPSGYPPSGYPPSGYPPAGYPPSGYPPSGYPP 68 [30][TOP] >UniRef100_B9N0V9 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0V9_POPTR Length = 143 Score = 110 bits (275), Expect = 5e-23 Identities = 70/146 (47%), Positives = 75/146 (51%), Gaps = 21/146 (14%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPP---VGTPPP---QGYPPEGYGK---EGYPPPGYPPPGYPP 177 Q H PP Y + PP PPP +GYPP EGYPPP PPPGYP Sbjct: 4 QRAPHDPYPPPGYSSPYPPPGYSPSAPPPPPHEGYPPPPPPPPPHEGYPPPPPPPPGYP- 62 Query: 178 QGYPPQGYPPPGYPPQGYPPPP-------YSAQGYP-PQYAPQYAQPPPPHHHNNSNNSS 333 GYPP G PPPGYP GYPPP Y A+GYP P PQY Q HH +N Sbjct: 63 -GYPPPGPPPPGYP--GYPPPGPPRGYQGYFAEGYPTPPGPPQYQQCCHYEHHPYQDNYG 119 Query: 334 SPGC---LEGCCAALCCCC-LLDACF 399 GC L GC AALCCCC L + CF Sbjct: 120 --GCSSFLRGCLAALCCCCVLEECCF 143 [31][TOP] >UniRef100_B5DPT7 GA23811 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DPT7_DROPS Length = 561 Score = 109 bits (273), Expect = 8e-23 Identities = 50/86 (58%), Positives = 55/86 (63%), Gaps = 5/86 (5%) Frame = +1 Query: 97 PPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPP 267 PP G+ PP GY + YPP GYP GYPPQGYP QGYP GYPPQGYP P + QG PP Sbjct: 9 PPAGFSSAPPAGYPPQEYPPQGYPQQGYPPQGYPAQGYPQQGYPPQGYPQPGFIQQGNPP 68 Query: 268 QY--APQYAQPPPPHHHNNSNNSSSP 339 QY AP PPPP+HH S +P Sbjct: 69 QYYGAPPGQGPPPPNHHYGSVPPPAP 94 Score = 87.8 bits (216), Expect = 3e-16 Identities = 47/98 (47%), Positives = 52/98 (53%), Gaps = 10/98 (10%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 G + PP Y Q+ PP G P QGYPP+GY +GYP GYPP GYP G+ QG PP Sbjct: 12 GFSSAPPAGYPPQEYPPQGYPQ-QGYPPQGYPAQGYPQQGYPPQGYPQPGFIQQGNPPQY 70 Query: 214 Y---PPQGYPPP-------PYSAQGYPPQYAPQYAQPP 297 Y P QG PPP P A PPQ AP PP Sbjct: 71 YGAPPGQGPPPPNHHYGSVPPPAPTLPPQDAPATVVPP 108 [32][TOP] >UniRef100_Q9U7P0 Putative uncharacterized protein (Fragment) n=1 Tax=Eufolliculina uhligi RepID=Q9U7P0_9CILI Length = 254 Score = 108 bits (271), Expect = 1e-22 Identities = 60/113 (53%), Positives = 63/113 (55%), Gaps = 20/113 (17%) Frame = +1 Query: 19 N*QHRGHPTT--PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP----- 177 N QH GHP PP Y QQ G PP Q YPP+ Y ++GYPP YP YPP Sbjct: 130 NAQHAGHPPQGYPPQQAYPPQQ---GYPPQQAYPPQAYPQQGYPPQAYPQQAYPPQQAYP 186 Query: 178 --------QGYPPQGYPPP-GYPP-QGYPPPPY-SAQGYPPQ--YAPQYAQPP 297 QGYPPQGYPPP GYPP QGYPP Y QGYPPQ Y PQ PP Sbjct: 187 PQQAYPPQQGYPPQGYPPPQGYPPQQGYPPQAYPPQQGYPPQQGYPPQQGYPP 239 Score = 91.3 bits (225), Expect = 3e-17 Identities = 51/81 (62%), Positives = 54/81 (66%), Gaps = 7/81 (8%) Frame = +1 Query: 49 PPMSYYNQQQPPVGT-PPPQGYPPE-GYGKEGYPPP-GYPPP-GYPPQGYPPQ-GYPP-P 210 PP +Y Q PP PP Q YPP+ GY +GYPPP GYPP GYPPQ YPPQ GYPP Sbjct: 170 PPQAYPQQAYPPQQAYPPQQAYPPQQGYPPQGYPPPQGYPPQQGYPPQAYPPQQGYPPQQ 229 Query: 211 GYPP-QGYPPPPYSAQGYPPQ 270 GYPP QGYPP QGYPPQ Sbjct: 230 GYPPQQGYPP----QQGYPPQ 246 Score = 84.7 bits (208), Expect = 3e-15 Identities = 47/73 (64%), Positives = 49/73 (67%), Gaps = 7/73 (9%) Frame = +1 Query: 49 PPMSYYNQQQ--PPVGTPPPQGYPPEGYGKEGYPPPGYPPP-GYPPQ-GYPPQ-GYPP-P 210 PP Y QQ PP G PPPQGYPP+ +GYPP YPP GYPPQ GYPPQ GYPP Sbjct: 186 PPQQAYPPQQGYPPQGYPPPQGYPPQ----QGYPPQAYPPQQGYPPQQGYPPQQGYPPQQ 241 Query: 211 GYPP-QGYPPPPY 246 GYPP QGYPP Y Sbjct: 242 GYPPQQGYPPYGY 254 Score = 78.2 bits (191), Expect = 3e-13 Identities = 45/99 (45%), Positives = 52/99 (52%), Gaps = 8/99 (8%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPE---GYGKEGYPPPGYPPP-GYPPQ-GYP 189 +H+G P Q + + P G+ P+ G+PP GYPP YPPQ GYP Sbjct: 102 RHKGRPA-------GQVRLGITWAPDGGHKPKQNPNAQHAGHPPQGYPPQQAYPPQQGYP 154 Query: 190 PQ-GYPPPGYPPQGYPPPPYSAQGYPPQ--YAPQYAQPP 297 PQ YPP YP QGYPP Y Q YPPQ Y PQ A PP Sbjct: 155 PQQAYPPQAYPQQGYPPQAYPQQAYPPQQAYPPQQAYPP 193 [33][TOP] >UniRef100_B9RH08 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RH08_RICCO Length = 118 Score = 108 bits (270), Expect = 2e-22 Identities = 60/130 (46%), Positives = 66/130 (50%), Gaps = 16/130 (12%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY-----PPPGYPPQGYPPQGYPPP--- 210 MSY Q+PP PP GY P YPPPGY PPP P +GYPP GYPPP Sbjct: 1 MSY---QKPPHEHYPPPGYAP------SYPPPGYTPSAPPPPPQPYEGYPPPGYPPPPGP 51 Query: 211 --------GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAA 366 GY +GYPPPP + PPQY QY HHH N +GC AA Sbjct: 52 RQQYEGYQGYFAEGYPPPP--PRPGPPQYHHQYHY---EHHHYQDNTGGCTSFFQGCLAA 106 Query: 367 LCCCCLLDAC 396 LCCCC+LD C Sbjct: 107 LCCCCVLDEC 116 [34][TOP] >UniRef100_B8B948 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B948_ORYSI Length = 120 Score = 107 bits (266), Expect = 5e-22 Identities = 58/115 (50%), Positives = 65/115 (56%), Gaps = 14/115 (12%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPG---YPPQGYPPQG--YPPPG--YPPQGYPPPP--- 243 PP + YPP GY + G P YPPP YPPQGYP YPPP YPP PPPP Sbjct: 7 PPDEPYPPPGYPQSG--PYPYPPPSGAVYPPQGYPSSHGVYPPPQGPYPPPHQPPPPGYQ 64 Query: 244 -YSAQGYPPQYAPQYAQPPPPH---HHNNSNNSSSPGCLEGCCAALCCCCLLDAC 396 Y QG P Y P PPPP+ HH+ + S G L+GC AALCCCCLL+ C Sbjct: 65 GYFNQGQQPYYPPP-PPPPPPYDHCHHHCGDEGSGAGFLKGCLAALCCCCLLEEC 118 [35][TOP] >UniRef100_A9P8I3 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P8I3_POPTR Length = 125 Score = 106 bits (265), Expect = 7e-22 Identities = 59/122 (48%), Positives = 63/122 (51%), Gaps = 21/122 (17%) Frame = +1 Query: 97 PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ-----GYPPPGYPPQGYP--PPPYSAQ 255 P Q YPP GY YPPPGYPP P GYPP GYPPPG PP GY PPP + Sbjct: 7 PHQPYPPSGYSPP-YPPPGYPPTTPPYGGYPPTTPPYGGYPPPGAPPPGYSGYPPPGPPR 65 Query: 256 GYPPQYAPQYAQPPPP-------------HHHNNSNNSSSPGCLEGCCAALCCCC-LLDA 393 GY +A Y PPPP HHH + SS L GC AALCCCC L + Sbjct: 66 GYQGYFAEGYPPPPPPPGPQQYQECYHYEHHHYQDDGCSS--FLRGCLAALCCCCVLEEC 123 Query: 394 CF 399 CF Sbjct: 124 CF 125 Score = 104 bits (259), Expect = 4e-21 Identities = 64/140 (45%), Positives = 70/140 (50%), Gaps = 16/140 (11%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVG----TPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP 192 Q H PP S Y+ PP G TPP GYPP GYPPPG PPPGY Sbjct: 4 QKAPHQPYPP-SGYSPPYPPPGYPPTTPPYGGYPPTTPPYGGYPPPGAPPPGY------- 55 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP------------HHHNNSNNSSS 336 GYPPPG PP+GY Y A+GYPP PPPP HHH + SS Sbjct: 56 SGYPPPG-PPRGY--QGYFAEGYPP-------PPPPPGPQQYQECYHYEHHHYQDDGCSS 105 Query: 337 PGCLEGCCAALCCCCLLDAC 396 L GC AALCCCC+L+ C Sbjct: 106 --FLRGCLAALCCCCVLEEC 123 [36][TOP] >UniRef100_C6TLY7 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=C6TLY7_SOYBN Length = 113 Score = 105 bits (261), Expect = 2e-21 Identities = 63/117 (53%), Positives = 78/117 (66%) Frame = +3 Query: 54 NELLQSTTATRRNSAATRLSAGGIRKGRISATGISTTGISTTRISTARISSAGLSTTRIS 233 NELLQ R+SAA RLSAGG+RKG IS GI +GI + I TA IS +TTR+S Sbjct: 6 NELLQPAATAGRSSAAARLSAGGVRKGGISTAGIPASGIPASGIPTAGIS----ATTRLS 61 Query: 234 TATILSARLSSSVRSSIRSTTTTSSS**QQQFIEPWLLRRLLCCSLLLLSIGCLLLR 404 +A + A +SS++RSSIRS + S+ +F PWL RL CSLLLLSIGC+LLR Sbjct: 62 SAALPGAGVSSALRSSIRSASAPST-----KFNWPWLFGRLFGCSLLLLSIGCVLLR 113 [37][TOP] >UniRef100_A2EVN2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2EVN2_TRIVA Length = 231 Score = 104 bits (260), Expect = 3e-21 Identities = 56/90 (62%), Positives = 58/90 (64%), Gaps = 8/90 (8%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP-QGYPPQ-GYPP-PGYP 219 PPM Y P G PP GYPP+GY + GYPP GYP PGYPP QGYPPQ GYPP PGYP Sbjct: 138 PPMGGY----PQAGYPPQGGYPPQGYPQAGYPPQGYPQPGYPPQQGYPPQPGYPPQPGYP 193 Query: 220 P-QGYPP---PPYSAQGYPPQ-YAPQYAQP 294 P QGYPP P GYPPQ Y PQ P Sbjct: 194 PQQGYPPMGKPGMPQPGYPPQGYPPQQGYP 223 Score = 98.6 bits (244), Expect = 2e-19 Identities = 49/73 (67%), Positives = 50/73 (68%), Gaps = 5/73 (6%) Frame = +1 Query: 94 PPPQGYPPEG-YGKEGYPPP-GYPPPGYPPQGYPPQGYPPPGYPP-QGYPPPPYSAQGYP 264 P PQGYPP G Y + GYPP GYPP GYP GYPPQGYP PGYPP QGYPP P GYP Sbjct: 132 PRPQGYPPMGGYPQAGYPPQGGYPPQGYPQAGYPPQGYPQPGYPPQQGYPPQP----GYP 187 Query: 265 PQ--YAPQYAQPP 297 PQ Y PQ PP Sbjct: 188 PQPGYPPQQGYPP 200 [38][TOP] >UniRef100_A7PSK5 Chromosome chr6 scaffold_28, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PSK5_VITVI Length = 191 Score = 103 bits (257), Expect = 6e-21 Identities = 52/103 (50%), Positives = 60/103 (58%), Gaps = 2/103 (1%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKE-GYPPPGYPPPGYPPQGYPPQGYPPP 210 GH P +Y++Q PP PPP GYPP GY GYPP GYPPPG GYPP GYPPP Sbjct: 27 GHYRPPHGAYHSQGYPPSAYPPPGGYPPSGYPPPGGYPPSGYPPPG----GYPPAGYPPP 82 Query: 211 -GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSS 336 GYPP YPPP GYPP P PP+H + +N+ + Sbjct: 83 GGYPPAPYPPP----GGYPPSGYP--GPSAPPYHSGHGSNTGA 119 [39][TOP] >UniRef100_Q6Z1G1 Os08g0536400 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6Z1G1_ORYSJ Length = 117 Score = 103 bits (256), Expect = 8e-21 Identities = 57/115 (49%), Positives = 64/115 (55%), Gaps = 14/115 (12%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPG---YPPQGYPPQG--YPPPG--YPPQGYPPPP--- 243 PP + YPP GY + G P YPPP YPPQGYP YPPP YPP PPPP Sbjct: 7 PPDEPYPPPGYPQSG--PYPYPPPSGAVYPPQGYPSSHGVYPPPQGPYPPPHQPPPPGYQ 64 Query: 244 -YSAQGYPPQYAPQYAQPPPPH---HHNNSNNSSSPGCLEGCCAALCCCCLLDAC 396 Y QG P Y P PP P+ HH+ + S G L+GC AALCCCCLL+ C Sbjct: 65 GYFNQGQQPYYPP----PPLPYDHCHHHCGDEGSGAGFLKGCLAALCCCCLLEEC 115 [40][TOP] >UniRef100_C5YG10 Putative uncharacterized protein Sb06g028480 n=1 Tax=Sorghum bicolor RepID=C5YG10_SORBI Length = 99 Score = 103 bits (256), Expect = 8e-21 Identities = 60/122 (49%), Positives = 65/122 (53%), Gaps = 7/122 (5%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG---YPPPGYPPQGYPPQGYPPPG---Y 216 MSY Q PP GT YPP G YPPPG YPPPG Q YPPPG Y Sbjct: 1 MSY---QAPPPGTA---AYPPPG---TAYPPPGQQAYPPPGQ-------QAYPPPGQQAY 44 Query: 217 PPQGY-PPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDA 393 PP Y PPP +A GYPP PPP +S S+ G L+GC AALCCCC+LD Sbjct: 45 PPPAYGAPPPMAAGGYPPP-------PPPQQQQQDSKGGSNDGFLKGCLAALCCCCMLDM 97 Query: 394 CF 399 CF Sbjct: 98 CF 99 [41][TOP] >UniRef100_Q9LPW8 F13K23.6 protein n=1 Tax=Arabidopsis thaliana RepID=Q9LPW8_ARATH Length = 198 Score = 102 bits (253), Expect = 2e-20 Identities = 57/123 (46%), Positives = 65/123 (52%), Gaps = 23/123 (18%) Frame = +1 Query: 97 PPQGYPPEGYGKEGYPPPGYP----PPGYPPQGYPPQGYPPPGYPPQGYPPP---PYSA- 252 PP+ YPP GY + YPPPGYP PPGYP +GYPPP P GYPPP PY Sbjct: 76 PPESYPPPGY-QSHYPPPGYPSAPPPPGYPSPPSHHEGYPPP-QPYGGYPPPSSRPYEGG 133 Query: 253 -QGY--PPQYAPQYAQPPPP------------HHHNNSNNSSSPGCLEGCCAALCCCCLL 387 QGY Y Q+ PPPP HHH ++S + GC AALCCCCLL Sbjct: 134 YQGYFAGGGYPHQHHGPPPPPPPQNYDHCHHDHHHYQDSDSGCFSFIRGCLAALCCCCLL 193 Query: 388 DAC 396 + C Sbjct: 194 EEC 196 [42][TOP] >UniRef100_Q940Z6 At1g12810/F13K23_4 n=1 Tax=Arabidopsis thaliana RepID=Q940Z6_ARATH Length = 129 Score = 102 bits (253), Expect = 2e-20 Identities = 57/123 (46%), Positives = 65/123 (52%), Gaps = 23/123 (18%) Frame = +1 Query: 97 PPQGYPPEGYGKEGYPPPGYP----PPGYPPQGYPPQGYPPPGYPPQGYPPP---PYSA- 252 PP+ YPP GY + YPPPGYP PPGYP +GYPPP P GYPPP PY Sbjct: 7 PPESYPPPGY-QSHYPPPGYPSAPPPPGYPSPPSHHEGYPPP-QPYGGYPPPSSRPYEGG 64 Query: 253 -QGY--PPQYAPQYAQPPPP------------HHHNNSNNSSSPGCLEGCCAALCCCCLL 387 QGY Y Q+ PPPP HHH ++S + GC AALCCCCLL Sbjct: 65 YQGYFAGGGYPHQHHGPPPPPPPQNYDHCHHDHHHYQDSDSGCFSFIRGCLAALCCCCLL 124 Query: 388 DAC 396 + C Sbjct: 125 EEC 127 [43][TOP] >UniRef100_Q70YQ5 PGYRP protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q70YQ5_CHLRE Length = 169 Score = 101 bits (251), Expect = 3e-20 Identities = 58/100 (58%), Positives = 61/100 (61%), Gaps = 16/100 (16%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPE-GY-GKEGYPP-PGYPP-PGYPPQ-GYPPQ------ 195 PP Y P G PPP GYPP+ GY GYPP PGYPP PGYPPQ GYPPQ Sbjct: 4 PPPGYPGAPGYPPGYPPPAGYPPQPGYPAPAGYPPQPGYPPQPGYPPQPGYPPQPGYPPP 63 Query: 196 -GYPPPGYPPQ-GYPPPPYSAQGYPPQ---YAPQYAQPPP 300 GYP PGYPPQ GYPP P+ GYPP Y PQ+ PPP Sbjct: 64 AGYPAPGYPPQPGYPPAPH---GYPPAPHGYPPQHGYPPP 100 Score = 86.7 bits (213), Expect = 8e-16 Identities = 55/103 (53%), Positives = 58/103 (56%), Gaps = 21/103 (20%) Frame = +1 Query: 97 PPQGYPPEGYGKEGYPPPGYPPP-GYPPQ-------GYPPQ-GYPP-PGYPPQ-GYPPPP 243 PP GYP G GYPP GYPPP GYPPQ GYPPQ GYPP PGYPPQ GYPP P Sbjct: 4 PPPGYP----GAPGYPP-GYPPPAGYPPQPGYPAPAGYPPQPGYPPQPGYPPQPGYPPQP 58 Query: 244 -------YSAQGYPPQ--YAP-QYAQPPPPHHHNNSNNSSSPG 342 Y A GYPPQ Y P + PP PH + + PG Sbjct: 59 GYPPPAGYPAPGYPPQPGYPPAPHGYPPAPHGYPPQHGYPPPG 101 Score = 83.2 bits (204), Expect = 8e-15 Identities = 49/94 (52%), Positives = 52/94 (55%), Gaps = 5/94 (5%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP-PGYPPP-GYPPQGYPPQ-GYP 204 G+P P P G PP GYPP+ GYPP PGYPPP GYP GYPPQ GYP Sbjct: 23 GYPPQPGYPAPAGYPPQPGYPPQPGYPPQ----PGYPPQPGYPPPAGYPAPGYPPQPGYP 78 Query: 205 PPGYPPQGYPPPPYSAQGYPPQ--YAPQYAQPPP 300 P P GYPP P+ GYPPQ Y P A P P Sbjct: 79 P---APHGYPPAPH---GYPPQHGYPPPGAYPAP 106 Score = 73.2 bits (178), Expect = 9e-12 Identities = 40/61 (65%), Positives = 41/61 (67%), Gaps = 7/61 (11%) Frame = +1 Query: 139 YPPPGYP-PPGYPPQGYPPQGYPP-PGYP-PQGYPPPP-YSAQ-GYPPQ--YAPQYAQPP 297 +PPPGYP PGYPP PP GYPP PGYP P GYPP P Y Q GYPPQ Y PQ PP Sbjct: 3 HPPPGYPGAPGYPPGYPPPAGYPPQPGYPAPAGYPPQPGYPPQPGYPPQPGYPPQPGYPP 62 Query: 298 P 300 P Sbjct: 63 P 63 Score = 65.1 bits (157), Expect = 2e-09 Identities = 41/84 (48%), Positives = 42/84 (50%), Gaps = 9/84 (10%) Frame = +1 Query: 40 PTTPPMSYYNQQQ---PPVGTPPPQGYPPEGYGKEGYPPPGYPPP--GYP--PQGYPPQ- 195 P PP Y Q P G PPP GYP GY P PGYPP GYP P GYPPQ Sbjct: 40 PGYPPQPGYPPQPGYPPQPGYPPPAGYPAPGYP----PQPGYPPAPHGYPPAPHGYPPQH 95 Query: 196 GYPPPG-YPPQGYPPPPYSAQGYP 264 GYPPPG YP P + G P Sbjct: 96 GYPPPGAYPAPHTVVVPVAVHGAP 119 [44][TOP] >UniRef100_A9NRB0 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NRB0_PICSI Length = 208 Score = 101 bits (251), Expect = 3e-20 Identities = 43/68 (63%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 100 PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQ-GYPPPPYSAQGYPPQYA 276 P GYPP GY GYPP GYPP GYPP GYPP GYPP GYPPQ GYPP + GYP Sbjct: 28 PSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQGGYPPEHNAPHGYPQHGP 87 Query: 277 PQYAQPPP 300 P A P P Sbjct: 88 PPGAYPSP 95 Score = 94.7 bits (234), Expect = 3e-18 Identities = 48/94 (51%), Positives = 49/94 (52%), Gaps = 5/94 (5%) Frame = +1 Query: 76 QPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP-GYPPQGYPPPPYSA 252 Q P G PP GYPP GY GYPP GYPP GYPP GYPP GYPP GYPP+ P Y Sbjct: 26 QSPSGYPP-SGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQGGYPPEHNAPHGYPQ 84 Query: 253 QGYPPQYAPQ----YAQPPPPHHHNNSNNSSSPG 342 G PP P Y P P H SS G Sbjct: 85 HGPPPGAYPSPYGGYMPPGPSSGHPPQGQSSGHG 118 Score = 92.4 bits (228), Expect = 1e-17 Identities = 40/69 (57%), Positives = 43/69 (62%), Gaps = 3/69 (4%) Frame = +1 Query: 106 GYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQY 285 G P GY GYPP GYPP GYPP GYPP GYPP GYPP GYPP GYPP++ + Sbjct: 25 GQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPP----QGGYPPEHNAPH 80 Query: 286 AQP---PPP 303 P PPP Sbjct: 81 GYPQHGPPP 89 Score = 86.3 bits (212), Expect = 1e-15 Identities = 47/97 (48%), Positives = 51/97 (52%), Gaps = 8/97 (8%) Frame = +1 Query: 4 RGKASN*QHRGHPTT-PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP-GYPP 177 RG SN H P+ PP Y PP G PP GYPP GY GYPP GYPP GYPP Sbjct: 16 RGLFSNILHGQSPSGYPPSGYPPSGYPPAGYPPA-GYPPAGYPPSGYPPAGYPPQGGYPP 74 Query: 178 QGYPPQGYPPPGYPPQGYPP------PPYSAQGYPPQ 270 + P GYP G PP YP PP + G+PPQ Sbjct: 75 EHNAPHGYPQHGPPPGAYPSPYGGYMPPGPSSGHPPQ 111 Score = 78.6 bits (192), Expect = 2e-13 Identities = 34/66 (51%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +1 Query: 151 GYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHH--HNNSN 324 G P GYPP GYPP GYPP GYPP GYPP Y GYPP P PP H+ H Sbjct: 25 GQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQGGYPPEHNAPHGYPQ 84 Query: 325 NSSSPG 342 + PG Sbjct: 85 HGPPPG 90 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = -1 Query: 233 GYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*PCGGGVP 87 G G P GYP GYP GYP GYP GYP YP G P GG P Sbjct: 25 GQSPSGYPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYPPQGGYP 73 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = -1 Query: 245 YGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*PCGGGVPTG 81 Y GYP G P GYP GYP GYP GYP GYP P GG P P G Sbjct: 31 YPPSGYPPSGYPPAGYPPAGYPPAGYPPSGYPPAGYP----PQGGYPPEHNAPHG 81 [45][TOP] >UniRef100_A8J964 Predicted protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J964_CHLRE Length = 148 Score = 101 bits (251), Expect = 3e-20 Identities = 64/147 (43%), Positives = 71/147 (48%), Gaps = 20/147 (13%) Frame = +1 Query: 7 GKASN*QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPP-EGYG-KEGYPPPG--------Y 156 G+ N G+P PP P G PPP GYP + YG GYPPPG Y Sbjct: 10 GRDPNKAVPGYPAGPP-----GYPPQPGYPPPPGYPSAQSYGGPPGYPPPGPGYGAPPAY 64 Query: 157 PPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYA-PQYAQPP----PPHHHNNS 321 P P P GYPPQG PPP P GYPPP G P YA P Y Q P P HH+N Sbjct: 65 PSPYSAPPGYPPQGPPPPPGYPGGYPPP-----GPPGAYAQPVYIQGPGPSGPSHHYNQH 119 Query: 322 NNSSSPGCLEGCC-----AALCCCCLL 387 + S + CC AALCCCCL+ Sbjct: 120 HGHHSDDSAKWCCGLGALAALCCCCLM 146 [46][TOP] >UniRef100_UPI0001984D5A PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984D5A Length = 300 Score = 100 bits (250), Expect = 4e-20 Identities = 43/90 (47%), Positives = 48/90 (53%), Gaps = 8/90 (8%) Frame = +1 Query: 34 GHPTTP--------PMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYP 189 GHP+ P P Q P G PPPQ YPP Y + YPP YPP YPPQ +P Sbjct: 207 GHPSEPSYGQPHGYPPPGQVQDYPAAGYPPPQAYPPHAYPPQAYPPQAYPPQAYPPQAHP 266 Query: 190 PQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 PQ YPP +PP+ YPP Y Q YPP P Sbjct: 267 PQAYPPQAHPPRAYPPQAYPPQAYPPPAQP 296 Score = 99.4 bits (246), Expect = 1e-19 Identities = 54/108 (50%), Positives = 56/108 (51%), Gaps = 17/108 (15%) Frame = +1 Query: 40 PTTPPMSYYNQQQPP-VGTPP------PQGYPPEG----YGKEGYPPP-GYPPPGYPPQG 183 P T MS +Q PP VG P P GYPP G Y GYPPP YPP YPPQ Sbjct: 190 PPTQQMSRVDQPIPPLVGHPSEPSYGQPHGYPPPGQVQDYPAAGYPPPQAYPPHAYPPQA 249 Query: 184 YPPQGYPPPGYPPQGYPPPPYSAQ-----GYPPQYAPQYAQPPPPHHH 312 YPPQ YPP YPPQ +PP Y Q YPPQ P A PPP H Sbjct: 250 YPPQAYPPQAYPPQAHPPQAYPPQAHPPRAYPPQAYPPQAYPPPAQPH 297 [47][TOP] >UniRef100_A7PZM5 Chromosome chr15 scaffold_40, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PZM5_VITVI Length = 276 Score = 100 bits (250), Expect = 4e-20 Identities = 43/90 (47%), Positives = 48/90 (53%), Gaps = 8/90 (8%) Frame = +1 Query: 34 GHPTTP--------PMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYP 189 GHP+ P P Q P G PPPQ YPP Y + YPP YPP YPPQ +P Sbjct: 183 GHPSEPSYGQPHGYPPPGQVQDYPAAGYPPPQAYPPHAYPPQAYPPQAYPPQAYPPQAHP 242 Query: 190 PQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 PQ YPP +PP+ YPP Y Q YPP P Sbjct: 243 PQAYPPQAHPPRAYPPQAYPPQAYPPPAQP 272 Score = 99.4 bits (246), Expect = 1e-19 Identities = 54/108 (50%), Positives = 56/108 (51%), Gaps = 17/108 (15%) Frame = +1 Query: 40 PTTPPMSYYNQQQPP-VGTPP------PQGYPPEG----YGKEGYPPP-GYPPPGYPPQG 183 P T MS +Q PP VG P P GYPP G Y GYPPP YPP YPPQ Sbjct: 166 PPTQQMSRVDQPIPPLVGHPSEPSYGQPHGYPPPGQVQDYPAAGYPPPQAYPPHAYPPQA 225 Query: 184 YPPQGYPPPGYPPQGYPPPPYSAQ-----GYPPQYAPQYAQPPPPHHH 312 YPPQ YPP YPPQ +PP Y Q YPPQ P A PPP H Sbjct: 226 YPPQAYPPQAYPPQAHPPQAYPPQAHPPRAYPPQAYPPQAYPPPAQPH 273 [48][TOP] >UniRef100_Q0D319 Rhodopsin (Fragment) n=1 Tax=Octopoteuthis nielseni RepID=Q0D319_9MOLL Length = 130 Score = 100 bits (250), Expect = 4e-20 Identities = 40/61 (65%), Positives = 44/61 (72%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M+ + Q PPQGYPP+GY +GYPP GYPP GYPPQGYPPQGYPP GYPPQ P Sbjct: 69 MAMMQKMQAQQAQAPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQAAP 128 Query: 235 P 237 P Sbjct: 129 P 129 Score = 95.5 bits (236), Expect = 2e-18 Identities = 38/46 (82%), Positives = 38/46 (82%) Frame = +1 Query: 142 PPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 PP GYPP GYPPQGYPPQGYPP GYPPQGYPP Y QGYPPQ AP Sbjct: 83 PPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQAAP 128 Score = 92.4 bits (228), Expect = 1e-17 Identities = 39/57 (68%), Positives = 41/57 (71%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQ 225 M Q PP G PP QGYPP+GY +GYPP GYPP GYPPQGYPPQGYPP PPQ Sbjct: 75 MQAQQAQAPPQGYPP-QGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQAAPPQ 130 Score = 88.6 bits (218), Expect = 2e-16 Identities = 36/47 (76%), Positives = 36/47 (76%) Frame = +1 Query: 157 PPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PP GYPPQGYPPQGYPP GYPPQGYPP Y QGYPPQ P A PP Sbjct: 83 PPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQAAPP 129 Score = 75.1 bits (183), Expect = 2e-12 Identities = 32/49 (65%), Positives = 34/49 (69%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 PP Y Q PP G PP QGYPP+GY +GYPP GYPP GYPPQ PPQ Sbjct: 83 PPQGYPPQGYPPQGYPP-QGYPPQGYPPQGYPPQGYPPQGYPPQAAPPQ 130 [49][TOP] >UniRef100_Q0D316 Rhodopsin (Fragment) n=1 Tax=Megalocranchia fisheri RepID=Q0D316_9MOLL Length = 298 Score = 100 bits (248), Expect = 7e-20 Identities = 40/56 (71%), Positives = 42/56 (75%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP 237 QQQ P G PPP GYPP+GY +GYPP GYPP GYPPQGYPPQG PP G PP PP Sbjct: 241 QQQQPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPPAAAPP 296 Score = 93.6 bits (231), Expect = 6e-18 Identities = 42/55 (76%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = +1 Query: 136 GYPPP-GYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 GYPPP GYPP GYPPQGYPPQGYPP GYPPQGYPP QG PPQ AP A PP Sbjct: 247 GYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPP-----QGAPPQGAPPAAAPP 296 Score = 79.7 bits (195), Expect = 9e-14 Identities = 34/47 (72%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 160 PPGYPP-QGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 P GYPP GYPPQGYPP GYPPQGYPP Y QGYPPQ AP PP Sbjct: 245 PAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPP 291 Score = 78.2 bits (191), Expect = 3e-13 Identities = 39/67 (58%), Positives = 40/67 (59%), Gaps = 9/67 (13%) Frame = +1 Query: 55 MSYYNQQQP-----PVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 M QQQP P G PP PQGYPP +GYPP GYPP GYPPQG PPQG PP Sbjct: 237 MQQQQQQQPAGYPPPAGYPPQGYPPQGYPP-----QGYPPQGYPPQGYPPQGAPPQGAPP 291 Query: 208 PGYPPQG 228 PPQG Sbjct: 292 AAAPPQG 298 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +1 Query: 178 QGYPPQGYPPP-GYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 Q P GYPPP GYPPQGYPP Y QGYPPQ P PP Sbjct: 241 QQQQPAGYPPPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPP 281 [50][TOP] >UniRef100_C5YHP3 Putative uncharacterized protein Sb07g025930 n=1 Tax=Sorghum bicolor RepID=C5YHP3_SORBI Length = 110 Score = 99.8 bits (247), Expect = 9e-20 Identities = 54/113 (47%), Positives = 67/113 (59%), Gaps = 12/113 (10%) Frame = +1 Query: 94 PPPQGYPPEGYGK----EGYPPP----GYPPPGYPPQG--YPPQGYPPPGYPPQGY--PP 237 PP + YPP GY + + YPPP G+PPP PPQG YPP +PPPGY QGY P Sbjct: 7 PPEEPYPPPGYPRPPPPDVYPPPPWGHGHPPPPPPPQGPYYPPPQHPPPGY--QGYFNDP 64 Query: 238 PPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDAC 396 PP+ +Y Q+ H+H N +SSS G L+GC AALCCCC+L+ C Sbjct: 65 PPHG------EYQQQH-----HHNHGNQGSSSSSGFLKGCLAALCCCCVLEEC 106 [51][TOP] >UniRef100_A0DJL3 Chromosome undetermined scaffold_53, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DJL3_PARTE Length = 294 Score = 98.6 bits (244), Expect = 2e-19 Identities = 56/100 (56%), Positives = 62/100 (62%), Gaps = 7/100 (7%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKE-GYPP-PGYPP-PGYPPQ-GYPP 192 Q G+P P + P G PP GYPP+G+ + GYPP PGYPP PGYPPQ GYPP Sbjct: 133 QQIGYPQQPGFPHQPGYPPQQGHPPQPGYPPQGHPPQPGYPPQPGYPPQPGYPPQPGYPP 192 Query: 193 -QGYPP-PGYPPQ-GYPPPPYSAQGYPPQYAPQYAQPPPP 303 QGYPP PGYPPQ GYPP P GYPPQ + QP P Sbjct: 193 QQGYPPQPGYPPQPGYPPQP----GYPPQPGQPHLQPGYP 228 Score = 87.4 bits (215), Expect = 4e-16 Identities = 54/111 (48%), Positives = 60/111 (54%), Gaps = 5/111 (4%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ-GY 201 Q +G P P Y QQ G P GYPP+ +G+PP PGYPPQG+PPQ GY Sbjct: 124 QGQGFPQQPQQIGYPQQP---GFPHQPGYPPQ----QGHPPQ----PGYPPQGHPPQPGY 172 Query: 202 PP-PGYPPQ-GYPPPPYSAQGYPPQ--YAPQYAQPPPPHHHNNSNNSSSPG 342 PP PGYPPQ GYPP P GYPPQ Y PQ PP P + PG Sbjct: 173 PPQPGYPPQPGYPPQP----GYPPQQGYPPQPGYPPQPGYPPQPGYPPQPG 219 Score = 82.0 bits (201), Expect = 2e-14 Identities = 51/88 (57%), Positives = 54/88 (61%), Gaps = 8/88 (9%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPE-GYGKE-GYPP-PGYPPP-GYPPQ-GYPPQ 195 +GHP P PP G PP GYPP+ GY + GYPP PGYPP GYPPQ GYPPQ Sbjct: 153 QGHPPQPGY-------PPQGHPPQPGYPPQPGYPPQPGYPPQPGYPPQQGYPPQPGYPPQ 205 Query: 196 -GYPP-PGYPPQ-GYPPPPYSAQGYPPQ 270 GYPP PGYPPQ G P GYPPQ Sbjct: 206 PGYPPQPGYPPQPGQPHLQPGYPGYPPQ 233 [52][TOP] >UniRef100_UPI000180C958 PREDICTED: hypothetical protein n=1 Tax=Ciona intestinalis RepID=UPI000180C958 Length = 157 Score = 98.2 bits (243), Expect = 3e-19 Identities = 64/140 (45%), Positives = 73/140 (52%), Gaps = 22/140 (15%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPE-GYGKEGYPPPGYPP-PGYPPQ--GYPPQ-GY 201 +P PP++ QQ P P GYPP+ GY + Y GYPP PGYPPQ GYPPQ GY Sbjct: 25 YPPQPPVAQAGMQQAP---QPGPGYPPQPGYQQAPYYQGGYPPQPGYPPQQGGYPPQGGY 81 Query: 202 PP-PGYPPQ-GYPPPPYSAQGYPPQ--YAPQYAQPPPPHHH-------------NNSNNS 330 PP PGYPPQ GYPP GYPPQ Y PQ H H + + Sbjct: 82 PPQPGYPPQGGYPP----QGGYPPQGGYPPQGQHISTDHRHGKKAPNVVVVEERHKKRDE 137 Query: 331 SSPGCLEGCCAALCCCCLLD 390 ++ L GCC AL CC LLD Sbjct: 138 TADCFLIGCCTALLCCWLLD 157 [53][TOP] >UniRef100_Q6LE68 Rhodopsin (Fragment) n=1 Tax=Sepia officinalis RepID=Q6LE68_SEPOF Length = 357 Score = 98.2 bits (243), Expect = 3e-19 Identities = 51/82 (62%), Positives = 52/82 (63%), Gaps = 7/82 (8%) Frame = +1 Query: 73 QQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP----GYPPQGYPP--QGYPPP-GYPPQGY 231 QQ PP YPP+G GYPP GYPPP GYPPQGYPP QGYPP GYPPQGY Sbjct: 274 QQQQAAYPPQGAYPPQG----GYPPQGYPPPPAQGGYPPQGYPPPPQGYPPAQGYPPQGY 329 Query: 232 PPPPYSAQGYPPQYAPQYAQPP 297 PPP QG PPQ AP A PP Sbjct: 330 PPP----QGAPPQGAPPQAAPP 347 Score = 89.0 bits (219), Expect = 2e-16 Identities = 51/84 (60%), Positives = 53/84 (63%), Gaps = 12/84 (14%) Frame = +1 Query: 55 MSYYNQQQ---PPVGTPPPQG-YPPEGY----GKEGYPPPGYPPP--GYPP-QGYPPQGY 201 M QQQ PP G PPQG YPP+GY + GYPP GYPPP GYPP QGYPPQGY Sbjct: 270 MQKMQQQQAAYPPQGAYPPQGGYPPQGYPPPPAQGGYPPQGYPPPPQGYPPAQGYPPQGY 329 Query: 202 PPP-GYPPQGYPPPPYSAQGYPPQ 270 PPP G PPQG PP Q PPQ Sbjct: 330 PPPQGAPPQGAPP-----QAAPPQ 348 Score = 83.2 bits (204), Expect = 8e-15 Identities = 45/79 (56%), Positives = 46/79 (58%), Gaps = 8/79 (10%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPE----GYGKEGYPPP--GYPPP-GYPPQGYPP-QGYP 204 PP Y PP G PPQGYPP GY +GYPPP GYPP GYPPQGYPP QG P Sbjct: 281 PPQGAY----PPQGGYPPQGYPPPPAQGGYPPQGYPPPPQGYPPAQGYPPQGYPPPQGAP 336 Query: 205 PPGYPPQGYPPPPYSAQGY 261 P G PPQ PP Q Y Sbjct: 337 PQGAPPQAAPPQGVDNQAY 355 [54][TOP] >UniRef100_O16005 Rhodopsin n=1 Tax=Sepia officinalis RepID=OPSD_SEPOF Length = 464 Score = 98.2 bits (243), Expect = 3e-19 Identities = 51/82 (62%), Positives = 52/82 (63%), Gaps = 7/82 (8%) Frame = +1 Query: 73 QQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP----GYPPQGYPP--QGYPPP-GYPPQGY 231 QQ PP YPP+G GYPP GYPPP GYPPQGYPP QGYPP GYPPQGY Sbjct: 381 QQQQAAYPPQGAYPPQG----GYPPQGYPPPPAQGGYPPQGYPPPPQGYPPAQGYPPQGY 436 Query: 232 PPPPYSAQGYPPQYAPQYAQPP 297 PPP QG PPQ AP A PP Sbjct: 437 PPP----QGAPPQGAPPQAAPP 454 Score = 89.0 bits (219), Expect = 2e-16 Identities = 51/84 (60%), Positives = 53/84 (63%), Gaps = 12/84 (14%) Frame = +1 Query: 55 MSYYNQQQ---PPVGTPPPQG-YPPEGY----GKEGYPPPGYPPP--GYPP-QGYPPQGY 201 M QQQ PP G PPQG YPP+GY + GYPP GYPPP GYPP QGYPPQGY Sbjct: 377 MQKMQQQQAAYPPQGAYPPQGGYPPQGYPPPPAQGGYPPQGYPPPPQGYPPAQGYPPQGY 436 Query: 202 PPP-GYPPQGYPPPPYSAQGYPPQ 270 PPP G PPQG PP Q PPQ Sbjct: 437 PPPQGAPPQGAPP-----QAAPPQ 455 Score = 83.2 bits (204), Expect = 8e-15 Identities = 45/79 (56%), Positives = 46/79 (58%), Gaps = 8/79 (10%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPE----GYGKEGYPPP--GYPPP-GYPPQGYPP-QGYP 204 PP Y PP G PPQGYPP GY +GYPPP GYPP GYPPQGYPP QG P Sbjct: 388 PPQGAY----PPQGGYPPQGYPPPPAQGGYPPQGYPPPPQGYPPAQGYPPQGYPPPQGAP 443 Query: 205 PPGYPPQGYPPPPYSAQGY 261 P G PPQ PP Q Y Sbjct: 444 PQGAPPQAAPPQGVDNQAY 462 [55][TOP] >UniRef100_P09241 Rhodopsin n=1 Tax=Enteroctopus dofleini RepID=OPSD_ENTDO Length = 455 Score = 98.2 bits (243), Expect = 3e-19 Identities = 47/67 (70%), Positives = 49/67 (73%), Gaps = 2/67 (2%) Frame = +1 Query: 76 QPPVGTPPPQGYPPEGYGKEGYPPPG-YPPP-GYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 QPP PPPQGYPP+GY PP G YPPP GYPPQGYPPQGYPP GYPPQG PP + Sbjct: 388 QPP---PPPQGYPPQGY-----PPQGAYPPPQGYPPQGYPPQGYPPQGYPPQGAPPQVEA 439 Query: 250 AQGYPPQ 270 QG PPQ Sbjct: 440 PQGAPPQ 446 Score = 85.1 bits (209), Expect = 2e-15 Identities = 41/72 (56%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGT-PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 P PP Y Q PP G PPPQGYPP +GYPP GYPP GYPPQG PPQ P G Sbjct: 389 PPPPPQGYPPQGYPPQGAYPPPQGYPP-----QGYPPQGYPPQGYPPQGAPPQVEAPQGA 443 Query: 217 PPQGYPPPPYSA 252 PPQG Y A Sbjct: 444 PPQGVDNQAYQA 455 Score = 85.1 bits (209), Expect = 2e-15 Identities = 42/64 (65%), Positives = 44/64 (68%), Gaps = 5/64 (7%) Frame = +1 Query: 142 PPPGYPPPGYPPQGYPPQG-YPPP-GYPPQGYPPPPYSAQGYPPQYAPQYAQPP---PPH 306 PPP PP GYPPQGYPPQG YPPP GYPPQGYPP Y QGYPPQ AP + P PP Sbjct: 389 PPP--PPQGYPPQGYPPQGAYPPPQGYPPQGYPPQGYPPQGYPPQGAPPQVEAPQGAPPQ 446 Query: 307 HHNN 318 +N Sbjct: 447 GVDN 450 [56][TOP] >UniRef100_UPI00003BE83A hypothetical protein DEHA0G23474g n=1 Tax=Debaryomyces hansenii CBS767 RepID=UPI00003BE83A Length = 440 Score = 97.4 bits (241), Expect = 4e-19 Identities = 46/76 (60%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = +1 Query: 64 YNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 Y QQ PP G PP GY PP G + PP GYPP GYPPQGYPPQGY P GYPPQGY Sbjct: 10 YRQQAPPPG--PPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYA 67 Query: 235 PPPYSAQGYPPQYAPQ 282 P Y+ QGY Q Q Sbjct: 68 PQGYAPQGYQQQGGQQ 83 Score = 89.7 bits (221), Expect = 9e-17 Identities = 55/125 (44%), Positives = 57/125 (45%), Gaps = 28/125 (22%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGT----PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 P PP Y Q PP G PPPQGYPP+GY PP GYPP GY PQGYPPQGY P Sbjct: 16 PPGPPNGY--QYGPPPGAQGQYPPPQGYPPQGY-----PPQGYPPQGYAPQGYPPQGYAP 68 Query: 208 PGYPPQGYPPPPYSAQGYPPQ-----------YAPQYAQ-------------PPPPHHHN 315 GY PQGY QG Q YA Q AQ PPP + Sbjct: 69 QGYAPQGYQQQGGQQQGGQQQGGQQQGGQRQTYATQEAQNFGQGVGNPHPTGPPPSNPQG 128 Query: 316 NSNNS 330 NS Sbjct: 129 FGQNS 133 [57][TOP] >UniRef100_A9V0Y5 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V0Y5_MONBE Length = 117 Score = 97.4 bits (241), Expect = 4e-19 Identities = 50/114 (43%), Positives = 54/114 (47%), Gaps = 1/114 (0%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP Y G PPP G P + YP GYP GYP QGYP QGYP GYP QG Sbjct: 4 PPPGYPTTTSSGYGAPPPYGQPQYPQYPQ-YPQQGYPQQGYPQQGYPQQGYPQQGYPQQG 62 Query: 229 YPPPPYSAQGYPPQ-YAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLL 387 YP Y QGYP Q Y Q Q N+N S + CCA C C L+ Sbjct: 63 YPQQGYPQQGYPQQGYVQQNQQQTGRPQQQNNNGESFLAGMAACCAICCLCDLM 116 [58][TOP] >UniRef100_Q6BH13 Metacaspase-1 n=1 Tax=Debaryomyces hansenii RepID=MCA1_DEBHA Length = 440 Score = 97.4 bits (241), Expect = 4e-19 Identities = 46/76 (60%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = +1 Query: 64 YNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 Y QQ PP G PP GY PP G + PP GYPP GYPPQGYPPQGY P GYPPQGY Sbjct: 10 YRQQAPPPG--PPNGYQYGPPPGAQGQYPPPQGYPPQGYPPQGYPPQGYAPQGYPPQGYA 67 Query: 235 PPPYSAQGYPPQYAPQ 282 P Y+ QGY Q Q Sbjct: 68 PQGYAPQGYQQQGGQQ 83 Score = 89.7 bits (221), Expect = 9e-17 Identities = 55/125 (44%), Positives = 57/125 (45%), Gaps = 28/125 (22%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGT----PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 P PP Y Q PP G PPPQGYPP+GY PP GYPP GY PQGYPPQGY P Sbjct: 16 PPGPPNGY--QYGPPPGAQGQYPPPQGYPPQGY-----PPQGYPPQGYAPQGYPPQGYAP 68 Query: 208 PGYPPQGYPPPPYSAQGYPPQ-----------YAPQYAQ-------------PPPPHHHN 315 GY PQGY QG Q YA Q AQ PPP + Sbjct: 69 QGYAPQGYQQQGGQQQGGQQQGGQQQGGQRQTYATQEAQNFGQGVGNPHPTGPPPSNPQG 128 Query: 316 NSNNS 330 NS Sbjct: 129 FGQNS 133 [59][TOP] >UniRef100_B9RFX3 DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RFX3_RICCO Length = 92 Score = 97.1 bits (240), Expect = 6e-19 Identities = 46/88 (52%), Positives = 53/88 (60%), Gaps = 1/88 (1%) Frame = +1 Query: 139 YPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPP-YSAQGYPPQYAPQYAQPPPPHHHN 315 +PPPG+PPP YPP GYP PPP YPP PPPP Y YPP PPPP N Sbjct: 14 HPPPGHPPP-YPPPGYP----PPPPYPPPPPPPPPYYQDYFYPP-------PPPPPPQDN 61 Query: 316 NSNNSSSPGCLEGCCAALCCCCLLDACF 399 ++S L+GC AALCCCCL++ CF Sbjct: 62 RQDDSGCSSFLKGCLAALCCCCLMEECF 89 [60][TOP] >UniRef100_Q3BDP4 Rhodopsin (Fragment) n=1 Tax=Ommastrephes bartramii RepID=Q3BDP4_9MOLL Length = 296 Score = 97.1 bits (240), Expect = 6e-19 Identities = 46/75 (61%), Positives = 46/75 (61%) Frame = +1 Query: 73 QQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSA 252 QQ PPP PP GYPP GYPPQGYPPQGYPP GYPPQGYPPPP Sbjct: 235 QQQQAAYPPP-------------PPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPPP--- 278 Query: 253 QGYPPQYAPQYAQPP 297 QG PPQ AP A PP Sbjct: 279 QGPPPQGAPPAAAPP 293 Score = 94.4 bits (233), Expect = 4e-18 Identities = 42/68 (61%), Positives = 44/68 (64%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M QQQ PPPQGYPP+GY +GYPP GYPP GYPPQGYPP PP G PPQG P Sbjct: 231 MQKMQQQQAAYPPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPP---PPQGPPPQGAP 287 Query: 235 PPPYSAQG 258 P QG Sbjct: 288 PAAAPPQG 295 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/68 (55%), Positives = 40/68 (58%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q +P PP Y Q PP G PP QGYPP +GYPP GYPP PPQG PPQG P Sbjct: 237 QQAAYPPPPPQGYPPQGYPPQGYPP-QGYPP-----QGYPPQGYPP---PPQGPPPQGAP 287 Query: 205 PPGYPPQG 228 P PPQG Sbjct: 288 PAAAPPQG 295 [61][TOP] >UniRef100_A0JMY8 Plscr2 protein n=1 Tax=Xenopus laevis RepID=A0JMY8_XENLA Length = 354 Score = 96.3 bits (238), Expect = 1e-18 Identities = 50/94 (53%), Positives = 50/94 (53%), Gaps = 12/94 (12%) Frame = +1 Query: 49 PPMSYYNQQQPPV---GTPPPQ--------GYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P Y NQ P G PPPQ GYPP GY GYPP GY P GYPP GY P Sbjct: 11 PDPGYGNQGYPGADYPGYPPPQNPYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPA 70 Query: 196 GYPPPGYPPQGYPPPPYSA-QGYPPQYAPQYAQP 294 GYPP GY P GYPPP QGYPP P QP Sbjct: 71 GYPPAGYQPAGYPPPGGQVPQGYPP--GPYQGQP 102 Score = 94.7 bits (234), Expect = 3e-18 Identities = 49/84 (58%), Positives = 51/84 (60%), Gaps = 5/84 (5%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGY 201 G+P PP + Y Q P G PP P GYPP GY GYPP GY P GYPP GY P GY Sbjct: 27 GYP--PPQNPYGYQ--PAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPAGYPPAGYQPAGY 82 Query: 202 PPP-GYPPQGYPPPPYSAQGYPPQ 270 PPP G PQGYPP PY QG P Q Sbjct: 83 PPPGGQVPQGYPPGPY--QGQPGQ 104 Score = 83.6 bits (205), Expect = 6e-15 Identities = 39/75 (52%), Positives = 40/75 (53%), Gaps = 12/75 (16%) Frame = +1 Query: 112 PPEGYGKEGYPP---PGYPPP---------GYPPQGYPPQGYPPPGYPPQGYPPPPYSAQ 255 P GYG +GYP PGYPPP GYPP GY P GYPP GY P GYPP Y Sbjct: 11 PDPGYGNQGYPGADYPGYPPPQNPYGYQPAGYPPAGYQPTGYPPAGYQPAGYPPAGYQPA 70 Query: 256 GYPPQYAPQYAQPPP 300 GYPP PPP Sbjct: 71 GYPPAGYQPAGYPPP 85 [62][TOP] >UniRef100_A7QZB8 Chromosome chr7 scaffold_270, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QZB8_VITVI Length = 121 Score = 96.3 bits (238), Expect = 1e-18 Identities = 45/71 (63%), Positives = 48/71 (67%), Gaps = 2/71 (2%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGY-PPQGYPPQ-GYPPPGYPPQG 228 MSYY+QQQPPVG PPPQGYP EGY K+ YPPPGYPP Y PPQ YPPQ PPP G Sbjct: 1 MSYYSQQQPPVGVPPPQGYPVEGYPKDAYPPPGYPPQAYPPPQAYPPQYAQPPPKNETGG 60 Query: 229 YPPPPYSAQGY 261 + YS Y Sbjct: 61 FLEGWYSQNHY 71 [63][TOP] >UniRef100_Q6QE84 Rhodopsin (Fragment) n=1 Tax=Loligo forbesi RepID=Q6QE84_LOLFO Length = 305 Score = 95.9 bits (237), Expect = 1e-18 Identities = 49/81 (60%), Positives = 50/81 (61%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M QQQP PPQGYPP +GYPPP PPQGYPPQGYPP GYPPQGYP Sbjct: 240 MQAQQQQQPAY---PPQGYPP-----QGYPPP-------PPQGYPPQGYPPQGYPPQGYP 284 Query: 235 PPPYSAQGYPPQYAPQYAQPP 297 PPP QG PPQ P A PP Sbjct: 285 PPP---QGPPPQGPPPQAAPP 302 Score = 86.7 bits (213), Expect = 8e-16 Identities = 40/68 (58%), Positives = 43/68 (63%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q + P PP Y Q PP PPPQGYPP+GY +GYPP GYPP PPQG PPQG P Sbjct: 243 QQQQQPAYPPQGYPPQGYPP---PPPQGYPPQGYPPQGYPPQGYPP---PPQGPPPQGPP 296 Query: 205 PPGYPPQG 228 P PPQG Sbjct: 297 PQAAPPQG 304 Score = 77.8 bits (190), Expect = 4e-13 Identities = 34/50 (68%), Positives = 34/50 (68%), Gaps = 3/50 (6%) Frame = +1 Query: 163 PGYPPQGYPPQGYPPP---GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P YPPQGYPPQGYPPP GYPPQGYPP Y QGYPP Q PPP Sbjct: 248 PAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPPPQGPPPQGPPP 297 [64][TOP] >UniRef100_Q3BDP0 Rhodopsin (Fragment) n=1 Tax=Photololigo sp. JMS-2004 RepID=Q3BDP0_9MOLL Length = 305 Score = 95.9 bits (237), Expect = 1e-18 Identities = 49/81 (60%), Positives = 50/81 (61%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M QQQP PPQGYPP +GYPPP PPQGYPPQGYPP GYPPQGYP Sbjct: 240 MQAQQQQQPAY---PPQGYPP-----QGYPPP-------PPQGYPPQGYPPQGYPPQGYP 284 Query: 235 PPPYSAQGYPPQYAPQYAQPP 297 PPP QG PPQ P A PP Sbjct: 285 PPP---QGPPPQGPPPQAAPP 302 Score = 86.7 bits (213), Expect = 8e-16 Identities = 40/68 (58%), Positives = 43/68 (63%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q + P PP Y Q PP PPPQGYPP+GY +GYPP GYPP PPQG PPQG P Sbjct: 243 QQQQQPAYPPQGYPPQGYPP---PPPQGYPPQGYPPQGYPPQGYPP---PPQGPPPQGPP 296 Query: 205 PPGYPPQG 228 P PPQG Sbjct: 297 PQAAPPQG 304 Score = 77.8 bits (190), Expect = 4e-13 Identities = 34/50 (68%), Positives = 34/50 (68%), Gaps = 3/50 (6%) Frame = +1 Query: 163 PGYPPQGYPPQGYPPP---GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P YPPQGYPPQGYPPP GYPPQGYPP Y QGYPP Q PPP Sbjct: 248 PAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPPPQGPPPQGPPP 297 [65][TOP] >UniRef100_A2DBY2 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2DBY2_TRIVA Length = 383 Score = 95.9 bits (237), Expect = 1e-18 Identities = 46/85 (54%), Positives = 54/85 (63%), Gaps = 5/85 (5%) Frame = +1 Query: 40 PTTP---PMSYYNQQQPPVGTPPPQGYPPEGYGKEG-YPPPGYPPPG-YPPQGYPPQGYP 204 P TP P ++ QQ P PP GYPP+GY +G YPP GYPP G YPPQGYPPQG+P Sbjct: 127 PFTPFDGPANWTRQQPAPAPYPPQGGYPPQGYPPQGGYPPQGYPPQGAYPPQGYPPQGFP 186 Query: 205 PPGYPPQGYPPPPYSAQGYPPQYAP 279 P G+PPQG+P P +PP P Sbjct: 187 PQGFPPQGFPGGPCL---FPPDAKP 208 Score = 91.7 bits (226), Expect = 2e-17 Identities = 59/122 (48%), Positives = 62/122 (50%), Gaps = 30/122 (24%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPG-YPPQG-YPPQG------- 198 PP Y + PP G PPQGYPP+G YPPPG YPP G YPPQG YPPQG Sbjct: 266 PPPGYPPYRYPPQGPYPPQGYPPQG----AYPPPGQYPPQGAYPPQGQYPPQGQPHQGQQ 321 Query: 199 -----YPPPG-------YPPQGYPP----PPYSAQGYPPQYAPQYAQPPPPHHH----NN 318 YPP G YPPQG PP PP YPPQ P Q PPP+ NN Sbjct: 322 PPQGQYPPQGQQPPQGQYPPQGQPPQGQQPPQGQ--YPPQGYPLQGQQPPPNQQAPPPNN 379 Query: 319 SN 324 SN Sbjct: 380 SN 381 Score = 79.3 bits (194), Expect = 1e-13 Identities = 48/87 (55%), Positives = 49/87 (56%), Gaps = 9/87 (10%) Frame = +1 Query: 64 YNQQQPPVGTPPPQG-YPPEGYGKEGYPPPG-YPPPGYPPQG-YPPQG-YPPPG-YPPQG 228 + Q PP G YPP GY YPP G YPP GYPPQG YPP G YPP G YPPQG Sbjct: 249 FEQMLKAATVPPNWGQYPPPGYPPYRYPPQGPYPPQGYPPQGAYPPPGQYPPQGAYPPQG 308 Query: 229 -YPPPPYSAQGYPP---QYAPQYAQPP 297 YPP QG P QY PQ QPP Sbjct: 309 QYPPQGQPHQGQQPPQGQYPPQGQQPP 335 Score = 77.8 bits (190), Expect = 4e-13 Identities = 41/67 (61%), Positives = 43/67 (64%), Gaps = 5/67 (7%) Frame = +1 Query: 115 PEGYGKEGYPPPGYPPPGYPPQG-YPPQGYPPPG-YPPQGYPPP--PYSAQG-YPPQYAP 279 P +G+ YPPPGYPP YPPQG YPPQGYPP G YPP G PP Y QG YPPQ P Sbjct: 259 PPNWGQ--YPPPGYPPYRYPPQGPYPPQGYPPQGAYPPPGQYPPQGAYPPQGQYPPQGQP 316 Query: 280 QYAQPPP 300 Q PP Sbjct: 317 HQGQQPP 323 Score = 60.8 bits (146), Expect = 4e-08 Identities = 39/79 (49%), Positives = 41/79 (51%), Gaps = 10/79 (12%) Frame = +1 Query: 49 PPMSYYNQ-QQPPVGTPPPQG-------YPPEGYGKEGYPPPGYPPP--GYPPQGYPPQG 198 PP +Q QQPP G PPQG YPP +G PP G PP YPPQGYP QG Sbjct: 311 PPQGQPHQGQQPPQGQYPPQGQQPPQGQYPP-----QGQPPQGQQPPQGQYPPQGYPLQG 365 Query: 199 YPPPGYPPQGYPPPPYSAQ 255 PP P Q PPP S Q Sbjct: 366 QQPP--PNQQAPPPNNSNQ 382 [66][TOP] >UniRef100_Q17094 Rhodopsin (Fragment) n=1 Tax=Alloteuthis subulata RepID=OPSD_LOLSU Length = 439 Score = 95.9 bits (237), Expect = 1e-18 Identities = 49/81 (60%), Positives = 50/81 (61%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M QQQP PPQGYPP +GYPPP PPQGYPPQGYPP GYPPQGYP Sbjct: 373 MQAQQQQQPAY---PPQGYPP-----QGYPPP-------PPQGYPPQGYPPQGYPPQGYP 417 Query: 235 PPPYSAQGYPPQYAPQYAQPP 297 PPP QG PPQ P A PP Sbjct: 418 PPP---QGPPPQGPPPQAAPP 435 Score = 86.7 bits (213), Expect = 8e-16 Identities = 40/68 (58%), Positives = 43/68 (63%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q + P PP Y Q PP PPPQGYPP+GY +GYPP GYPP PPQG PPQG P Sbjct: 376 QQQQQPAYPPQGYPPQGYPP---PPPQGYPPQGYPPQGYPPQGYPP---PPQGPPPQGPP 429 Query: 205 PPGYPPQG 228 P PPQG Sbjct: 430 PQAAPPQG 437 Score = 77.8 bits (190), Expect = 4e-13 Identities = 34/50 (68%), Positives = 34/50 (68%), Gaps = 3/50 (6%) Frame = +1 Query: 163 PGYPPQGYPPQGYPPP---GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P YPPQGYPPQGYPPP GYPPQGYPP Y QGYPP Q PPP Sbjct: 381 PAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPPPQGPPPQGPPP 430 [67][TOP] >UniRef100_P24603 Rhodopsin n=1 Tax=Loligo forbesi RepID=OPSD_LOLFO Length = 452 Score = 95.9 bits (237), Expect = 1e-18 Identities = 49/81 (60%), Positives = 50/81 (61%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M QQQP PPQGYPP +GYPPP PPQGYPPQGYPP GYPPQGYP Sbjct: 380 MQAQQQQQPAY---PPQGYPP-----QGYPPP-------PPQGYPPQGYPPQGYPPQGYP 424 Query: 235 PPPYSAQGYPPQYAPQYAQPP 297 PPP QG PPQ P A PP Sbjct: 425 PPP---QGPPPQGPPPQAAPP 442 Score = 88.6 bits (218), Expect = 2e-16 Identities = 42/76 (55%), Positives = 45/76 (59%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q + P PP Y Q PP PPPQGYPP+GY +GYPP GYPPP PQG PPQG P Sbjct: 383 QQQQQPAYPPQGYPPQGYPP---PPPQGYPPQGYPPQGYPPQGYPPP---PQGPPPQGPP 436 Query: 205 PPGYPPQGYPPPPYSA 252 P PPQG Y A Sbjct: 437 PQAAPPQGVDNQAYQA 452 Score = 77.8 bits (190), Expect = 4e-13 Identities = 34/50 (68%), Positives = 34/50 (68%), Gaps = 3/50 (6%) Frame = +1 Query: 163 PGYPPQGYPPQGYPPP---GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P YPPQGYPPQGYPPP GYPPQGYPP Y QGYPP Q PPP Sbjct: 388 PAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPPPQGPPPQGPPP 437 [68][TOP] >UniRef100_B9I6F5 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I6F5_POPTR Length = 192 Score = 95.5 bits (236), Expect = 2e-18 Identities = 53/107 (49%), Positives = 56/107 (52%), Gaps = 5/107 (4%) Frame = +1 Query: 61 YYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-GYPPPGYPPQ-GYPPQGYPPPG--YPPQG 228 Y PP PP GYP +GY GYPPP GYPP GYPP GYPP GYPPPG PP G Sbjct: 24 YAGGHYPPSAPYPPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPPGG 83 Query: 229 YPPPPYSAQGYPPQYA-PQYAQPPPPHHHNNSNNSSSPGCLEGCCAA 366 YPPP GYPP A P P P H + + L G AA Sbjct: 84 YPPP----GGYPPPGAYPPAGYPGPSASHYSGHGPGMGTMLAGGAAA 126 Score = 93.2 bits (230), Expect = 8e-18 Identities = 48/78 (61%), Positives = 48/78 (61%), Gaps = 8/78 (10%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKE-GYPPPGYPPP-GYPPQG--YPPQGYPPPG- 213 PP Y Q PP G PPP GYPP GY GYPP GYPPP GYPP G PP GYPPPG Sbjct: 36 PPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPPGGYPPPGGYPPPGA 95 Query: 214 YPPQGYPPPP---YSAQG 258 YPP GYP P YS G Sbjct: 96 YPPAGYPGPSASHYSGHG 113 Score = 87.8 bits (216), Expect = 3e-16 Identities = 51/93 (54%), Positives = 53/93 (56%), Gaps = 9/93 (9%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTP----PPQGYPPEGYGKEGYPPPGYPPP-GYPPQGYPPQ-GYPPP 210 PP + Y PP G P PP GYPP G GYPP GYPPP GYPP GYPP GYPPP Sbjct: 30 PPSAPY----PPHGYPQQGYPPAGYPPPG----GYPPSGYPPPGGYPPAGYPPPGGYPPP 81 Query: 211 G--YPPQGYPPP-PYSAQGYPPQYAPQYAQPPP 300 G PP GYPPP Y GYP A Y+ P Sbjct: 82 GGYPPPGGYPPPGAYPPAGYPGPSASHYSGHGP 114 Score = 81.3 bits (199), Expect = 3e-14 Identities = 40/65 (61%), Positives = 40/65 (61%), Gaps = 5/65 (7%) Frame = +1 Query: 121 GYGKEGYPPPG-YPPPGYPPQGYPPQGYPPP-GYPPQGYPPP-PYSAQGYPPQ--YAPQY 285 GY YPP YPP GYP QGYPP GYPPP GYPP GYPPP Y GYPP Y P Sbjct: 23 GYAGGHYPPSAPYPPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPPG 82 Query: 286 AQPPP 300 PPP Sbjct: 83 GYPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 33/64 (51%), Positives = 34/64 (53%), Gaps = 5/64 (7%) Frame = -1 Query: 257 PCAEYGGGGYPCGG*PGGGY-PCGGYPCGGY-PGGGYPGGGYP---SFPYPSGG*PCGGG 93 P A Y GYP G P GY P GGYP GY P GGYP GYP +P P G P GG Sbjct: 31 PSAPYPPHGYPQQGYPPAGYPPPGGYPPSGYPPPGGYPPAGYPPPGGYPPPGGYPPPGGY 90 Query: 92 VPTG 81 P G Sbjct: 91 PPPG 94 [69][TOP] >UniRef100_UPI00017928E3 PREDICTED: hypothetical protein n=1 Tax=Acyrthosiphon pisum RepID=UPI00017928E3 Length = 259 Score = 95.1 bits (235), Expect = 2e-18 Identities = 44/90 (48%), Positives = 46/90 (51%), Gaps = 3/90 (3%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P+ P S Q P G PP YP Y + YP P YPPP YPP YP YPPP YP Sbjct: 135 PSGQPPSSVWIQVPANGYYPPPSYPYPSYPPQQYPQPSYPPPSYPPPSYPQPSYPPPSYP 194 Query: 220 PQGYPPPPYSAQGYPPQYAPQ---YAQPPP 300 P YPPP Y YPP PQ Y QP P Sbjct: 195 PPSYPPPSYPPPSYPPPAYPQPSPYPQPSP 224 Score = 95.1 bits (235), Expect = 2e-18 Identities = 42/84 (50%), Positives = 44/84 (52%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 P YY P + PPQ YP Y YPPP YP P YPP YPP YPPP YPP Sbjct: 148 PANGYYPPPSYPYPSYPPQQYPQPSYPPPSYPPPSYPQPSYPPPSYPPPSYPPPSYPPPS 207 Query: 229 YPPPPYSAQGYPPQYAPQYAQPPP 300 YPPP Y PQ +P Y QP P Sbjct: 208 YPPPAYPQPSPYPQPSP-YPQPSP 230 Score = 93.2 bits (230), Expect = 8e-18 Identities = 50/104 (48%), Positives = 54/104 (51%), Gaps = 5/104 (4%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P+ P SY QQ P PPP YPP Y + YPPP YPPP YPP YPP YPPP YP Sbjct: 156 PSYPYPSYPPQQYPQPSYPPP-SYPPPSYPQPSYPPPSYPPPSYPPPSYPPPSYPPPAYP 214 Query: 220 -PQGYP-PPPY-SAQGYP--PQYAPQYAQPPPPHHHNNSNNSSS 336 P YP P PY YP P Y PQ A P S ++ S Sbjct: 215 QPSPYPQPSPYPQPSPYPQQPLYPPQPAPSPVSEEQELSTSAPS 258 Score = 90.5 bits (223), Expect = 5e-17 Identities = 46/105 (43%), Positives = 50/105 (47%), Gaps = 8/105 (7%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP SY PP P P YPP Y YP P YPPP YPP YPP YPPP YPP Sbjct: 154 PPPSYPYPSYPPQQYPQPS-YPPPSYPPPSYPQPSYPPPSYPPPSYPPPSYPPPSYPPPA 212 Query: 229 YP-PPPYSAQGYPPQYAPQYAQP-------PPPHHHNNSNNSSSP 339 YP P PY PQ +P QP P P ++S+P Sbjct: 213 YPQPSPYPQPSPYPQPSPYPQQPLYPPQPAPSPVSEEQELSTSAP 257 Score = 87.0 bits (214), Expect = 6e-16 Identities = 44/85 (51%), Positives = 46/85 (54%), Gaps = 4/85 (4%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG- 213 +P+ PP Y PP PPP YP Y YPPP YPPP YPP YPP YP P Sbjct: 160 YPSYPPQQYPQPSYPPPSYPPPS-YPQPSYPPPSYPPPSYPPPSYPPPSYPPPAYPQPSP 218 Query: 214 YP-PQGYP-PPPYSAQG-YPPQYAP 279 YP P YP P PY Q YPPQ AP Sbjct: 219 YPQPSPYPQPSPYPQQPLYPPQPAP 243 Score = 85.1 bits (209), Expect = 2e-15 Identities = 39/84 (46%), Positives = 42/84 (50%), Gaps = 5/84 (5%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGY-----GKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 Q PP G+ P G PP YPPP YP P YPPQ YP YPPP YPP YP Sbjct: 126 QVSPPAGSQP-SGQPPSSVWIQVPANGYYPPPSYPYPSYPPQQYPQPSYPPPSYPPPSYP 184 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPH 306 P Y YPP P + PPP + Sbjct: 185 QPSYPPPSYPPPSYPPPSYPPPSY 208 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/70 (42%), Positives = 34/70 (48%), Gaps = 10/70 (14%) Frame = +1 Query: 127 GKEGYPPPGYPPPGYPPQG----------YPPQGYPPPGYPPQGYPPPPYSAQGYPPQYA 276 G++ PP G P G PP YPP YP P YPPQ YP P Y YPP Sbjct: 124 GQQVSPPAGSQPSGQPPSSVWIQVPANGYYPPPSYPYPSYPPQQYPQPSYPPPSYPPPSY 183 Query: 277 PQYAQPPPPH 306 PQ + PPP + Sbjct: 184 PQPSYPPPSY 193 [70][TOP] >UniRef100_A0BKH8 Chromosome undetermined scaffold_112, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BKH8_PARTE Length = 271 Score = 95.1 bits (235), Expect = 2e-18 Identities = 56/99 (56%), Positives = 58/99 (58%), Gaps = 11/99 (11%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP--PGYPP--PGYPPQGYPPQ-GYP 204 P PP Y QQP G P GYP +GY + YPP PGYPP PGYPPQ YP Q GYP Sbjct: 154 PNYPPQQPYPPQQP--GYPVQPGYPQQGYPAQPYPPQQPGYPPQQPGYPPQPYPQQPGYP 211 Query: 205 P--PGYPPQGYPPPP-YSAQ-GYPPQ--YAPQYAQPPPP 303 P PGYP Q YPP Y Q GYPPQ Y PQ PP P Sbjct: 212 PQQPGYPAQPYPPQQGYPPQPGYPPQPGYPPQPGYPPQP 250 Score = 93.6 bits (231), Expect = 6e-18 Identities = 57/109 (52%), Positives = 60/109 (55%), Gaps = 21/109 (19%) Frame = +1 Query: 40 PTTPPMSYYNQQQ---PPVGTPPPQGYPPE--------GYGKEGYPPPGYPP--PGYPPQ 180 P PP Y QQ P PP Q YPP+ GY ++GYP YPP PGYPPQ Sbjct: 136 PYYPPNQPYPQQPIYPPQPNYPPQQPYPPQQPGYPVQPGYPQQGYPAQPYPPQQPGYPPQ 195 Query: 181 --GYPPQGYP-PPGYPPQ--GYPPPPY-SAQGYPPQ--YAPQYAQPPPP 303 GYPPQ YP PGYPPQ GYP PY QGYPPQ Y PQ PP P Sbjct: 196 QPGYPPQPYPQQPGYPPQQPGYPAQPYPPQQGYPPQPGYPPQPGYPPQP 244 Score = 87.0 bits (214), Expect = 6e-16 Identities = 58/106 (54%), Positives = 62/106 (58%), Gaps = 17/106 (16%) Frame = +1 Query: 25 QHRGHPTTP-------PMSYYNQQQPPVGTPPPQ-GYPPEGYGKE-GYPP--PGYPPPGY 171 Q G+P P P Y QQP G PP Q GYPP+ Y ++ GYPP PGYP Y Sbjct: 165 QQPGYPVQPGYPQQGYPAQPYPPQQP--GYPPQQPGYPPQPYPQQPGYPPQQPGYPAQPY 222 Query: 172 PP-QGYPPQ-GYPP-PGYPPQ-GYPPPPYSAQGYPPQYA--PQYAQ 291 PP QGYPPQ GYPP PGYPPQ GYPP P GYPPQ P Y Q Sbjct: 223 PPQQGYPPQPGYPPQPGYPPQPGYPPQP----GYPPQQPGYPGYPQ 264 Score = 76.3 bits (186), Expect = 1e-12 Identities = 47/84 (55%), Positives = 49/84 (58%), Gaps = 10/84 (11%) Frame = +1 Query: 40 PTTPPMSYYNQQQP---PVGTPPPQGYPPE--GYGKEGYPPP-GYPP-PGYPPQ-GYPPQ 195 P P Y QQP P P GYPP+ GY + YPP GYPP PGYPPQ GYPPQ Sbjct: 184 PYPPQQPGYPPQQPGYPPQPYPQQPGYPPQQPGYPAQPYPPQQGYPPQPGYPPQPGYPPQ 243 Query: 196 -GYPP-PGYPPQGYPPPPYSAQGY 261 GYPP PGYPPQ P Y QGY Sbjct: 244 PGYPPQPGYPPQQPGYPGYPQQGY 267 Score = 74.7 bits (182), Expect = 3e-12 Identities = 47/78 (60%), Positives = 50/78 (64%), Gaps = 11/78 (14%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQ-GYPPEGYG-KEGYPP-PGYPP-PGYPPQ-GYPPQ-GY 201 P PP Y QQP G PP Q GYP + Y ++GYPP PGYPP PGYPPQ GYPPQ GY Sbjct: 197 PGYPPQPY--PQQP--GYPPQQPGYPAQPYPPQQGYPPQPGYPPQPGYPPQPGYPPQPGY 252 Query: 202 PP-----PGYPPQGYPPP 240 PP PGYP QGY P Sbjct: 253 PPQQPGYPGYPQQGYQKP 270 Score = 68.2 bits (165), Expect = 3e-10 Identities = 50/131 (38%), Positives = 53/131 (40%), Gaps = 43/131 (32%) Frame = +1 Query: 79 PPVGTPPP--QGYPPEGYGKEGYPPPG--------YPP--------------------PG 168 P G PP GY ++ Y PP YPP PG Sbjct: 121 PDGGVQPPIMPGY------QQPYYPPNQPYPQQPIYPPQPNYPPQQPYPPQQPGYPVQPG 174 Query: 169 YPPQGYPPQGYPP--PGYPPQ--GYPPPPYSAQ-GYPPQ--------YAPQYAQPPPPHH 309 YP QGYP Q YPP PGYPPQ GYPP PY Q GYPPQ Y PQ PP P + Sbjct: 175 YPQQGYPAQPYPPQQPGYPPQQPGYPPQPYPQQPGYPPQQPGYPAQPYPPQQGYPPQPGY 234 Query: 310 HNNSNNSSSPG 342 PG Sbjct: 235 PPQPGYPPQPG 245 [71][TOP] >UniRef100_C3XUY7 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3XUY7_BRAFL Length = 1576 Score = 94.7 bits (234), Expect = 3e-18 Identities = 56/97 (57%), Positives = 58/97 (59%), Gaps = 10/97 (10%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP--PGYPP--PGYPPQ-GYPPQ--G 198 P PP Y QQP G PP GYPP+ + GYPP PGYPP PGYPPQ GYPPQ Sbjct: 1486 PYPPPQPGYPPQQP--GYPPQPGYPPQ---QPGYPPQQPGYPPQQPGYPPQPGYPPQQPA 1540 Query: 199 YPP--PGYPPQGYP-PPPYSAQGYPPQYAPQYAQPPP 300 YPP PGYPPQG P PPPY PP P Y PPP Sbjct: 1541 YPPQQPGYPPQGEPAPPPYHPSAPPPPQDPAY--PPP 1575 Score = 89.0 bits (219), Expect = 2e-16 Identities = 57/102 (55%), Positives = 61/102 (59%), Gaps = 14/102 (13%) Frame = +1 Query: 46 TPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP--PGYPP-PGYPPQ--GYPPQ--GYP 204 +P S Y +P PP Q YPP + GYPP PGYPP PGYPPQ GYPPQ GYP Sbjct: 1466 SPQPSPYPGGKPDQPYPPDQPYPPP---QPGYPPQQPGYPPQPGYPPQQPGYPPQQPGYP 1522 Query: 205 P--PGYPPQ-GYPP--PPYSAQ--GYPPQYAPQYAQPPPPHH 309 P PGYPPQ GYPP P Y Q GYPPQ P PPP+H Sbjct: 1523 PQQPGYPPQPGYPPQQPAYPPQQPGYPPQGEP----APPPYH 1560 [72][TOP] >UniRef100_B4YS99 Rhodopsin (Fragment) n=1 Tax=Afrololigo mercatoris RepID=B4YS99_9MOLL Length = 303 Score = 94.7 bits (234), Expect = 3e-18 Identities = 47/76 (61%), Positives = 48/76 (63%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 QQQ PPPQGYPP+GY PPP PPQGYPPQGYPP GYPPQGYPP Sbjct: 243 QQQQQPAYPPPQGYPPQGY----------PPP--PPQGYPPQGYPPQGYPPQGYPP---- 286 Query: 250 AQGYPPQYAPQYAQPP 297 AQG PPQ P A PP Sbjct: 287 AQGPPPQGPPPQAAPP 302 Score = 79.0 bits (193), Expect = 2e-13 Identities = 35/52 (67%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +1 Query: 148 PGYPPP-GYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 P YPPP GYPPQGYPP PP GYPPQGYPP Y QGYPP P PPP Sbjct: 248 PAYPPPQGYPPQGYPPP--PPQGYPPQGYPPQGYPPQGYPPAQGPPPQGPPP 297 Score = 60.8 bits (146), Expect = 4e-08 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP-QGYPPQGYPP 207 +G+P PPQGYPP+G YPP GYPP GYPP QG PPQG PP Sbjct: 259 QGYPPP----------------PPQGYPPQG-----YPPQGYPPQGYPPAQGPPPQGPPP 297 Query: 208 PGYPPQ 225 PPQ Sbjct: 298 QAAPPQ 303 [73][TOP] >UniRef100_UPI000186AAB5 hypothetical protein BRAFLDRAFT_132198 n=1 Tax=Branchiostoma floridae RepID=UPI000186AAB5 Length = 1133 Score = 94.4 bits (233), Expect = 4e-18 Identities = 56/98 (57%), Positives = 58/98 (59%), Gaps = 11/98 (11%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP--PGYPP--PGYPPQ--GYPPQ-- 195 P PP Y QQP G PP GYPP+ + GYPP PGYPP PGYPPQ GYPPQ Sbjct: 1042 PYPPPQPGYPPQQP--GYPPQPGYPPQ---QPGYPPQQPGYPPQQPGYPPQQPGYPPQQP 1096 Query: 196 GYPP--PGYPPQGYP-PPPYSAQGYPPQYAPQYAQPPP 300 YPP PGYPPQG P PPPY PP P Y PPP Sbjct: 1097 AYPPQQPGYPPQGEPAPPPYHPSAPPPPQDPAY--PPP 1132 Score = 90.1 bits (222), Expect = 7e-17 Identities = 58/108 (53%), Positives = 61/108 (56%), Gaps = 18/108 (16%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP--GYPP--PGYPPQ-GYPPQ--G 198 P PP Q P G P Q YPP+ + YPPP GYPP PGYPPQ GYPPQ G Sbjct: 1014 PQQPPPQPSPQPSPYPGGKPDQPYPPD----QPYPPPQPGYPPQQPGYPPQPGYPPQQPG 1069 Query: 199 YPP--PGYPPQ--GYPP--PPYSAQ--GYPPQ---YAPQYAQPPPPHH 309 YPP PGYPPQ GYPP P Y Q YPPQ Y PQ PPP+H Sbjct: 1070 YPPQQPGYPPQQPGYPPQQPGYPPQQPAYPPQQPGYPPQGEPAPPPYH 1117 Score = 71.2 bits (173), Expect = 3e-11 Identities = 50/99 (50%), Positives = 52/99 (52%), Gaps = 10/99 (10%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPP--GYPPQ--GYPPQG 198 G T PM QQ PP +P P YP G + YPP YPPP GYPPQ GYPPQ Sbjct: 1005 GQTVTIPME--PQQPPPQPSPQPSPYPG-GKPDQPYPPDQPYPPPQPGYPPQQPGYPPQ- 1060 Query: 199 YPPPGYPPQ--GYPPPPYSAQGYPPQ---YAPQYAQPPP 300 PGYPPQ GYPP GYPPQ Y PQ PP Sbjct: 1061 ---PGYPPQQPGYPP---QQPGYPPQQPGYPPQQPGYPP 1093 [74][TOP] >UniRef100_Q0D313 Rhodopsin (Fragment) n=1 Tax=Illex coindetii RepID=Q0D313_9MOLL Length = 286 Score = 94.4 bits (233), Expect = 4e-18 Identities = 44/68 (64%), Positives = 44/68 (64%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQY 273 PPPQGYPP PP GYPPQGYPPQGYPP GYPPQGYPPP QG PPQ Sbjct: 233 PPPQGYPP-------------PPQGYPPQGYPPQGYPPQGYPPQGYPPP----QGAPPQG 275 Query: 274 APQYAQPP 297 AP A PP Sbjct: 276 APPAAAPP 283 Score = 87.4 bits (215), Expect = 4e-16 Identities = 39/57 (68%), Positives = 41/57 (71%), Gaps = 2/57 (3%) Frame = +1 Query: 64 YNQQQPPVG-TPPPQGYPPEGYGKEGYPPPGYPPPGY-PPQGYPPQGYPPPGYPPQG 228 Y Q PP G PPPQGYPP+GY +GYPP GYPP GY PPQG PPQG PP PPQG Sbjct: 229 YPQPPPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQGYPPPQGAPPQGAPPAAAPPQG 285 Score = 74.7 bits (182), Expect = 3e-12 Identities = 36/54 (66%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +1 Query: 139 YPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGY-PPQYAPQYAQPP 297 YP P PP GYPP PPQGYPP GYPPQGYPP Y QGY PPQ AP PP Sbjct: 229 YPQPP-PPQGYPP---PPQGYPPQGYPPQGYPPQGYPPQGYPPPQGAPPQGAPP 278 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = +1 Query: 175 PQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 PQ PPQGYPPP PQGYPP Y QGYPPQ P PPP Sbjct: 230 PQPPPPQGYPPP---PQGYPPQGYPPQGYPPQGYPPQGYPPP 268 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/64 (45%), Positives = 32/64 (50%), Gaps = 11/64 (17%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP-----------GY 171 Q +P PP Y PP PPQGYPP+GY +GYPP GYPPP Sbjct: 225 QQAAYPQPPPPQGY---PPPPQGYPPQGYPPQGYPPQGYPPQGYPPPQGAPPQGAPPAAA 281 Query: 172 PPQG 183 PPQG Sbjct: 282 PPQG 285 [75][TOP] >UniRef100_B4YS71 Rhodopsin (Fragment) n=1 Tax=Alloteuthis africana RepID=B4YS71_9MOLL Length = 303 Score = 94.4 bits (233), Expect = 4e-18 Identities = 48/77 (62%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP-GYPPQGYPPPPY 246 QQQ PPPQGYPP+GY PPP PPQGYPPQGYPPP GYPPQGYPPP Sbjct: 243 QQQQQPAYPPPQGYPPQGY----------PPP--PPQGYPPQGYPPPQGYPPQGYPPP-- 288 Query: 247 SAQGYPPQYAPQYAQPP 297 QG PPQ P A PP Sbjct: 289 --QGPPPQGPPPQAAPP 303 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/59 (50%), Positives = 33/59 (55%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 +G+P PP Y PP G PPPQGYPP+GY PP G PPQG PPQ PP Sbjct: 259 QGYPPPPPQGY-----PPQGYPPPQGYPPQGYP---------PPQGPPPQGPPPQAAPP 303 [76][TOP] >UniRef100_C6T3K1 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T3K1_SOYBN Length = 183 Score = 94.0 bits (232), Expect = 5e-18 Identities = 51/115 (44%), Positives = 57/115 (49%), Gaps = 2/115 (1%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG-YPPQGYPPQGYP 204 H G+P+ PP + PP G PPP GYPP Y PPP YPPPG YP GY P YP Sbjct: 20 HLGYPSAPPYPPPHGY-PPSGYPPPGGYPPTAY-----PPPAYPPPGVYPHSGYYPSEYP 73 Query: 205 PPGYPPQGYPPPPYSAQGY-PPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAA 366 P PP GYPP Y GY PP Y + PP + + G L G AA Sbjct: 74 PAYPPPGGYPPTTYPHSGYHPPAYPAPHGYPPAAPPYPAGRGAGMGGLLAGGVAA 128 [77][TOP] >UniRef100_Q6QE87 Rhodopsin (Fragment) n=1 Tax=Idiosepius notoides RepID=Q6QE87_9MOLL Length = 316 Score = 94.0 bits (232), Expect = 5e-18 Identities = 52/87 (59%), Positives = 54/87 (62%), Gaps = 6/87 (6%) Frame = +1 Query: 55 MSYYNQQQ---PPVGTPPPQG-YPPEGYGKEGYPPPGYPPPGYPPQGYPPQ--GYPPPGY 216 M QQQ PP G PPQG YPP+GY PP GYPPP P GYPP GYPP GY Sbjct: 237 MQKMQQQQAAYPPQGAYPPQGAYPPQGYPP---PPAGYPPP---PAGYPPPQGGYPPQGY 290 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PPQGYPPP QG PPQ AP A+PP Sbjct: 291 PPQGYPPP----QGAPPQGAPPAAEPP 313 Score = 79.3 bits (194), Expect = 1e-13 Identities = 41/70 (58%), Positives = 41/70 (58%), Gaps = 7/70 (10%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYG----KEGYPPP--GYPPPGYPPQGY-PPQGYPP 207 PP Y PP G PPQGYPP G GYPPP GYPP GYPPQGY PPQG PP Sbjct: 248 PPQGAY----PPQGAYPPQGYPPPPAGYPPPPAGYPPPQGGYPPQGYPPQGYPPPQGAPP 303 Query: 208 PGYPPQGYPP 237 G PP PP Sbjct: 304 QGAPPAAEPP 313 Score = 67.4 bits (163), Expect = 5e-10 Identities = 35/62 (56%), Positives = 36/62 (58%), Gaps = 7/62 (11%) Frame = +1 Query: 49 PPMSYYNQQ---QPPVG-TPPPQGYPPE--GYGKEGYPPPGYPPP-GYPPQGYPPQGYPP 207 PP Y Q PP G PPP GYPP GY +GYPP GYPPP G PPQG PP PP Sbjct: 254 PPQGAYPPQGYPPPPAGYPPPPAGYPPPQGGYPPQGYPPQGYPPPQGAPPQGAPPAAEPP 313 Query: 208 PG 213 G Sbjct: 314 QG 315 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQG-YPPEGYGKEGYPPP-GYPPPGYPPQGYPPQG 198 +G+P PP Y PP G PPPQG YPP+GY +GYPPP G PP G PP PPQG Sbjct: 262 QGYPP-PPAGY---PPPPAGYPPPQGGYPPQGYPPQGYPPPQGAPPQGAPPAAEPPQG 315 [78][TOP] >UniRef100_A2ED24 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2ED24_TRIVA Length = 232 Score = 94.0 bits (232), Expect = 5e-18 Identities = 49/85 (57%), Positives = 52/85 (61%), Gaps = 5/85 (5%) Frame = +1 Query: 67 NQQQPPVGTPPPQGYPPEG-YGKEGYPPPGYPPPG-YPPQGYPPQ-GYPPPG-YPPQGYP 234 N P G PPQGYPP+G Y +GYP YPP YPPQGYPPQ YPP YPPQGYP Sbjct: 129 NNTGPAPGPYPPQGYPPQGPYPPQGYPQQPYPPQQPYPPQGYPPQQSYPPQQPYPPQGYP 188 Query: 235 PPPYSAQ-GYPPQYAPQYAQPPPPH 306 P PY Q YPPQ Q PP P+ Sbjct: 189 PQPYPPQPAYPPQSNSQSGYPPMPY 213 Score = 93.2 bits (230), Expect = 8e-18 Identities = 50/87 (57%), Positives = 53/87 (60%), Gaps = 5/87 (5%) Frame = +1 Query: 52 PMSYYNQQQPPVGTPPPQGYPPEGYG-KEGYPPPGYPPP-GYPPQG-YPPQGYPPPGYPP 222 P Y Q PP G PPQGYP + Y ++ YPP GYPP YPPQ YPPQGYPP YPP Sbjct: 135 PGPYPPQGYPPQGPYPPQGYPQQPYPPQQPYPPQGYPPQQSYPPQQPYPPQGYPPQPYPP 194 Query: 223 Q-GYPPPPYSAQGYPPQ-YAPQYAQPP 297 Q YPP S GYPP Y PQ QPP Sbjct: 195 QPAYPPQSNSQSGYPPMPYPPQPNQPP 221 Score = 80.9 bits (198), Expect = 4e-14 Identities = 44/77 (57%), Positives = 46/77 (59%), Gaps = 10/77 (12%) Frame = +1 Query: 139 YPPPGYPPPG-YPPQGYPPQGYPP-PGYPPQGYPP-------PPYSAQGYPPQ-YAPQYA 288 YPP GYPP G YPPQGYP Q YPP YPPQGYPP PY QGYPPQ Y PQ A Sbjct: 138 YPPQGYPPQGPYPPQGYPQQPYPPQQPYPPQGYPPQQSYPPQQPYPPQGYPPQPYPPQPA 197 Query: 289 QPPPPHHHNNSNNSSSP 339 PP +NS + P Sbjct: 198 YPP----QSNSQSGYPP 210 Score = 75.1 bits (183), Expect = 2e-12 Identities = 38/72 (52%), Positives = 41/72 (56%), Gaps = 8/72 (11%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGY--GKEGYPPPGYPPPGYPPQ-GYPPQ-----GYP 204 PP Y Q PP PPQGYPP+ ++ YPP GYPP YPPQ YPPQ GYP Sbjct: 150 PPQGYPQQPYPPQQPYPPQGYPPQQSYPPQQPYPPQGYPPQPYPPQPAYPPQSNSQSGYP 209 Query: 205 PPGYPPQGYPPP 240 P YPPQ PP Sbjct: 210 PMPYPPQPNQPP 221 [79][TOP] >UniRef100_A9GNQ7 Putative uncharacterized protein n=1 Tax=Sorangium cellulosum 'So ce 56' RepID=A9GNQ7_SORC5 Length = 367 Score = 93.6 bits (231), Expect = 6e-18 Identities = 50/98 (51%), Positives = 55/98 (56%), Gaps = 5/98 (5%) Frame = +1 Query: 25 QHRGHPTT--PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP-GYPPQGYPPQ 195 Q +G+P P Y QQQ G P QGYP +GY ++GYP GYP GYP QGYP Q Sbjct: 102 QQQGYPQQGYPQQQGYPQQQ---GYPQQQGYPQQGYPQQGYPQQGYPQQQGYPQQGYPQQ 158 Query: 196 GYPPPGYPPQGYPPPPYSAQ--GYPPQYAPQYAQPPPP 303 GYP GYP QGYP Y Q GY YA PPPP Sbjct: 159 GYPQQGYPQQGYPQQGYPQQPPGYGQGYALPAGPPPPP 196 Score = 92.0 bits (227), Expect = 2e-17 Identities = 53/104 (50%), Positives = 58/104 (55%), Gaps = 11/104 (10%) Frame = +1 Query: 25 QHRGHPTT--PPMSYYNQQQPPV--GTPPPQGYPPE-GYGKEGYPPPGYPPPGYPPQ-GY 186 Q +G+P P Y QQ P G P QGYP + GY ++GYP GYP GYP Q GY Sbjct: 91 QQQGYPQQGYPQQQGYPQQGYPQQQGYPQQQGYPQQQGYPQQGYPQQGYPQQGYPQQQGY 150 Query: 187 PPQGYPPPGYPPQGYPPPPYSAQGY---PPQYAPQYAQP--PPP 303 P QGYP GYP QGYP Y QGY PP Y YA P PPP Sbjct: 151 PQQGYPQQGYPQQGYPQQGYPQQGYPQQPPGYGQGYALPAGPPP 194 Score = 81.3 bits (199), Expect = 3e-14 Identities = 47/93 (50%), Positives = 50/93 (53%), Gaps = 12/93 (12%) Frame = +1 Query: 52 PMSYYNQQQ--PPVGTPPPQGYPPEGYGKE-GYPPPGYPPP-------GYPPQ-GYPPQG 198 P Y QQQ P G P QGYP +GY ++ GYP GYP GYP Q GYP QG Sbjct: 74 PQQGYPQQQGYPQQGYPQQQGYPQQGYPQQQGYPQQGYPQQQGYPQQQGYPQQQGYPQQG 133 Query: 199 YPPPGYPPQGYPPPP-YSAQGYPPQYAPQYAQP 294 YP GYP QGYP Y QGYP Q PQ P Sbjct: 134 YPQQGYPQQGYPQQQGYPQQGYPQQGYPQQGYP 166 Score = 80.5 bits (197), Expect = 5e-14 Identities = 52/131 (39%), Positives = 55/131 (41%), Gaps = 49/131 (37%) Frame = +1 Query: 58 SYYNQQQ--PPVGTPPPQGYPPEGY----------------------------------- 126 S Y QQQ P G P QGYP +GY Sbjct: 65 SGYPQQQGYPQQGYPQQQGYPQQGYPQQQGYPQQGYPQQQGYPQQGYPQQQGYPQQQGYP 124 Query: 127 GKEGYPPPGYPPPGYPPQGYP-PQGYPPPGYPPQGYPPPPYSAQGYP----PQYAPQYAQ 291 ++GYP GYP GYP QGYP QGYP GYP QGYP Y QGYP PQ P Y Q Sbjct: 125 QQQGYPQQGYPQQGYPQQGYPQQQGYPQQGYPQQGYPQQGYPQQGYPQQGYPQQPPGYGQ 184 Query: 292 -------PPPP 303 PPPP Sbjct: 185 GYALPAGPPPP 195 [80][TOP] >UniRef100_Q0D324 Rhodopsin (Fragment) n=1 Tax=Onychoteuthis sp. B3-JMS-2004 RepID=Q0D324_9MOLL Length = 303 Score = 93.6 bits (231), Expect = 6e-18 Identities = 38/56 (67%), Positives = 40/56 (71%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP 237 Q Q PPPQGYPP+GY +GYPP GYPP GYPPQGYPPQG PP G PP PP Sbjct: 245 QAQQAAYPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQGPPPAAAPP 300 Score = 89.0 bits (219), Expect = 2e-16 Identities = 40/55 (72%), Positives = 40/55 (72%), Gaps = 2/55 (3%) Frame = +1 Query: 139 YPPP--GYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 YPPP GYPP GYPPQGYPPQGYPP GYPPQGYPP QG PPQ P A PP Sbjct: 251 YPPPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPP-----QGAPPQGPPPAAAPP 300 Score = 85.9 bits (211), Expect = 1e-15 Identities = 35/50 (70%), Positives = 37/50 (74%) Frame = +1 Query: 79 PPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP PPQGYPP+GY +GYPP GYPP GYPPQG PPQG PP PPQG Sbjct: 253 PPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPPQGPPPAAAPPQG 302 [81][TOP] >UniRef100_UPI0001982952 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982952 Length = 108 Score = 93.2 bits (230), Expect = 8e-18 Identities = 57/120 (47%), Positives = 62/120 (51%), Gaps = 5/120 (4%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQG-YPPEGY-GKEGYPPPG---YPPPGYPPQGYPPQGYPPPGYP 219 M+ + Q PV PPP YPP G YPPP YPPP PP+ YPP P GYP Sbjct: 1 MTQHGHHQGPVVYPPPSAPYPPPGQPPSAAYPPPHSVVYPPP-RPPRSYPP---PVQGYP 56 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 Y PP A YP + QPPPP +N S G GCCAALCCCCLLD CF Sbjct: 57 QAQYVAPPPVA--YPMKNG---HQPPPPPARSNHRGS---GFCRGCCAALCCCCLLDMCF 108 [82][TOP] >UniRef100_A5BFM6 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BFM6_VITVI Length = 607 Score = 93.2 bits (230), Expect = 8e-18 Identities = 44/71 (61%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGY-PPQGYPPQ-GYPPPGYPPQG 228 MSYY+QQQPPVG PP QGYP EGY K+ YPPPGYPP Y PPQ YPPQ PPP G Sbjct: 472 MSYYSQQQPPVGVPPSQGYPVEGYPKDAYPPPGYPPQAYPPPQAYPPQYAQPPPKNETGG 531 Query: 229 YPPPPYSAQGY 261 + YS Y Sbjct: 532 FLEGWYSQNHY 542 [83][TOP] >UniRef100_UPI0001984A01 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001984A01 Length = 115 Score = 92.4 bits (228), Expect = 1e-17 Identities = 56/121 (46%), Positives = 61/121 (50%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 G+P+ PP PP G PPP GYP GYPPP PPPG P QGY QGY G Sbjct: 25 GYPSAPP-------PPPPGCPPPPGYP-------GYPPPP-PPPGPPYQGY--QGYFNEG 67 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDA 393 YPP PPP PPQ QY Q + + S L GC AALCCCCLL+ Sbjct: 68 YPP---PPP-------PPQQYQQYQQ------YQYQDQSGPSSFLPGCLAALCCCCLLEE 111 Query: 394 C 396 C Sbjct: 112 C 112 [84][TOP] >UniRef100_B9N0Q7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N0Q7_POPTR Length = 175 Score = 92.4 bits (228), Expect = 1e-17 Identities = 47/84 (55%), Positives = 49/84 (58%), Gaps = 2/84 (2%) Frame = +1 Query: 121 GYGKEGYPP-PG-YPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQP 294 G+G GYPP PG YPP GYPPQGYPPQGYPP GYPP GYPP Y GYPP P Sbjct: 24 GHGAPGYPPQPGAYPPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGYPP-------GP 76 Query: 295 PPPHHHNNSNNSSSPGCLEGCCAA 366 PH +S G L G AA Sbjct: 77 SAPHQPGHSGGGLG-GLLAGGAAA 99 Score = 85.5 bits (210), Expect = 2e-15 Identities = 34/48 (70%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +1 Query: 106 GYPPE--GYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPP 243 GYPP+ Y +GYPP GYPP GYPPQGYPP GYPP YPP GYPP P Sbjct: 29 GYPPQPGAYPPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGYPPGP 76 Score = 80.9 bits (198), Expect = 4e-14 Identities = 34/57 (59%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP--PPYSAQG 258 P P YPP+GY +GYPP GYPP GYPP GYPP YPP GYPP P P +S G Sbjct: 32 PQPGAYPPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGYPPGPSAPHQPGHSGGG 88 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +1 Query: 34 GHPTTPPM--SYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 G P PP +Y Q PP G PP QGYPP +GYPP GYPP YPP GYPP P Sbjct: 26 GAPGYPPQPGAYPPQGYPPQGYPP-QGYPP-----QGYPPAGYPPGAYPPSGYPPGPSAP 79 Query: 208 --PGYPPQG 228 PG+ G Sbjct: 80 HQPGHSGGG 88 [85][TOP] >UniRef100_A9P8F5 Putative uncharacterized protein n=1 Tax=Populus trichocarpa RepID=A9P8F5_POPTR Length = 189 Score = 92.4 bits (228), Expect = 1e-17 Identities = 47/84 (55%), Positives = 49/84 (58%), Gaps = 2/84 (2%) Frame = +1 Query: 121 GYGKEGYPP-PG-YPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQP 294 G+G GYPP PG YPP GYPPQGYPPQGYPP GYPP GYPP Y GYPP P Sbjct: 24 GHGAPGYPPQPGAYPPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGYPP-------GP 76 Query: 295 PPPHHHNNSNNSSSPGCLEGCCAA 366 PH +S G L G AA Sbjct: 77 SAPHQPGHSGGGLG-GLLAGGAAA 99 Score = 85.5 bits (210), Expect = 2e-15 Identities = 34/48 (70%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +1 Query: 106 GYPPE--GYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPP 243 GYPP+ Y +GYPP GYPP GYPPQGYPP GYPP YPP GYPP P Sbjct: 29 GYPPQPGAYPPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGYPPGP 76 Score = 80.9 bits (198), Expect = 4e-14 Identities = 34/57 (59%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP--PPYSAQG 258 P P YPP+GY +GYPP GYPP GYPP GYPP YPP GYPP P P +S G Sbjct: 32 PQPGAYPPQGYPPQGYPPQGYPPQGYPPAGYPPGAYPPSGYPPGPSAPHQPGHSGGG 88 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/69 (50%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +1 Query: 34 GHPTTPPM--SYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 G P PP +Y Q PP G PP QGYPP +GYPP GYPP YPP GYPP P Sbjct: 26 GAPGYPPQPGAYPPQGYPPQGYPP-QGYPP-----QGYPPAGYPPGAYPPSGYPPGPSAP 79 Query: 208 --PGYPPQG 228 PG+ G Sbjct: 80 HQPGHSGGG 88 [86][TOP] >UniRef100_C0PAF2 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PAF2_MAIZE Length = 84 Score = 92.0 bits (227), Expect = 2e-17 Identities = 53/102 (51%), Positives = 55/102 (53%), Gaps = 2/102 (1%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP--GYPPQG 228 MSYY QQ PPVG PP QGYP GK+GYPP GY PP GYPPP GYPPQG Sbjct: 1 MSYYGQQ-PPVGVPPQQGYP----GKDGYPPAGY----------PPAGYPPPAQGYPPQG 45 Query: 229 YPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEG 354 YP PQYAQPPPP SS P +EG Sbjct: 46 YP--------------PQYAQPPPP----QQQQSSGPSFMEG 69 [87][TOP] >UniRef100_Q39115 GPRP protein n=1 Tax=Arabidopsis thaliana RepID=Q39115_ARATH Length = 177 Score = 91.7 bits (226), Expect = 2e-17 Identities = 51/103 (49%), Positives = 59/103 (57%), Gaps = 7/103 (6%) Frame = +1 Query: 79 PPVGTPPPQGYPPEGYGKEGYPPP--GYPPPGYPPQGYPPQ--GYPP-PGYPPQGYPPPP 243 PP G PPP YPP GY ++GYPPP YPP GYPP YPP GYPP PGY GYPP P Sbjct: 17 PPAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGY--GGYPPAP 74 Query: 244 YSAQGYPPQYAPQYAQPPPPHH--HNNSNNSSSPGCLEGCCAA 366 GYPP AP + PP + H++ + G + G AA Sbjct: 75 -GYGGYPP--APGHGGYPPAGYPAHHSGHAGGIGGMIAGAAAA 114 Score = 80.5 bits (197), Expect = 5e-14 Identities = 40/63 (63%), Positives = 41/63 (65%), Gaps = 5/63 (7%) Frame = +1 Query: 127 GKEGYPPPGYPPPG-YPPQGYPPQGYPPP--GYPPQGYPPPPY--SAQGYPPQYAPQYAQ 291 G GYPP GYPPPG YPP GYP QGYPPP YPP GYPP Y + GYPP AP Y Sbjct: 12 GFHGYPPAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPP--APGYGG 69 Query: 292 PPP 300 PP Sbjct: 70 YPP 72 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/47 (63%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +1 Query: 166 GYPPQGYPPQG-YPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 GYPP GYPP G YPP GYP QGYPPPP YPP P A PP P Sbjct: 15 GYPPAGYPPPGAYPPAGYPQQGYPPPP---GAYPPAGYPPGAYPPAP 58 [88][TOP] >UniRef100_A0C5H2 Chromosome undetermined scaffold_15, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0C5H2_PARTE Length = 198 Score = 91.7 bits (226), Expect = 2e-17 Identities = 56/104 (53%), Positives = 60/104 (57%), Gaps = 21/104 (20%) Frame = +1 Query: 37 HPTTPPMSY----YNQQQ-------PPVGTP--PPQGYPPE--GYGKEGYPP-PGYPP-P 165 +P PP +Y Y QQ PP G P P GYPP GY ++GYPP PGYPP P Sbjct: 17 YPPPPPPAYGQTPYPQQPGYQQPPPPPAGYPYPPTPGYPPPVGGYPQQGYPPTPGYPPTP 76 Query: 166 GYPPQ-GYPPQGYPPPGYPPQ--GYPPPP-YSAQGYPPQYAPQY 285 GYPP GYPP GYPP GYPP GY PPP Y Q P QY QY Sbjct: 77 GYPPTPGYPPAGYPPAGYPPPQPGYVPPPNYPQQYPPQQYPGQY 120 Score = 91.7 bits (226), Expect = 2e-17 Identities = 51/98 (52%), Positives = 55/98 (56%), Gaps = 5/98 (5%) Frame = +1 Query: 1 ARGKASN*QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP-PGYPP-PGYP 174 A G+ Q G+ PP P G PPP G GY ++GYPP PGYPP PGYP Sbjct: 24 AYGQTPYPQQPGYQQPPPPPAGYPYPPTPGYPPPVG----GYPQQGYPPTPGYPPTPGYP 79 Query: 175 P-QGYPPQGYPPPGYPP--QGYPPPPYSAQGYPPQYAP 279 P GYPP GYPP GYPP GY PPP Q YPPQ P Sbjct: 80 PTPGYPPAGYPPAGYPPPQPGYVPPPNYPQQYPPQQYP 117 Score = 86.7 bits (213), Expect = 8e-16 Identities = 57/123 (46%), Positives = 59/123 (47%), Gaps = 22/123 (17%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGY----------------PPEGYGKEGYPP-PGYPPP- 165 P PP Y Q Q P PPP Y PP GY YPP PGYPPP Sbjct: 4 PPPPPYGGYPQGQYP--PPPPPAYGQTPYPQQPGYQQPPPPPAGY---PYPPTPGYPPPV 58 Query: 166 -GYPPQGYPP-QGYPP-PGYPP-QGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSS 333 GYP QGYPP GYPP PGYPP GYPP Y GYPP PQ PPP++ Sbjct: 59 GGYPQQGYPPTPGYPPTPGYPPTPGYPPAGYPPAGYPP---PQPGYVPPPNYPQQYPPQQ 115 Query: 334 SPG 342 PG Sbjct: 116 YPG 118 Score = 68.6 bits (166), Expect = 2e-10 Identities = 42/82 (51%), Positives = 43/82 (52%), Gaps = 15/82 (18%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPE-GYGKE-GYPP-PGYPPPGYPPQGYPP---- 192 G+P P Y PPVG P QGYPP GY GYPP PGYPP GYPP GYPP Sbjct: 45 GYPYPPTPGY----PPPVGGYPQQGYPPTPGYPPTPGYPPTPGYPPAGYPPAGYPPPQPG 100 Query: 193 --------QGYPPPGYPPQGYP 234 Q YPP YP Q YP Sbjct: 101 YVPPPNYPQQYPPQQYPGQ-YP 121 [89][TOP] >UniRef100_C5FNC5 Annexin A7 n=1 Tax=Microsporum canis CBS 113480 RepID=C5FNC5_NANOT Length = 472 Score = 91.7 bits (226), Expect = 2e-17 Identities = 55/109 (50%), Positives = 60/109 (55%), Gaps = 31/109 (28%) Frame = +1 Query: 79 PPVGTPPPQGYPPEGYGKEGYPPPG-YPPP---GYPPQG-------YPPQG-YPPPG--- 213 PP G PPPQGYPP+GY +G+PP G YPPP YPPQG YPPQG +PPPG Sbjct: 13 PPHGGPPPQGYPPQGY--QGHPPQGQYPPPQHGQYPPQGHHPPQGHYPPQGHHPPPGGAQ 70 Query: 214 ---YPPQGYPP-----------PPYSA--QGYPPQYAPQYAQPPPPHHH 312 Y PQG+PP PP A GYPPQ PQ PPP H Sbjct: 71 AQYYAPQGHPPQGQYPQGQYGAPPPGAPPHGYPPQGLPQGQYPPPQQGH 119 Score = 87.0 bits (214), Expect = 6e-16 Identities = 53/118 (44%), Positives = 60/118 (50%), Gaps = 25/118 (21%) Frame = +1 Query: 31 RGHPTTPPMSYY----NQQQPPVGTPPPQG-YPPEGYGKEGYPPPG------YPPPGYPP 177 +G+ PP Y + Q PP G PPQG YPP+G+ +PPPG Y P G+PP Sbjct: 26 QGYQGHPPQGQYPPPQHGQYPPQGHHPPQGHYPPQGH----HPPPGGAQAQYYAPQGHPP 81 Query: 178 QGYPPQGY---PPPGYPPQGYPP---------PPYSAQGYPPQ--YAPQYAQPPPPHH 309 QG PQG PPPG PP GYPP PP PPQ YAPQ PP HH Sbjct: 82 QGQYPQGQYGAPPPGAPPHGYPPQGLPQGQYPPPQQGHYPPPQHGYAPQGHYPPQGHH 139 Score = 72.0 bits (175), Expect = 2e-11 Identities = 44/89 (49%), Positives = 49/89 (55%), Gaps = 10/89 (11%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQ---PPVGTPPPQGYPPEGYGKEGYPPPG---YPPP--GYPPQG- 183 +GHP P Y Q Q PP G PP GYPP+G + YPPP YPPP GY PQG Sbjct: 77 QGHP---PQGQYPQGQYGAPPPGAPP-HGYPPQGLPQGQYPPPQQGHYPPPQHGYAPQGH 132 Query: 184 YPPQGY-PPPGYPPQGYPPPPYSAQGYPP 267 YPPQG+ P PGY PP + GY P Sbjct: 133 YPPQGHHPQPGYGAAPSGPPAQPSPGYAP 161 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/57 (56%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +1 Query: 151 GYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ---YAPQYAQPPPPHHH 312 GYPPPG P YPP G PPP QGYPP Y QG+PPQ PQ+ Q PP HH Sbjct: 3 GYPPPGQNP--YPPHGGPPP----QGYPPQGY--QGHPPQGQYPPPQHGQYPPQGHH 51 [90][TOP] >UniRef100_A9RJ18 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RJ18_PHYPA Length = 377 Score = 91.3 bits (225), Expect = 3e-17 Identities = 46/100 (46%), Positives = 54/100 (54%), Gaps = 6/100 (6%) Frame = +1 Query: 88 GTPPPQGYPPEGYGKEG---YPP---PGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 G PP QGYPP+GY +G YPP GYPP GYPP GYPP GYPP GYPP GYPP Y Sbjct: 209 GYPPQQGYPPQGYPPQGGHAYPPGAPAGYPPAGYPPAGYPPSGYPPSGYPPSGYPPSGY- 267 Query: 250 AQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAAL 369 P H ++ ++S + G + AAL Sbjct: 268 ----------------PRAHDSHGSSSHAVGGMAAGAAAL 291 Score = 80.5 bits (197), Expect = 5e-14 Identities = 40/76 (52%), Positives = 41/76 (53%), Gaps = 5/76 (6%) Frame = +1 Query: 7 GKASN*QHRGHPTTPPMSYYNQQQPPVGTPPPQG--YPP---EGYGKEGYPPPGYPPPGY 171 G + H H PP Y PP G PP G YPP GY GYPP GYPP GY Sbjct: 197 GSSQQYGHGHHGGYPPQQGY----PPQGYPPQGGHAYPPGAPAGYPPAGYPPAGYPPSGY 252 Query: 172 PPQGYPPQGYPPPGYP 219 PP GYPP GYPP GYP Sbjct: 253 PPSGYPPSGYPPSGYP 268 [91][TOP] >UniRef100_B4YS88 Rhodopsin (Fragment) n=1 Tax=Alloteuthis media RepID=B4YS88_9MOLL Length = 309 Score = 91.3 bits (225), Expect = 3e-17 Identities = 47/77 (61%), Positives = 48/77 (62%), Gaps = 1/77 (1%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP-GYPPQGYPPPPY 246 QQQ PPPQGYPP+GY PP PPQGYPPQGYPPP GYPPQGYPPP Sbjct: 243 QQQQQPAYPPPQGYPPQGY-----------PP--PPQGYPPQGYPPPQGYPPQGYPPP-- 287 Query: 247 SAQGYPPQYAPQYAQPP 297 QG PPQ P A PP Sbjct: 288 --QGPPPQGPPPQAAPP 302 Score = 77.8 bits (190), Expect = 4e-13 Identities = 36/53 (67%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = +1 Query: 148 PGYPPP-GYPPQGYPPQGYPPPGYPPQGYPPPP-YSAQGYPPQYAPQYAQPPP 300 P YPPP GYPPQGYPP PP GYPPQGYPPP Y QGYPP P PPP Sbjct: 248 PAYPPPQGYPPQGYPP---PPQGYPPQGYPPPQGYPPQGYPPPQGPPPQGPPP 297 Score = 73.9 bits (180), Expect = 5e-12 Identities = 38/69 (55%), Positives = 41/69 (59%), Gaps = 2/69 (2%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGK-EGYPPPGYPPP-GYPPQGYPPQG 198 Q + P PP Y Q P PPPQGYPP+GY +GYPP GYPPP G PPQG PPQ Sbjct: 243 QQQQQPAYPPPQGYPPQGYP---PPPQGYPPQGYPPPQGYPPQGYPPPQGPPPQGPPPQA 299 Query: 199 YPPPGYPPQ 225 PP G Q Sbjct: 300 APPQGVDNQ 308 [92][TOP] >UniRef100_A2FFX8 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2FFX8_TRIVA Length = 306 Score = 91.3 bits (225), Expect = 3e-17 Identities = 55/96 (57%), Positives = 56/96 (58%), Gaps = 13/96 (13%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQG-YPPEGYGKEGYPPPGYPPPG-YPPQG-YPPQGYPPPG-Y 216 PP Y QQ PP G PPQG YPP+G YPP YPP G YPPQG YPP YPP G Y Sbjct: 148 PPPGQYPQQMPPPGQYPPQGQYPPQGQ----YPPGQYPPQGQYPPQGQYPPGQYPPQGQY 203 Query: 217 PPQG-YPPPPYSAQG-YPP-------QYAPQYAQPP 297 PPQG YPP Y QG YPP QY PQ PP Sbjct: 204 PPQGQYPPGQYPPQGQYPPQGQYPPGQYPPQGQYPP 239 Score = 85.1 bits (209), Expect = 2e-15 Identities = 52/102 (50%), Positives = 55/102 (53%), Gaps = 13/102 (12%) Frame = +1 Query: 49 PPMSYYNQ-QQPPVGTPPPQG-YPPEGYGKEG-YPPPG-YPPPGYPPQG-YPPQG-YPPP 210 PP Y Q PP G PPQG YPP Y +G YPP G YPP YPPQG YPPQG YPP Sbjct: 170 PPQGQYPPGQYPPQGQYPPQGQYPPGQYPPQGQYPPQGQYPPGQYPPQGQYPPQGQYPPG 229 Query: 211 GYPPQG-------YPPPPYSAQGYPPQYAPQYAQPPPPHHHN 315 YPPQG YPP Y Q P QY P P +H+ Sbjct: 230 QYPPQGQYPPQGQYPPGQYPPQPQPGQYPPGQYPPQGMSYHD 271 Score = 71.6 bits (174), Expect = 3e-11 Identities = 51/123 (41%), Positives = 51/123 (41%), Gaps = 20/123 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG-----------YPPQ 180 GHP P PPPQG YPP G PPPG YPPQ Sbjct: 124 GHPAFHPFQ---------AMPPPQGV--------AYPPQGMPPPGQYPQQMPPPGQYPPQ 166 Query: 181 G-YPPQG-YPPPGYPPQGYPPP--PYSAQGYPP--QYAPQYAQPP---PPHHHNNSNNSS 333 G YPPQG YPP YPPQG PP Y YPP QY PQ PP PP Sbjct: 167 GQYPPQGQYPPGQYPPQGQYPPQGQYPPGQYPPQGQYPPQGQYPPGQYPPQGQYPPQGQY 226 Query: 334 SPG 342 PG Sbjct: 227 PPG 229 [93][TOP] >UniRef100_A0E2M3 Chromosome undetermined scaffold_75, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0E2M3_PARTE Length = 288 Score = 91.3 bits (225), Expect = 3e-17 Identities = 64/115 (55%), Positives = 67/115 (58%), Gaps = 22/115 (19%) Frame = +1 Query: 25 QHRGHPTTP---PMSYYNQQQPPV--GTPPPQ-GYPPEGYGKEGYPP--PGYPP--PGYP 174 Q G+PT P P Y Q P G PP Q GYPP+ + GYPP PGYPP PGYP Sbjct: 163 QQPGYPTQPGYPPQPGYPAQPYPQQPGYPPQQPGYPPQ---QPGYPPQQPGYPPQQPGYP 219 Query: 175 PQ-GYPPQ--GYPP--PGYPPQ--GYPP--PPYSAQ--GYP-PQYAPQYAQPPPP 303 PQ GYPPQ GYPP PGYPPQ GYPP P Y Q GYP QY PQ PP P Sbjct: 220 PQPGYPPQQPGYPPQQPGYPPQQPGYPPQQPGYPPQQPGYPAQQYPPQQGYPPQP 274 Score = 82.0 bits (201), Expect = 2e-14 Identities = 56/103 (54%), Positives = 58/103 (56%), Gaps = 20/103 (19%) Frame = +1 Query: 52 PMSYYNQQQ---PPVGTPPPQGYPPEGYG---KEGYPP-PGYPPPGYPPQ-GYPPQ--GY 201 P Y QQ P G PP Q YPP+ G + GYPP PGYP YP Q GYPPQ GY Sbjct: 138 PNQPYQQQPMYPPQPGYPPQQPYPPQQPGYPTQPGYPPQPGYPAQPYPQQPGYPPQQPGY 197 Query: 202 PP--PGYPPQ--GYPP--PPYSAQ-GYPPQ---YAPQYAQPPP 300 PP PGYPPQ GYPP P Y Q GYPPQ Y PQ PP Sbjct: 198 PPQQPGYPPQQPGYPPQQPGYPPQPGYPPQQPGYPPQQPGYPP 240 Score = 80.9 bits (198), Expect = 4e-14 Identities = 51/91 (56%), Positives = 54/91 (59%), Gaps = 9/91 (9%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP--PGYPP--PGYPPQ--GY 186 Q G+P P Y QQP G PP GYPP+ + GYPP PGYPP PGYPPQ GY Sbjct: 200 QQPGYP--PQQPGYPPQQP--GYPPQPGYPPQ---QPGYPPQQPGYPPQQPGYPPQQPGY 252 Query: 187 PPQ--GYPPPGYPP-QGYPPPPYSAQGYPPQ 270 PPQ GYP YPP QGYPP P GYP Q Sbjct: 253 PPQQPGYPAQQYPPQQGYPPQP-GYPGYPQQ 282 Score = 75.9 bits (185), Expect = 1e-12 Identities = 45/77 (58%), Positives = 47/77 (61%), Gaps = 10/77 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQ-GYPPEGYGKEGYPP--PGYPP--PGYPPQGYPP-QGY 201 P PP Y QQP G PP Q GYPP+ + GYPP PGYPP PGYP Q YPP QGY Sbjct: 216 PGYPPQPGYPPQQP--GYPPQQPGYPPQ---QPGYPPQQPGYPPQQPGYPAQQYPPQQGY 270 Query: 202 PP----PGYPPQGYPPP 240 PP PGYP QGY P Sbjct: 271 PPQPGYPGYPQQGYQKP 287 Score = 68.9 bits (167), Expect = 2e-10 Identities = 52/103 (50%), Positives = 54/103 (52%), Gaps = 17/103 (16%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQ-GYPPQ-GYP--- 204 P P Y QQQP PP GYPP+ + YPP PGYP Q GYPPQ GYP Sbjct: 135 PYFPNQPY--QQQPMY--PPQPGYPPQ----QPYPPQ---QPGYPTQPGYPPQPGYPAQP 183 Query: 205 ---PPGYPPQ--GYPP--PPYSAQ--GYPPQ---YAPQYAQPP 297 PGYPPQ GYPP P Y Q GYPPQ Y PQ PP Sbjct: 184 YPQQPGYPPQQPGYPPQQPGYPPQQPGYPPQQPGYPPQPGYPP 226 Score = 56.2 bits (134), Expect = 1e-06 Identities = 37/70 (52%), Positives = 41/70 (58%), Gaps = 6/70 (8%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPP-PGYPPQG-YPPQGYPPPGYPPQ-GYPPPP-YSAQGYP--PQ 270 +P + Y ++ P YPP PGYPPQ YPPQ PGYP Q GYPP P Y AQ YP P Sbjct: 137 FPNQPYQQQ----PMYPPQPGYPPQQPYPPQ---QPGYPTQPGYPPQPGYPAQPYPQQPG 189 Query: 271 YAPQYAQPPP 300 Y PQ PP Sbjct: 190 YPPQQPGYPP 199 [94][TOP] >UniRef100_P31356 Rhodopsin n=1 Tax=Todarodes pacificus RepID=OPSD_TODPA Length = 448 Score = 91.3 bits (225), Expect = 3e-17 Identities = 41/54 (75%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +1 Query: 139 YPPPGYPPP--GYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQP 294 YPP GY PP GYPPQGYPPQGYPP GYPPQGYPPPP QG PPQ AP A P Sbjct: 388 YPPQGYAPPPQGYPPQGYPPQGYPPQGYPPQGYPPPP---QGAPPQGAPPAAPP 438 Score = 84.7 bits (208), Expect = 3e-15 Identities = 42/76 (55%), Positives = 45/76 (59%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M+ + Q PPQGY P +GYPP GYPP GYPPQGYPPQGYPP PPQG P Sbjct: 375 MAMMQKMQQQQAAYPPQGYAPP---PQGYPPQGYPPQGYPPQGYPPQGYPP---PPQGAP 428 Query: 235 PPPYSAQGYPPQYAPQ 282 P QG PP PQ Sbjct: 429 P-----QGAPPAAPPQ 439 Score = 73.2 bits (178), Expect = 9e-12 Identities = 36/56 (64%), Positives = 37/56 (66%), Gaps = 6/56 (10%) Frame = +1 Query: 169 YPPQGY--PPQGYPPPGYPPQGYPPPPYSAQGY--PPQYAPQYAQPP--PPHHHNN 318 YPPQGY PPQGYPP GYPPQGYPP Y QGY PPQ AP PP PP +N Sbjct: 388 YPPQGYAPPPQGYPPQGYPPQGYPPQGYPPQGYPPPPQGAPPQGAPPAAPPQGVDN 443 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/68 (50%), Positives = 35/68 (51%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP Y Q PP G PP QGYPP +GYPP PPQG PPQG PP PPQG Sbjct: 396 PPQGYPPQGYPPQGYPP-QGYPP-----QGYPP--------PPQGAPPQG-APPAAPPQG 440 Query: 229 YPPPPYSA 252 Y A Sbjct: 441 VDNQAYQA 448 [95][TOP] >UniRef100_P24639 Annexin A7 n=1 Tax=Dictyostelium discoideum RepID=ANXA7_DICDI Length = 462 Score = 91.3 bits (225), Expect = 3e-17 Identities = 60/99 (60%), Positives = 63/99 (63%), Gaps = 16/99 (16%) Frame = +1 Query: 49 PPMSYYNQQQ---PPVGTPPPQGYPPE-GYG-KEGYPPP-GYPPP-GYPPQ-GYPPQ-GY 201 PP Y QQ P G PP QGYPP+ GY ++GYPP GYPP GYPPQ GYPPQ GY Sbjct: 35 PPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGY 94 Query: 202 PP-PGYPP-QGYPP----PPYSAQGYPPQ-YAPQYAQPP 297 PP GYPP QGYPP PP QGYPPQ Y PQ PP Sbjct: 95 PPQQGYPPQQGYPPQQGYPP--QQGYPPQGYPPQQGYPP 131 Score = 90.5 bits (223), Expect = 5e-17 Identities = 58/96 (60%), Positives = 61/96 (63%), Gaps = 13/96 (13%) Frame = +1 Query: 49 PPMSYYNQQQ---PPVGTPPPQGYPPE-GYG-KEGYPPP-GYPPP-GYPPQ-GYPPQ-GY 201 PP Y QQ P G PP QGYPP+ GY ++GYPP GYPP GYPPQ GYPPQ GY Sbjct: 29 PPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGY 88 Query: 202 PP-PGYPP-QGYPPPPYSAQGYPPQ--YAPQYAQPP 297 PP GYPP QGYPP QGYPPQ Y PQ PP Sbjct: 89 PPQQGYPPQQGYPP----QQGYPPQQGYPPQQGYPP 120 Score = 88.6 bits (218), Expect = 2e-16 Identities = 60/108 (55%), Positives = 62/108 (57%), Gaps = 14/108 (12%) Frame = +1 Query: 16 SN*QHRGHPTTPPMSYYNQQ--QPPVGTPPPQGYPPEGYGKEGYPPP-GYPPP-GYPPQ- 180 SN G P Y QQ P G PP QGYPP+ +GYPP GYPP GYPPQ Sbjct: 13 SNSPQPGQYGAPQQGYPPQQGYPPQQGYPPQQGYPPQ----QGYPPQQGYPPQQGYPPQQ 68 Query: 181 GYPPQ-GYPP-PGYPP-QGYPP----PPYSAQGYPPQ--YAPQYAQPP 297 GYPPQ GYPP GYPP QGYPP PP QGYPPQ Y PQ PP Sbjct: 69 GYPPQQGYPPQQGYPPQQGYPPQQGYPP--QQGYPPQQGYPPQQGYPP 114 Score = 84.0 bits (206), Expect = 5e-15 Identities = 54/91 (59%), Positives = 56/91 (61%), Gaps = 8/91 (8%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-GYPPP-GYPPQ-GYPPQ-GYPPP-G 213 PP S N QP P QGYPP+ +GYPP GYPP GYPPQ GYPPQ GYPP G Sbjct: 10 PPQS--NSPQPGQYGAPQQGYPPQ----QGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQG 63 Query: 214 YPPQ-GYPPPPYSAQGYPPQ--YAPQYAQPP 297 YPPQ GYPP QGYPPQ Y PQ PP Sbjct: 64 YPPQQGYPPQ----QGYPPQQGYPPQQGYPP 90 Score = 82.0 bits (201), Expect = 2e-14 Identities = 51/87 (58%), Positives = 55/87 (63%), Gaps = 10/87 (11%) Frame = +1 Query: 49 PPMSYYNQQQ---PPVGTPPPQGYPPE-GYG-KEGYPPP-GYPPP-GYPPQ-GYPPQ-GY 201 PP Y QQ P G PP QGYPP+ GY ++GYPP GYPP GYPPQ GYPPQ GY Sbjct: 59 PPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGY 118 Query: 202 PPPGYPP-QGYPPPPYSAQGYPPQYAP 279 PP GYPP QGYPP G P +AP Sbjct: 119 PPQGYPPQQGYPPVGVPV-GVPVGFAP 144 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/66 (57%), Positives = 38/66 (57%), Gaps = 13/66 (19%) Frame = +1 Query: 139 YPP-PGYPPPGYPPQ----GYPPQGYPP-PGYPP-QGYPP----PPYSAQGYPPQ--YAP 279 YPP GYPP PQ G P QGYPP GYPP QGYPP PP QGYPPQ Y P Sbjct: 3 YPPNQGYPPQSNSPQPGQYGAPQQGYPPQQGYPPQQGYPPQQGYPP--QQGYPPQQGYPP 60 Query: 280 QYAQPP 297 Q PP Sbjct: 61 QQGYPP 66 [96][TOP] >UniRef100_Q0D321 Rhodopsin (Fragment) n=1 Tax=Abraliopsis pacificus RepID=Q0D321_9MOLL Length = 299 Score = 90.9 bits (224), Expect = 4e-17 Identities = 39/56 (69%), Positives = 40/56 (71%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP 237 QQ PPPQGYPP+GY PP GYPP GYPPQGYPPQGYPP G PPQG PP Sbjct: 244 QQAQQPAYPPPQGYPPQGYP----PPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPP 295 Score = 84.0 bits (206), Expect = 5e-15 Identities = 40/54 (74%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = +1 Query: 139 YPPP-GYPPPGYPP-QGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQP 294 YPPP GYPP GYPP QGYPPQGYPP GYPPQGYPP QG PPQ AP A P Sbjct: 251 YPPPQGYPPQGYPPPQGYPPQGYPPQGYPPQGYPP-----QGAPPQGAPPAAAP 299 Score = 78.6 bits (192), Expect = 2e-13 Identities = 37/65 (56%), Positives = 38/65 (58%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q P PP Y PP G PPPQGYPP +GYPP GYPP GYPPQG PPQG P Sbjct: 244 QQAQQPAYPPPQGY----PPQGYPPPQGYPP-----QGYPPQGYPPQGYPPQGAPPQGAP 294 Query: 205 PPGYP 219 P P Sbjct: 295 PAAAP 299 [97][TOP] >UniRef100_C6T2Z6 Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T2Z6_SOYBN Length = 118 Score = 90.5 bits (223), Expect = 5e-17 Identities = 47/110 (42%), Positives = 56/110 (50%), Gaps = 22/110 (20%) Frame = +1 Query: 133 EGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQ------- 291 E YPPPG+ P PPQ P P GYPP PPPP GYPP + PQ+ Sbjct: 10 ESYPPPGHGSPYPPPQPGYPSAPPHEGYPP---PPPPPGYGGYPPPHPPQHPPYDSYQGY 66 Query: 292 --------PPPPHHH----NNSNNSSSPGC---LEGCCAALCCCCLLDAC 396 PPPPH+H ++ + PGC L GC AALCCCC+L+ C Sbjct: 67 FDNGRPPPPPPPHYHYQHVDHHHLHDEPGCFSFLRGCIAALCCCCVLEEC 116 [98][TOP] >UniRef100_A5AL41 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AL41_VITVI Length = 336 Score = 90.1 bits (222), Expect = 7e-17 Identities = 54/112 (48%), Positives = 56/112 (50%), Gaps = 20/112 (17%) Frame = +1 Query: 37 HPTTPPMSYYNQQQ----------PPVGTPPPQGYP------PEGYGKEGYPPP-GYPPP 165 H PP YY Q PP+ PP QGYP P GY GY PP G+PP Sbjct: 31 HMACPPQQYYPPPQQCYPPPQQCYPPLAYPP-QGYPXAKYSPPFGYPAAGYSPPCGFPPA 89 Query: 166 GYPPQ-GYPPQGYPPPG-YPPQGYPPP-PYSAQGYPPQYAPQYAQPPPPHHH 312 YPP G PP YPPPG YPP GYPPP Y A GYPP Q A PP H Sbjct: 90 XYPPPCGLPPAEYPPPGVYPPAGYPPPGGYPAAGYPPLSGHQAAGYSPPSEH 141 Score = 72.0 bits (175), Expect = 2e-11 Identities = 45/100 (45%), Positives = 51/100 (51%), Gaps = 8/100 (8%) Frame = +1 Query: 31 RGHPT---TPPMSYYNQ-QQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPGYPPQ-GYPP 192 +G+P +PP Y PP G PP PP G YPPPG YPP GYPP GYP Sbjct: 62 QGYPXAKYSPPFGYPAAGYSPPCGFPPAXYPPPCGLPPAEYPPPGVYPPAGYPPPGGYPA 121 Query: 193 QGYPP-PGYPPQGY-PPPPYSAQGYPPQYAPQYAQPPPPH 306 GYPP G+ GY PP + A GYP P PP P+ Sbjct: 122 AGYPPLSGHQAAGYSPPSEHPAAGYP----PPGGYPPAPY 157 Score = 70.1 bits (170), Expect = 7e-11 Identities = 39/79 (49%), Positives = 42/79 (53%), Gaps = 9/79 (11%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-GYPPPGYPP------QGY-PPQGYP 204 PP Y PP G PP + PP Y GYPPP GYP GYPP GY PP +P Sbjct: 87 PPAXY----PPPCGLPPAEYPPPGVYPPAGYPPPGGYPAAGYPPLSGHQAAGYSPPSEHP 142 Query: 205 PPGYPPQ-GYPPPPYSAQG 258 GYPP GYPP PY+ G Sbjct: 143 AAGYPPPGGYPPAPYTLPG 161 Score = 53.9 bits (128), Expect = 5e-06 Identities = 36/76 (47%), Positives = 37/76 (48%), Gaps = 7/76 (9%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP----PPP--YSAQ 255 PP PP+ Y YPPP YPP P Q YPP YPPQGYP PP Y A Sbjct: 29 PPHMACPPQQY----YPPP---QQCYPP---PQQCYPPLAYPPQGYPXAKYSPPFGYPAA 78 Query: 256 GY-PPQYAPQYAQPPP 300 GY PP P PPP Sbjct: 79 GYSPPCGFPPAXYPPP 94 [99][TOP] >UniRef100_Q0D314 Rhodopsin (Fragment) n=1 Tax=Cranchia scabra RepID=Q0D314_9MOLL Length = 278 Score = 90.1 bits (222), Expect = 7e-17 Identities = 38/61 (62%), Positives = 41/61 (67%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M+ + Q PP GYPP+GY PP GYPP GYPPQGYPPQGYPP GYPPQG P Sbjct: 223 MAMMQKMQAQQAQAPPAGYPPQGY-----PPQGYPPQGYPPQGYPPQGYPPQGYPPQGAP 277 Query: 235 P 237 P Sbjct: 278 P 278 Score = 88.2 bits (217), Expect = 3e-16 Identities = 37/46 (80%), Positives = 37/46 (80%) Frame = +1 Query: 142 PPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 PP GYPP GYPPQGYPPQGYPP GYPPQGYPP QGYPPQ AP Sbjct: 237 PPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPP-----QGYPPQGAP 277 Score = 74.7 bits (182), Expect = 3e-12 Identities = 32/42 (76%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +1 Query: 172 PPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ-YAPQYAQP 294 PP GYPPQGYPP GYPPQGYPP Y QGYPPQ Y PQ A P Sbjct: 237 PPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGAPP 278 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/53 (58%), Positives = 32/53 (60%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 PP Y Q PP G PP QGYPP+ GYPP GYPPQGYPPQG PP Sbjct: 237 PPAGYPPQGYPPQGYPP-QGYPPQ----------GYPPQGYPPQGYPPQGAPP 278 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +1 Query: 187 PPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PP GYPP GYPPQGYPP Y QGYPPQ P PP Sbjct: 237 PPAGYPPQGYPPQGYPPQGYPPQGYPPQGYPPQGYPP 273 [100][TOP] >UniRef100_Q86AY8 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q86AY8_DICDI Length = 637 Score = 89.7 bits (221), Expect = 9e-17 Identities = 48/87 (55%), Positives = 50/87 (57%), Gaps = 2/87 (2%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYP-PQGYPPPGYPPQ 225 PP Y QQ PP PQ YPP+ Y + YPP YPPP PQ YP PQ YPP YPPQ Sbjct: 165 PPPQQYPQQYPP--QQYPQQYPPQQYPPQQYPPQQYPPPQQYPQPYPHPQQYPPQQYPPQ 222 Query: 226 GYPPPPYSAQGYPPQYAPQ-YAQPPPP 303 YPP Q YP QY Q Y QPPPP Sbjct: 223 QYPP-----QQYPQQYYGQPYQQPPPP 244 Score = 70.9 bits (172), Expect = 4e-11 Identities = 40/84 (47%), Positives = 43/84 (51%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP Y QQ PP PPPQ YP + YPP YPP YPPQ YP Q Y G P Q Sbjct: 184 PPQQYPPQQYPPQQYPPPQQYPQPYPHPQQYPPQQYPPQQYPPQQYPQQYY---GQPYQ- 239 Query: 229 YPPPPYSAQGYPPQYAPQYAQPPP 300 PPP S PQ +P +PPP Sbjct: 240 -QPPPPSVPQQQPQQSP--LKPPP 260 Score = 60.5 bits (145), Expect = 6e-08 Identities = 38/85 (44%), Positives = 41/85 (48%), Gaps = 4/85 (4%) Frame = +1 Query: 70 QQQPPVGTPPPQGY--PPEGYGKEGYPPPGY--PPPGYPPQGYPPQGYPPPGYPPQGYPP 237 QQQ P P Q Y PP+ + YPP PPP PQ YPPQ YP Q YPP Sbjct: 136 QQQSPQHNPYGQPYQQPPQ----QQYPPQQQFAPPPQQYPQQYPPQQYP------QQYPP 185 Query: 238 PPYSAQGYPPQYAPQYAQPPPPHHH 312 Y Q YPPQ P Q P P+ H Sbjct: 186 QQYPPQQYPPQQYPPPQQYPQPYPH 210 Score = 56.2 bits (134), Expect = 1e-06 Identities = 37/106 (34%), Positives = 43/106 (40%), Gaps = 14/106 (13%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY-----------PPPGYPPQGYPPQ 195 PP Y QQ P P PQ YPP+ Y + YPP Y PPP PQ P Q Sbjct: 194 PPQQYPPPQQYPQPYPHPQQYPPQQYPPQQYPPQQYPQQYYGQPYQQPPPPSVPQQQPQQ 253 Query: 196 G--YPPPGYP-PQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSN 324 PPP P PQ P S+ Q + PH +N S+ Sbjct: 254 SPLKPPPSKPLPQSQKPAGMSSPQLQKQPVATQSWQTEPHQNNQSS 299 [101][TOP] >UniRef100_Q0D318 Rhodopsin (Fragment) n=1 Tax=Bathyteuthis abyssicola RepID=Q0D318_9MOLL Length = 170 Score = 89.7 bits (221), Expect = 9e-17 Identities = 41/68 (60%), Positives = 42/68 (61%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M QQ PPQGYPP+GY PP GYPP GYPPQGYPPQGYPP G PPQG P Sbjct: 105 MQKMQAQQAAQPAYPPQGYPPQGYPP---PPQGYPPQGYPPQGYPPQGYPPQGAPPQGAP 161 Query: 235 PPPYSAQG 258 P QG Sbjct: 162 PAAAPPQG 169 Score = 87.8 bits (216), Expect = 3e-16 Identities = 39/57 (68%), Positives = 41/57 (71%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 YPP+GY +GYPPP P GYPPQGYPPQGYPP GYPPQG PP QG PP AP Sbjct: 118 YPPQGYPPQGYPPP---PQGYPPQGYPPQGYPPQGYPPQGAPP-----QGAPPAAAP 166 Score = 87.4 bits (215), Expect = 4e-16 Identities = 38/52 (73%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = +1 Query: 148 PGYPPPGYPPQGYPP--QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 P YPP GYPPQGYPP QGYPP GYPPQGYPP Y QG PPQ AP A PP Sbjct: 116 PAYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPPAAAPP 167 Score = 83.6 bits (205), Expect = 6e-15 Identities = 39/68 (57%), Positives = 40/68 (58%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q P PP Y Q PP PPQGYPP +GYPP GYPP GYPPQG PPQG P Sbjct: 111 QQAAQPAYPPQGYPPQGYPP----PPQGYPP-----QGYPPQGYPPQGYPPQGAPPQGAP 161 Query: 205 PPGYPPQG 228 P PPQG Sbjct: 162 PAAAPPQG 169 [102][TOP] >UniRef100_B3NGQ0 GG13988 n=1 Tax=Drosophila erecta RepID=B3NGQ0_DROER Length = 571 Score = 89.7 bits (221), Expect = 9e-17 Identities = 46/103 (44%), Positives = 56/103 (54%), Gaps = 12/103 (11%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 G + PP Y +Q P PPQGYPP+GY +GY + G+P GYP GYP PG Sbjct: 2 GFASAPPQQGYPRQGYPQQGYPPQGYPPQGYPPQGYQHTEFRQTGFPQPGYPQSGYPQPG 61 Query: 214 Y-----PPQG----YPPPPYSAQGYPPQY---APQYAQPPPPH 306 + PPQ YPPPP QG+PPQY P+Y P PP+ Sbjct: 62 HSWNPPPPQSGFSEYPPPP--QQGHPPQYYGAPPRYGSPHPPN 102 Score = 80.5 bits (197), Expect = 5e-14 Identities = 47/114 (41%), Positives = 53/114 (46%), Gaps = 35/114 (30%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGY---------------PPQGYPPPG----- 213 PP QGYP +GY ++GYPP GYPP GYPPQGY P GYP PG Sbjct: 7 PPQQGYPRQGYPQQGYPPQGYPPQGYPPQGYQHTEFRQTGFPQPGYPQSGYPQPGHSWNP 66 Query: 214 ---------YPP---QGYPPPPYSAQGYPPQYA---PQYAQPPPPHHHNNSNNS 330 YPP QG+PP Y G PP+Y P P P +NNS Sbjct: 67 PPPQSGFSEYPPPPQQGHPPQYY---GAPPRYGSPHPPNLPPNLPQQTTTANNS 117 [103][TOP] >UniRef100_A0CIX0 Chromosome undetermined scaffold_19, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CIX0_PARTE Length = 351 Score = 89.7 bits (221), Expect = 9e-17 Identities = 60/107 (56%), Positives = 62/107 (57%), Gaps = 16/107 (14%) Frame = +1 Query: 49 PPMSYY---NQQQPPVGTPPPQG-YPPEGYGKEGYPPPG-------YPPPG-YPPQG-YP 189 PP Y QQ PP G PPQG YPP+G YPPPG YPP G YPPQG YP Sbjct: 196 PPGQQYPPQGQQYPPQGQYPPQGQYPPQGQ----YPPPGQYPPQGQYPPQGQYPPQGQYP 251 Query: 190 PQG-YPPPG-YPPQG-YPPPPYSAQGYPPQYAPQYAQPPPPHHHNNS 321 PQG YPP G YPPQG YPP P Q YPPQ P YAQ PP N + Sbjct: 252 PQGQYPPQGQYPPQGQYPPQPNPGQ-YPPQ--PAYAQYPPQPPQNTT 295 Score = 77.8 bits (190), Expect = 4e-13 Identities = 53/103 (51%), Positives = 57/103 (55%), Gaps = 10/103 (9%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPG-YPPQG-YPPQG 198 H P P + Q PP P Q YPP+G + YPP G YPP G YPPQG YPP G Sbjct: 178 HTVQPPPPAQNLPYGQMPP----PGQQYPPQG---QQYPPQGQYPPQGQYPPQGQYPPPG 230 Query: 199 -YPPPG-YPPQGYPPP--PYSAQG-YPP--QYAPQYAQPPPPH 306 YPP G YPPQG PP Y QG YPP QY PQ PP P+ Sbjct: 231 QYPPQGQYPPQGQYPPQGQYPPQGQYPPQGQYPPQGQYPPQPN 273 Score = 60.8 bits (146), Expect = 4e-08 Identities = 50/114 (43%), Positives = 55/114 (48%), Gaps = 12/114 (10%) Frame = +1 Query: 49 PPMSYYNQ--QQPPVGTPPPQG-YPPEG-YGKEG-YPPPG-YPPPGYPPQGYPPQGYPPP 210 PP Y Q PP G PPQG YPP+G Y +G YPP G YPP G YPPQ P P Sbjct: 221 PPQGQYPPPGQYPPQGQYPPQGQYPPQGQYPPQGQYPPQGQYPPQGQ----YPPQ--PNP 274 Query: 211 GYPPQGYPPPPYSAQGYPPQYAPQYA------QPPPPHHHNNSNNSSSPGCLEG 354 G YPP P AQ YPPQ PQ Q PPP + + G + G Sbjct: 275 GQ----YPPQPAYAQ-YPPQ-PPQNTTVIIEQQAPPPAQKSGVSGGVVAGAMVG 322 [104][TOP] >UniRef100_Q1DWE3 Putative uncharacterized protein n=1 Tax=Coccidioides immitis RepID=Q1DWE3_COCIM Length = 442 Score = 89.7 bits (221), Expect = 9e-17 Identities = 55/116 (47%), Positives = 59/116 (50%), Gaps = 11/116 (9%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQ--QQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGY 201 + G P P Y Q QQPP PPP G PP+GY YPPP GYPPQGYPPQGY Sbjct: 8 YSGAPGYNPNPAYAQPGQQPPQ-QPPPHGAPPQGY----YPPP----QGYPPQGYPPQGY 58 Query: 202 PPPG-------YPPQG-YPPPPYSAQGYPPQYAP-QYAQPPPPHHHNNSNNSSSPG 342 PP G YPPQG YPPP GYP Q P Y+ PP + PG Sbjct: 59 PPQGQYPPPGQYPPQGQYPPPQQPGYGYPAQPPPGGYSIPPGAPGYGAPGQFPQPG 114 Score = 85.1 bits (209), Expect = 2e-15 Identities = 55/112 (49%), Positives = 58/112 (51%), Gaps = 17/112 (15%) Frame = +1 Query: 70 QQQPPVGTPP------PQGYPPEGYGKEGYPPPG-YPPPG-YPPQG-YPPQGYPPPGY-- 216 QQ PP G PP PQGYPP+GY +GYPP G YPPPG YPPQG YPP P GY Sbjct: 29 QQPPPHGAPPQGYYPPPQGYPPQGYPPQGYPPQGQYPPPGQYPPQGQYPPPQQPGYGYPA 88 Query: 217 --PPQGYPPPP----YSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEG 354 PP GY PP Y A G PQ P Y P P SPG + G Sbjct: 89 QPPPGGYSIPPGAPGYGAPGQFPQ--PGYGAPVAP-------TPPSPGYIPG 131 Score = 84.7 bits (208), Expect = 3e-15 Identities = 47/88 (53%), Positives = 48/88 (54%), Gaps = 8/88 (9%) Frame = +1 Query: 61 YYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGY--PPQGYPPQGYPPPGYPPQGYP 234 Y N P P P P + PP G PP GY PPQGYPPQGYPP GYPPQG Sbjct: 5 YQNYSGAPGYNPNPAYAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGYPPQGQY 64 Query: 235 PPP--YSAQG-YPPQYAPQY---AQPPP 300 PPP Y QG YPP P Y AQPPP Sbjct: 65 PPPGQYPPQGQYPPPQQPGYGYPAQPPP 92 Score = 62.0 bits (149), Expect = 2e-08 Identities = 39/85 (45%), Positives = 42/85 (49%), Gaps = 6/85 (7%) Frame = +1 Query: 49 PPMSYYNQQQPPVGT-PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP-PPGYP- 219 PP Y Q PP G PPP YPP+G YPPP P GYP Q PP GY PPG P Sbjct: 49 PPQGYPPQGYPPQGQYPPPGQYPPQGQ----YPPPQQPGYGYPAQP-PPGGYSIPPGAPG 103 Query: 220 ---PQGYPPPPYSAQGYPPQYAPQY 285 P +P P Y A P +P Y Sbjct: 104 YGAPGQFPQPGYGAPVAPTPPSPGY 128 [105][TOP] >UniRef100_UPI0001760AB9 PREDICTED: similar to UPF0467 protein C5orf32 homolog n=1 Tax=Danio rerio RepID=UPI0001760AB9 Length = 107 Score = 89.0 bits (219), Expect = 2e-16 Identities = 50/106 (47%), Positives = 53/106 (50%), Gaps = 21/106 (19%) Frame = +1 Query: 145 PPGY----PPPGYPPQGYPPQGYPPPGYPPQGYPP-PPYSAQGYPPQYAPQ-YAQPPP-- 300 PP Y P P YPPQGYPPQG+PP GYP QGYP PP + YP Q Q Y QP P Sbjct: 6 PPAYMGPGPAPVYPPQGYPPQGHPPQGYPQQGYPNYPPGPSGPYPVQPGYQGYPQPQPGP 65 Query: 301 -------------PHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 HHH +S CL C ALC CCL D CF Sbjct: 66 PTNTVLVVEQNRRDHHH----HSGEKACLATCWTALCFCCLCDMCF 107 [106][TOP] >UniRef100_Q6QE83 Rhodopsin (Fragment) n=1 Tax=Sthenoteuthis oualaniensis RepID=Q6QE83_9MOLL Length = 295 Score = 89.0 bits (219), Expect = 2e-16 Identities = 45/84 (53%), Positives = 47/84 (55%), Gaps = 2/84 (2%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M QQ PPPQGYPP P GYPPQGYPPQGYPP GYPPQGYP Sbjct: 226 MQKMQAQQAAYPPPPPQGYPP--------------PQGYPPQGYPPQGYPPQGYPPQGYP 271 Query: 235 PPPYSAQGYPPQ--YAPQYAQPPP 300 PPP QG PP + P+ A P P Sbjct: 272 PPP---QGPPPAGWHPPRQAGPTP 292 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/62 (53%), Positives = 37/62 (59%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q +P PP Y PP PPQGYPP+GY +GYPP GYPP PPQG PP G+ Sbjct: 232 QQAAYPPPPPQGY-----PPPQGYPPQGYPPQGYPPQGYPPQGYPP---PPQGPPPAGWH 283 Query: 205 PP 210 PP Sbjct: 284 PP 285 Score = 71.6 bits (174), Expect = 3e-11 Identities = 36/64 (56%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +1 Query: 154 YPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ-YAPQYAQPPPPHHHNNSNNS 330 YPPP PPQGYPP P GYPPQGYPP Y QGYPPQ Y P PPP H Sbjct: 236 YPPP--PPQGYPP----PQGYPPQGYPPQGYPPQGYPPQGYPPPPQGPPPAGWHPPRQAG 289 Query: 331 SSPG 342 +PG Sbjct: 290 PTPG 293 [107][TOP] >UniRef100_Q0D322 Rhodopsin (Fragment) n=1 Tax=Histioteuthis oceanica RepID=Q0D322_9MOLL Length = 299 Score = 89.0 bits (219), Expect = 2e-16 Identities = 38/58 (65%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPP--GYPPPGYPPQGYPPQGYPPPGYPPQGYPP 237 Q Q PP QGYPP+GY +GYPPP GYPP GYPPQGYPPQG PP G PP PP Sbjct: 239 QAQQAAYPPPQQGYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGAPPQGAPPTAAPP 296 Score = 87.8 bits (216), Expect = 3e-16 Identities = 44/76 (57%), Positives = 45/76 (59%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 QQ PPPQ +GYPP GYPP GYPP PPQGYPP GYPPQGYPP Sbjct: 238 QQAQQAAYPPPQ---------QGYPPQGYPPQGYPP---PPQGYPPQGYPPQGYPP---- 281 Query: 250 AQGYPPQYAPQYAQPP 297 QG PPQ AP A PP Sbjct: 282 -QGAPPQGAPPTAAPP 296 Score = 79.0 bits (193), Expect = 2e-13 Identities = 34/52 (65%), Positives = 36/52 (69%), Gaps = 2/52 (3%) Frame = +1 Query: 79 PPVGTPPPQGYPPEGYGK--EGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP PPQGYPP+GY +GYPP GYPP GYPPQG PPQG PP PP G Sbjct: 247 PPQQGYPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGAPPQGAPPTAAPPTG 298 [108][TOP] >UniRef100_Q0D312 Rhodopsin (Fragment) n=1 Tax=Todaropsis eblanae RepID=Q0D312_9MOLL Length = 300 Score = 89.0 bits (219), Expect = 2e-16 Identities = 42/63 (66%), Positives = 44/63 (69%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYA 288 YPP+GY + PP PP GYPPQGYPPQGYP GYPPQGYPPP QG PPQ AP A Sbjct: 248 YPPQGYAQ----PP--PPQGYPPQGYPPQGYPQQGYPPQGYPPP----QGAPPQGAPPAA 297 Query: 289 QPP 297 PP Sbjct: 298 APP 300 Score = 77.4 bits (189), Expect = 5e-13 Identities = 38/63 (60%), Positives = 40/63 (63%), Gaps = 7/63 (11%) Frame = +1 Query: 55 MSYYNQQQ---PPVG---TPPPQGYPPEGYGKEGYPPPGYPPPGY-PPQGYPPQGYPPPG 213 M QQQ PP G PPPQGYPP+GY +GYP GYPP GY PPQG PPQG PP Sbjct: 238 MQKMQQQQAAYPPQGYAQPPPPQGYPPQGYPPQGYPQQGYPPQGYPPPQGAPPQGAPPAA 297 Query: 214 YPP 222 PP Sbjct: 298 APP 300 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +1 Query: 184 YPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 YPPQGY P PPQGYPP Y QGYP Q P PPP Sbjct: 248 YPPQGYAQPP-PPQGYPPQGYPPQGYPQQGYPPQGYPPP 285 [109][TOP] >UniRef100_C5PBW6 XYPPX repeat family protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5PBW6_COCP7 Length = 442 Score = 89.0 bits (219), Expect = 2e-16 Identities = 53/101 (52%), Positives = 55/101 (54%), Gaps = 10/101 (9%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQ--QQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGY 201 + G P P Y Q QQPP PPP G PP+GY YPPP GYPPQGYPPQGY Sbjct: 8 YSGAPGYNPNPAYAQPGQQPPQ-QPPPHGAPPQGY----YPPP----QGYPPQGYPPQGY 58 Query: 202 PPPG-------YPPQG-YPPPPYSAQGYPPQYAPQYAQPPP 300 PP G YPPQG YPPP GYP AQPPP Sbjct: 59 PPQGQYPPPGQYPPQGQYPPPQQPGYGYP-------AQPPP 92 Score = 85.5 bits (210), Expect = 2e-15 Identities = 47/92 (51%), Positives = 49/92 (53%), Gaps = 7/92 (7%) Frame = +1 Query: 61 YYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGY--PPQGYPPQGYPPPGYPPQGYP 234 Y N P P P P + PP G PP GY PPQGYPPQGYPP GYPPQG Sbjct: 5 YQNYSGAPGYNPNPAYAQPGQQPPQQPPPHGAPPQGYYPPPQGYPPQGYPPQGYPPQGQY 64 Query: 235 PPP--YSAQG-YPPQYAPQYAQP--PPPHHHN 315 PPP Y QG YPP P Y P PPP +N Sbjct: 65 PPPGQYPPQGQYPPPQQPGYGYPAQPPPGGYN 96 Score = 64.7 bits (156), Expect = 3e-09 Identities = 44/103 (42%), Positives = 45/103 (43%), Gaps = 1/103 (0%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPGYPPQGYPPQGYPPPGYPPQ 225 PP Y Q PP G PP YPP G YPP G YPPP P GYP Q PPPG Sbjct: 44 PPQGYPPQGYPPQGYPPQGQYPPPGQ----YPPQGQYPPPQQPGYGYPAQ--PPPGGYNI 97 Query: 226 GYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEG 354 P Y A G PQ P Y P P SPG + G Sbjct: 98 PLGAPGYGAPGQFPQ--PGYGAPVAP-------TPPSPGYIPG 131 [110][TOP] >UniRef100_P24639-2 Isoform Short of Annexin A7 n=1 Tax=Dictyostelium discoideum RepID=P24639-2 Length = 419 Score = 89.0 bits (219), Expect = 2e-16 Identities = 56/93 (60%), Positives = 58/93 (62%), Gaps = 10/93 (10%) Frame = +1 Query: 49 PPMSYYNQQQ---PPVGTPPPQGYPPEGYGKEGYPPP-GYPPP-GYPPQ-GYPPQ-GYPP 207 PP Y QQ P G PP QGYPP+ +GYPP GYPP GYPPQ GYPPQ GYPP Sbjct: 4 PPNQGYPPQQGYPPQQGYPPQQGYPPQ----QGYPPQQGYPPQQGYPPQQGYPPQQGYPP 59 Query: 208 P-GYPPQ-GYPPPPYSAQGYPPQ-YAPQYAQPP 297 GYPPQ GYPP QGYPPQ Y PQ PP Sbjct: 60 QQGYPPQQGYPPQ----QGYPPQGYPPQQGYPP 88 Score = 82.4 bits (202), Expect = 1e-14 Identities = 53/97 (54%), Positives = 60/97 (61%), Gaps = 13/97 (13%) Frame = +1 Query: 28 HRGHPTT---PPMSYYNQQQ---PPVGTPPPQGYPPE-GYG-KEGYPPP-GYPPP-GYPP 177 ++G+P PP Y QQ P G PP QGYPP+ GY ++GYPP GYPP GYPP Sbjct: 6 NQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPP 65 Query: 178 Q-GYPPQ-GYPPPGYPP-QGYPPPPYSAQGYPPQYAP 279 Q GYPPQ GYPP GYPP QGYPP G P +AP Sbjct: 66 QQGYPPQQGYPPQGYPPQQGYPPVGVPV-GVPVGFAP 101 Score = 61.2 bits (147), Expect = 3e-08 Identities = 37/55 (67%), Positives = 37/55 (67%), Gaps = 7/55 (12%) Frame = +1 Query: 154 YPP-PGYPPQ-GYPPQ-GYPPP-GYPPQ-GYPPPPYSAQGYPPQ--YAPQYAQPP 297 YPP GYPPQ GYPPQ GYPP GYPPQ GYPP QGYPPQ Y PQ PP Sbjct: 3 YPPNQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQ----QGYPPQQGYPPQQGYPP 53 [111][TOP] >UniRef100_B8LFI0 Glycine and proline-rich protein n=1 Tax=Ipomoea batatas RepID=B8LFI0_IPOBA Length = 185 Score = 88.6 bits (218), Expect = 2e-16 Identities = 43/78 (55%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Frame = +1 Query: 4 RGKASN*QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP-Q 180 +G S+ H H PP Y PP G PP QGYPP G GYPP YPP GYPP Q Sbjct: 13 KGLFSHLGHHAHQGYPPQGY-----PPQGYPPQQGYPPAG---AGYPPQAYPPSGYPPQQ 64 Query: 181 GYPPQGYPPPGYPPQGYP 234 GYPPQ YPP GYP Q +P Sbjct: 65 GYPPQAYPPAGYPGQPHP 82 Score = 80.9 bits (198), Expect = 4e-14 Identities = 39/68 (57%), Positives = 42/68 (61%), Gaps = 4/68 (5%) Frame = +1 Query: 151 GYPPPGYPPQGYPP-QGYPP--PGYPPQGYPPPPY-SAQGYPPQYAPQYAQPPPPHHHNN 318 GYPP GYPPQGYPP QGYPP GYPPQ YPP Y QGYPPQ P P PH + Sbjct: 26 GYPPQGYPPQGYPPQQGYPPAGAGYPPQAYPPSGYPPQQGYPPQAYPPAGYPGQPHPSAS 85 Query: 319 SNNSSSPG 342 ++ PG Sbjct: 86 HHSGHGPG 93 Score = 64.7 bits (156), Expect = 3e-09 Identities = 36/80 (45%), Positives = 39/80 (48%), Gaps = 17/80 (21%) Frame = +1 Query: 178 QGYPPQGYPPPGYPPQ--------GYPPPPYSAQGYPPQ--YAPQY-------AQPPPPH 306 QGYPPQGYPP GYPPQ GYPP Y GYPPQ Y PQ QP P Sbjct: 25 QGYPPQGYPPQGYPPQQGYPPAGAGYPPQAYPPSGYPPQQGYPPQAYPPAGYPGQPHPSA 84 Query: 307 HHNNSNNSSSPGCLEGCCAA 366 H++ + L G AA Sbjct: 85 SHHSGHGPGMGAMLAGGAAA 104 [112][TOP] >UniRef100_Q3BDN9 Rhodopsin (Fragment) n=1 Tax=Loliolus sp. JMS-2004 RepID=Q3BDN9_9MOLL Length = 297 Score = 88.6 bits (218), Expect = 2e-16 Identities = 39/61 (63%), Positives = 40/61 (65%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M QQ PPQGYPP+GY PP GYPP GYPPQGYPPQGYPP G PPQG P Sbjct: 237 MQKMQAQQQQQAAYPPQGYPPQGYPPP--PPQGYPPQGYPPQGYPPQGYPPQGAPPQGAP 294 Query: 235 P 237 P Sbjct: 295 P 295 Score = 86.3 bits (212), Expect = 1e-15 Identities = 41/60 (68%), Positives = 42/60 (70%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYA 288 YPP+GY PP GYPPP PPQGYPPQGYPP GYPPQGYPP QG PPQ AP A Sbjct: 250 YPPQGY-----PPQGYPPP--PPQGYPPQGYPPQGYPPQGYPP-----QGAPPQGAPPQA 297 Score = 79.7 bits (195), Expect = 9e-14 Identities = 34/46 (73%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = +1 Query: 169 YPPQGYPPQGYPPP---GYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 YPPQGYPPQGYPPP GYPPQGYPP Y QGYPPQ AP PP Sbjct: 250 YPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPP 295 Score = 75.5 bits (184), Expect = 2e-12 Identities = 33/57 (57%), Positives = 36/57 (63%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 Q + PP Y Q PP PPPQGYPP+GY +GYPP GYPP G PPQG PPQ Sbjct: 243 QQQQQAAYPPQGYPPQGYPP---PPPQGYPPQGYPPQGYPPQGYPPQGAPPQGAPPQ 296 [113][TOP] >UniRef100_Q0D320 Rhodopsin (Fragment) n=1 Tax=Enoploteuthis higginsi RepID=Q0D320_9MOLL Length = 134 Score = 88.6 bits (218), Expect = 2e-16 Identities = 38/56 (67%), Positives = 39/56 (69%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP 237 QQ PPPQGYPP+GY PP GYPP GYPPQGYPPQGYPP G PP G PP Sbjct: 78 QQAQQPAYPPPQGYPPQGYPP---PPQGYPPQGYPPQGYPPQGYPPQGAPPAGAPP 130 Score = 80.9 bits (198), Expect = 4e-14 Identities = 37/52 (71%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = +1 Query: 148 PGYPPP-GYPPQGYPP--QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQP 294 P YPPP GYPPQGYPP QGYPP GYPPQGYPP Y QG PP AP A P Sbjct: 83 PAYPPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPPQGAPPAGAPPAAAP 134 Score = 72.4 bits (176), Expect = 1e-11 Identities = 36/70 (51%), Positives = 37/70 (52%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q P PP Y Q P PPPQGYPP+ GYPP GYPPQGYPPQG P Sbjct: 78 QQAQQPAYPPPQGYPPQGYP---PPPQGYPPQ----------GYPPQGYPPQGYPPQGAP 124 Query: 205 PPGYPPQGYP 234 P G PP P Sbjct: 125 PAGAPPAAAP 134 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 3/36 (8%) Frame = +1 Query: 199 YPPP-GYPPQGYPPPP--YSAQGYPPQYAPQYAQPP 297 YPPP GYPPQGYPPPP Y QGYPPQ P PP Sbjct: 85 YPPPQGYPPQGYPPPPQGYPPQGYPPQGYPPQGYPP 120 [114][TOP] >UniRef100_C4JXG7 Predicted protein n=1 Tax=Uncinocarpus reesii 1704 RepID=C4JXG7_UNCRE Length = 451 Score = 88.6 bits (218), Expect = 2e-16 Identities = 56/93 (60%), Positives = 60/93 (64%), Gaps = 9/93 (9%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY--PPEGYGKEG-YPPPG-YPPPG-YPPQG-YPPQGYPP- 207 PP + QQ P G PP QGY PP+GY +G YPP G YPPPG YPPQG YPPQGYPP Sbjct: 27 PPPQQHPQQ--PYGAPP-QGYYPPPQGYPPQGQYPPQGQYPPPGQYPPQGQYPPQGYPPQ 83 Query: 208 -PGYPPQGYPP-PPYSAQGYPPQYAPQYAQPPP 300 PGY GYPP PP + G PP AP Y PPP Sbjct: 84 QPGY---GYPPQPPPAGYGMPPG-APGYGAPPP 112 Score = 85.9 bits (211), Expect = 1e-15 Identities = 55/108 (50%), Positives = 58/108 (53%), Gaps = 5/108 (4%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY--PPPGYPPQG-YPPQG-Y 201 G P P Y Q P PPPQ +P + YG PP GY PP GYPPQG YPPQG Y Sbjct: 10 GAPPYDPNLAYAQ---PGQHPPPQQHPQQPYGA---PPQGYYPPPQGYPPQGQYPPQGQY 63 Query: 202 PPPG-YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 PPPG YPPQG PP QGYPPQ P Y PP P +PG Sbjct: 64 PPPGQYPPQGQYPP----QGYPPQ-QPGYGYPPQPPPAGYGMPPGAPG 106 Score = 74.7 bits (182), Expect = 3e-12 Identities = 53/110 (48%), Positives = 54/110 (49%), Gaps = 17/110 (15%) Frame = +1 Query: 25 QHRGHPT-TPPMSYYNQQQ--PPVGTPPPQG-------YPPEGYGKEGYPPPGYPPP--- 165 QH P PP YY Q PP G PPQG YPP+G YPP GYPP Sbjct: 31 QHPQQPYGAPPQGYYPPPQGYPPQGQYPPQGQYPPPGQYPPQGQ----YPPQGYPPQQPG 86 Query: 166 -GYPPQGYPPQGY-PPPGYPPQGYPPP-PYSAQ-GYPPQYAPQYAQPPPP 303 GYPPQ PP GY PPG P G PPP Y Q G P AP A PP P Sbjct: 87 YGYPPQP-PPAGYGMPPGAPGYGAPPPGQYPGQFGQPGYGAPVAAAPPSP 135 Score = 59.3 bits (142), Expect = 1e-07 Identities = 38/82 (46%), Positives = 41/82 (50%), Gaps = 9/82 (10%) Frame = +1 Query: 49 PPMSYYNQ--QQPPVGTPPPQGYPPE--GYGKEGYPPP-GYP-PPGYPPQGYPPQGYPPP 210 PP Y Q PP G PPQGYPP+ GYG PPP GY PPG P G PP G P Sbjct: 58 PPQGQYPPPGQYPPQGQYPPQGYPPQQPGYGYPPQPPPAGYGMPPGAPGYGAPPPGQYPG 117 Query: 211 GYPPQGYPPPPYSA---QGYPP 267 + GY P +A GY P Sbjct: 118 QFGQPGYGAPVAAAPPSPGYVP 139 [115][TOP] >UniRef100_A5JVC8 Putative uncharacterized protein n=1 Tax=Brassica rapa RepID=A5JVC8_BRACM Length = 116 Score = 88.2 bits (217), Expect = 3e-16 Identities = 52/119 (43%), Positives = 59/119 (49%), Gaps = 18/119 (15%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY----PPPGYPPQGYPPQGYPPP---G 213 MSY ++ PP PPP GY + YPPPGY PPPGYPP + +GYPPP G Sbjct: 1 MSY--EKVPPESYPPPPGY------QSHYPPPGYPSAPPPPGYPPPHH--EGYPPPQPHG 50 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPP-----------HHHNNSNNSSSPGCLEGC 357 YPP YPPP GY +A Y PPPP HHH +NS L GC Sbjct: 51 YPP--YPPPRPYEGGYQGYFAGNYPPPPPPPPQQCNHYQHDHHHYQDSNSDGSSFLRGC 107 [116][TOP] >UniRef100_B4LEQ7 GJ11716 n=1 Tax=Drosophila virilis RepID=B4LEQ7_DROVI Length = 562 Score = 88.2 bits (217), Expect = 3e-16 Identities = 43/80 (53%), Positives = 49/80 (61%), Gaps = 7/80 (8%) Frame = +1 Query: 94 PPPQGYP--PEGYGKEGYPPPGYPPPGYPPQGYPPQ-GYPPPGYPPQGYPPPPYSAQGYP 264 PP G+ P G G + YPP GYP GYPPQGYPPQ YP PGYPPQ Y PPP + P Sbjct: 10 PPSYGFTSAPPG-GSQNYPPQGYPQHGYPPQGYPPQTSYPQPGYPPQNYVPPPQNFGAPP 68 Query: 265 PQY----APQYAQPPPPHHH 312 PQ+ PQ PPPP ++ Sbjct: 69 PQHYGSPPPQNFGPPPPQNY 88 Score = 71.2 bits (173), Expect = 3e-11 Identities = 46/114 (40%), Positives = 54/114 (47%), Gaps = 13/114 (11%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP----PPQGYPPEGYGKEGYPPPGYPPPGY--PPQGY--- 186 G + PP +Q PP G P PPQGYPP+ YP PGYPP Y PPQ + Sbjct: 14 GFTSAPPGG--SQNYPPQGYPQHGYPPQGYPPQ----TSYPQPGYPPQNYVPPPQNFGAP 67 Query: 187 PPQGYPPPGYPPQGYPPPPYSAQGYPPQY----APQYAQPPPPHHHNNSNNSSS 336 PPQ Y P PPQ + PPP G PP +P QP ++ N N S Sbjct: 68 PPQHYGSP--PPQNFGPPPPQNYGPPPTQPLPSSPIVVQPTGWYNRNQKNKPQS 119 Score = 70.1 bits (170), Expect = 7e-11 Identities = 35/69 (50%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = +1 Query: 115 PEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQ-GYPPPPYSAQGYPPQYAPQYAQ 291 P YG PP G YPPQGYP GYPP GYPPQ YP P Y Q Y P PQ Sbjct: 10 PPSYGFTSAPPGG--SQNYPPQGYPQHGYPPQGYPPQTSYPQPGYPPQNYVP--PPQNFG 65 Query: 292 PPPPHHHNN 318 PPP H+ + Sbjct: 66 APPPQHYGS 74 [117][TOP] >UniRef100_Q0D323 Rhodopsin (Fragment) n=1 Tax=Architeuthis sp. JMS-2004 RepID=Q0D323_9MOLL Length = 137 Score = 87.8 bits (216), Expect = 3e-16 Identities = 41/61 (67%), Positives = 42/61 (68%), Gaps = 3/61 (4%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP-GYPPQGYPPQGYPPPGYPPQGYPP--P 240 QQ PPP GYPP +GYPP GYPPP GYPPQGYPPQGYPP G PPQG PP P Sbjct: 78 QQAQQPAYPPPAGYPPP----QGYPPQGYPPPQGYPPQGYPPQGYPPQGAPPQGAPPAAP 133 Query: 241 P 243 P Sbjct: 134 P 134 Score = 82.4 bits (202), Expect = 1e-14 Identities = 41/55 (74%), Positives = 41/55 (74%), Gaps = 3/55 (5%) Frame = +1 Query: 139 YPPP-GYPPP-GYPPQGYPP-QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQP 294 YPPP GYPPP GYPPQGYPP QGYPP GYPPQGYPP QG PPQ AP A P Sbjct: 85 YPPPAGYPPPQGYPPQGYPPPQGYPPQGYPPQGYPP-----QGAPPQGAPPAAPP 134 Score = 75.9 bits (185), Expect = 1e-12 Identities = 38/56 (67%), Positives = 38/56 (67%), Gaps = 4/56 (7%) Frame = +1 Query: 148 PGYPPP-GYPP-QGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP--PP 303 P YPPP GYPP QGYPPQGYPPP QGYPP Y QGYPPQ AP PP PP Sbjct: 83 PAYPPPAGYPPPQGYPPQGYPPP----QGYPPQGYPPQGYPPQGAPPQGAPPAAPP 134 Score = 71.2 bits (173), Expect = 3e-11 Identities = 37/70 (52%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQ--PPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG 198 Q P PP + Y Q PP G PPPQGYPP+ GYPP GYPPQG PPQG Sbjct: 78 QQAQQPAYPPPAGYPPPQGYPPQGYPPPQGYPPQ----------GYPPQGYPPQGAPPQG 127 Query: 199 YPPPGYPPQG 228 PP PPQG Sbjct: 128 -APPAAPPQG 136 [118][TOP] >UniRef100_B4YS96 Rhodopsin (Fragment) n=1 Tax=Alloteuthis subulata RepID=B4YS96_LOLSU Length = 299 Score = 87.8 bits (216), Expect = 3e-16 Identities = 46/76 (60%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP-GYPPQGY 231 M QQQP YPP+ +GYPP GYPPP PPQGYPPQGYPPP GYPPQGY Sbjct: 240 MQAQQQQQP--------AYPPQ----QGYPPQGYPPP--PPQGYPPQGYPPPQGYPPQGY 285 Query: 232 PPPPYSAQGYPPQYAP 279 PPP QG PPQ P Sbjct: 286 PPP----QGPPPQGPP 297 Score = 83.2 bits (204), Expect = 8e-15 Identities = 40/58 (68%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP-QGYPPQGYPPP-GYPPQGYPP 237 QQQ PP QGYPP+GY PP GYPP GYPP QGYPPQGYPPP G PPQG PP Sbjct: 243 QQQQQPAYPPQQGYPPQGYPPP--PPQGYPPQGYPPPQGYPPQGYPPPQGPPPQGPPP 298 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 +G+P PP Y PP G PPPQGYPP+GY PP G PPQG PPQ Sbjct: 259 QGYPPPPPQGY-----PPQGYPPPQGYPPQGYP---------PPQGPPPQGPPPQ 299 [119][TOP] >UniRef100_UPI0001A2C6AC UPI0001A2C6AC related cluster n=1 Tax=Danio rerio RepID=UPI0001A2C6AC Length = 98 Score = 87.4 bits (215), Expect = 4e-16 Identities = 48/101 (47%), Positives = 50/101 (49%), Gaps = 15/101 (14%) Frame = +1 Query: 142 PPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYA--PQYAQPPPP---- 303 P P YPP GYPPQG+PPQGYP GYP YPP P P Y PQ QP PP Sbjct: 5 PAPVYPPQGYPPQGHPPQGYPQQGYP--NYPPGPSGPYPVQPGYQGYPQ-PQPGPPTNTV 61 Query: 304 ---------HHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 HHH +S CL C ALC CCL D CF Sbjct: 62 LVVEQNRRDHHH----HSGEKACLATCWTALCFCCLCDMCF 98 [120][TOP] >UniRef100_B0EHK2 Putative uncharacterized protein n=1 Tax=Entamoeba dispar SAW760 RepID=B0EHK2_ENTDI Length = 279 Score = 87.0 bits (214), Expect = 6e-16 Identities = 53/109 (48%), Positives = 55/109 (50%), Gaps = 25/109 (22%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEG-YGKEGYPP------PGYPP-------PGYPPQ-- 180 PP Y Q P PP QGYPP+G Y + GYPP PGYPP PGYPPQ Sbjct: 157 PPQQGYGQ---PGAYPPQQGYPPQGGYPQPGYPPQQPGAYPGYPPQQGGYPQPGYPPQQG 213 Query: 181 -----GYPPQG-YPPPGYPPQ---GYPPPPYSAQGYPPQYAPQYAQPPP 300 YPPQG YP PGYPPQ YP P GYPPQ Y PP Sbjct: 214 YGQPGAYPPQGGYPQPGYPPQQPGAYPGYPPQQGGYPPQQPGAYPGYPP 262 Score = 72.4 bits (176), Expect = 1e-11 Identities = 46/94 (48%), Positives = 51/94 (54%), Gaps = 6/94 (6%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPE-GYGKEGYPPP--GYPPPGYPPQGYPPQGYP 204 G+P P +Y G P P GYPP+ GYG+ G PP GYP PGYPPQ P Y Sbjct: 184 GYPPQQPGAYPGYPPQQGGYPQP-GYPPQQGYGQPGAYPPQGGYPQPGYPPQ--QPGAY- 239 Query: 205 PPGYPPQ--GYPP-PPYSAQGYPPQYAPQYAQPP 297 PGYPPQ GYPP P + GYPPQ Y P Sbjct: 240 -PGYPPQQGGYPPQQPGAYPGYPPQQPGAYPGYP 272 Score = 54.7 bits (130), Expect = 3e-06 Identities = 34/59 (57%), Positives = 35/59 (59%), Gaps = 6/59 (10%) Frame = +1 Query: 139 YPPP-GYPPPG-YPPQ-GYPPQGYPPPGYPPQGYPP-PPYSAQGYPPQYA--PQYAQPP 297 YPP GY PG YPPQ GYPPQG GYP GYPP P + GYPPQ PQ PP Sbjct: 156 YPPQQGYGQPGAYPPQQGYPPQG----GYPQPGYPPQQPGAYPGYPPQQGGYPQPGYPP 210 [121][TOP] >UniRef100_C8XIP8 Membrane-flanked domain protein n=1 Tax=Nakamurella multipartita DSM 44233 RepID=C8XIP8_9ACTO Length = 479 Score = 86.7 bits (213), Expect = 8e-16 Identities = 51/114 (44%), Positives = 58/114 (50%), Gaps = 12/114 (10%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKE---GYPP---PGYPPPGYPPQGYPPQG 198 HP T P Y PP G P QGYPP G + G+ P PGYPP GY GYPP G Sbjct: 245 HPQTGPTQGY----PPPGQP--QGYPPPGPTQSYPAGHQPTQSPGYPPSGYATGGYPPNG 298 Query: 199 YPPPGYPPQGYPPPPY-----SAQGYPPQYAP-QYAQPPPPHHHNNSNNSSSPG 342 Y PGY P GY P Y ++ GYPP AP Y+QP PP + + S G Sbjct: 299 YQQPGYAPNGYQQPGYQQPGHASGGYPPPAAPANYSQPGPPQPGYSQSGYSQAG 352 Score = 58.5 bits (140), Expect = 2e-07 Identities = 37/106 (34%), Positives = 43/106 (40%), Gaps = 21/106 (19%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-----YPPP---------GYPP 177 P PP Y PP G P GY P GY + GY PG YPPP G P Sbjct: 282 PGYPPSGYATGGYPPNGYQQP-GYAPNGYQQPGYQQPGHASGGYPPPAAPANYSQPGPPQ 340 Query: 178 QGYPPQGYPPPGY-------PPQGYPPPPYSAQGYPPQYAPQYAQP 294 GY GY GY P +G PP++ P + P A+P Sbjct: 341 PGYSQSGYSQAGYAQPGSSQPAEGQAAPPFTPAAGPGEQPPASAEP 386 [122][TOP] >UniRef100_Q6QE96 Rhodopsin (Fragment) n=1 Tax=Octopus bimaculoides RepID=Q6QE96_OCTBM Length = 294 Score = 86.3 bits (212), Expect = 1e-15 Identities = 41/63 (65%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPGYPPQG-YPPQGYPPPGYPPQG 228 M QQ PPPQGYPP+GY PP G YPP GYPPQG YPPQGYPP GYPPQG Sbjct: 237 MQKMQAQQAAYQQPPPQGYPPQGY-----PPQGAYPPQGYPPQGAYPPQGYPPQGYPPQG 291 Query: 229 YPP 237 PP Sbjct: 292 APP 294 Score = 79.0 bits (193), Expect = 2e-13 Identities = 37/48 (77%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = +1 Query: 142 PPPGYPPPGYPPQG-YPPQGYPPPG-YPPQGYPPPPYSAQGYPPQYAP 279 PP GYPP GYPPQG YPPQGYPP G YPPQGYPP QGYPPQ AP Sbjct: 251 PPQGYPPQGYPPQGAYPPQGYPPQGAYPPQGYPP-----QGYPPQGAP 293 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/61 (52%), Positives = 34/61 (55%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q + PP Y Q PP G PPQGYPP+G YPP GYPPQGYPPQG P Sbjct: 243 QQAAYQQPPPQGYPPQGYPPQGAYPPQGYPPQG---------AYPPQGYPPQGYPPQGAP 293 Query: 205 P 207 P Sbjct: 294 P 294 [123][TOP] >UniRef100_Q3BDN8 Rhodopsin (Fragment) n=1 Tax=Rossia pacifica RepID=Q3BDN8_ROSPA Length = 305 Score = 86.3 bits (212), Expect = 1e-15 Identities = 41/63 (65%), Positives = 43/63 (68%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYA 288 YPP+GY +GYPPP P GYPPQGYPPQG YPPQGYPPP QG PPQ AP A Sbjct: 251 YPPQGYPPQGYPPP---PQGYPPQGYPPQG----AYPPQGYPPP----QGAPPQGAPPQA 299 Query: 289 QPP 297 PP Sbjct: 300 APP 302 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/65 (56%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEG-YPPPGYPPP-GYPPQGYPPQG 198 Q P PP Y Q PP PPQGYPP+GY +G YPP GYPPP G PPQG PPQ Sbjct: 244 QQAQQPAYPPQGYPPQGYPP----PPQGYPPQGYPPQGAYPPQGYPPPQGAPPQGAPPQA 299 Query: 199 YPPPG 213 PP G Sbjct: 300 APPEG 304 Score = 73.9 bits (180), Expect = 5e-12 Identities = 35/49 (71%), Positives = 35/49 (71%), Gaps = 4/49 (8%) Frame = +1 Query: 163 PGYPPQGYPPQGYPPP--GYPPQGYPPP-PYSAQGY-PPQYAPQYAQPP 297 P YPPQGYPPQGYPPP GYPPQGYPP Y QGY PPQ AP PP Sbjct: 249 PAYPPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPPPQGAPPQGAPP 297 [124][TOP] >UniRef100_Q3BDN5 Rhodopsin (Fragment) n=1 Tax=Sepia pharaonis RepID=Q3BDN5_SEPPH Length = 302 Score = 86.3 bits (212), Expect = 1e-15 Identities = 43/65 (66%), Positives = 44/65 (67%), Gaps = 4/65 (6%) Frame = +1 Query: 55 MSYYNQQQ---PPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP-GYPP 222 M QQQ PP G PPPQGYPP+GY PP GYPPP PPQGYPPQGYPPP G PP Sbjct: 240 MQKMQQQQAAYPPQGYPPPQGYPPQGYPP---PPQGYPPP--PPQGYPPQGYPPPQGAPP 294 Query: 223 QGYPP 237 Q PP Sbjct: 295 QAAPP 299 Score = 84.3 bits (207), Expect = 4e-15 Identities = 43/75 (57%), Positives = 46/75 (61%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 M+ + Q PPQGYPP +GYPP GYPPP PQGYPP PP GYPPQGYP Sbjct: 237 MAMMQKMQQQQAAYPPQGYPPP----QGYPPQGYPPP---PQGYPPP--PPQGYPPQGYP 287 Query: 235 PPPYSAQGYPPQYAP 279 PP QG PPQ AP Sbjct: 288 PP----QGAPPQAAP 298 Score = 70.5 bits (171), Expect = 6e-11 Identities = 36/50 (72%), Positives = 36/50 (72%), Gaps = 7/50 (14%) Frame = +1 Query: 169 YPPQGYPP-QGYPPPGY--PPQGYPPPP---YSAQGY-PPQYAPQYAQPP 297 YPPQGYPP QGYPP GY PPQGYPPPP Y QGY PPQ AP A PP Sbjct: 250 YPPQGYPPPQGYPPQGYPPPPQGYPPPPPQGYPPQGYPPPQGAPPQAAPP 299 [125][TOP] >UniRef100_Q0D330 Rhodopsin (Fragment) n=1 Tax=Sepioloidea lineolata RepID=Q0D330_9MOLL Length = 146 Score = 86.3 bits (212), Expect = 1e-15 Identities = 48/81 (59%), Positives = 49/81 (60%), Gaps = 7/81 (8%) Frame = +1 Query: 55 MSYYNQQQ---PPVGTPPPQGYPPEGYGKEGYPPP--GYPPPGYPPQ--GYPPQGYPPPG 213 M QQQ PP G PPQGYPP + GYPPP GYPP GYPP GYPPQGYPP G Sbjct: 74 MQKMQQQQAAYPPQGAYPPQGYPPP---QAGYPPPQGGYPPQGYPPPQGGYPPQGYPPQG 130 Query: 214 YPPQGYPPPPYSAQGYPPQYA 276 PPQG PP Q PPQ A Sbjct: 131 PPPQGPPP-----QXAPPQGA 146 Score = 85.1 bits (209), Expect = 2e-15 Identities = 42/63 (66%), Positives = 43/63 (68%), Gaps = 6/63 (9%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPP--GYPPQ--GYPPQGYPPP--GYPPQGYPPPPYSAQGYPPQ 270 YPP+G YPP GYPPP GYPP GYPPQGYPPP GYPPQGYPP QG PPQ Sbjct: 84 YPPQG----AYPPQGYPPPQAGYPPPQGGYPPQGYPPPQGGYPPQGYPPQGPPPQGPPPQ 139 Query: 271 YAP 279 AP Sbjct: 140 XAP 142 Score = 80.9 bits (198), Expect = 4e-14 Identities = 41/65 (63%), Positives = 42/65 (64%), Gaps = 5/65 (7%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQ-GYPPE--GYGKEGYPPP--GYPPPGYPPQGYPPQGYPPPG 213 PP Y PP G PPPQ GYPP GY +GYPPP GYPP GYPPQG PPQG PP Sbjct: 85 PPQGAY----PPQGYPPPQAGYPPPQGGYPPQGYPPPQGGYPPQGYPPQGPPPQGPPPQX 140 Query: 214 YPPQG 228 PPQG Sbjct: 141 APPQG 145 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/55 (67%), Positives = 37/55 (67%), Gaps = 7/55 (12%) Frame = +1 Query: 154 YPPPG-YPPQGYPPQ--GYPPP--GYPPQGYPPPP--YSAQGYPPQYAPQYAQPP 297 YPP G YPPQGYPP GYPPP GYPPQGYPPP Y QGYPPQ P PP Sbjct: 84 YPPQGAYPPQGYPPPQAGYPPPQGGYPPQGYPPPQGGYPPQGYPPQGPPPQGPPP 138 Score = 56.6 bits (135), Expect = 8e-07 Identities = 34/55 (61%), Positives = 34/55 (61%), Gaps = 10/55 (18%) Frame = +1 Query: 169 YPPQG-YPPQGYPPP--GYPPQ--GYPPPPYSAQGYPPQ---YAPQYAQP--PPP 303 YPPQG YPPQGYPPP GYPP GYPP QGYPP Y PQ P PPP Sbjct: 84 YPPQGAYPPQGYPPPQAGYPPPQGGYPP-----QGYPPPQGGYPPQGYPPQGPPP 133 [126][TOP] >UniRef100_Q0D315 Rhodopsin (Fragment) n=1 Tax=Teuthowenia megalops RepID=Q0D315_9MOLL Length = 304 Score = 86.3 bits (212), Expect = 1e-15 Identities = 40/58 (68%), Positives = 42/58 (72%), Gaps = 2/58 (3%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPG-YPPQGYPPQGYPPPGYPPQGYPP 237 QQQP PPPQGYPP+GY +GYPP G YPP G YPPQGYPPQG PP G PP PP Sbjct: 246 QQQPAY--PPPQGYPPQGYPPQGYPPQGAYPPQGAYPPQGYPPQGAPPQGAPPAAAPP 301 Score = 82.0 bits (201), Expect = 2e-14 Identities = 41/56 (73%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = +1 Query: 139 YPPP-GYPPPGYPPQGYPPQG-YPPPG-YPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 YPPP GYPP GYPPQGYPPQG YPP G YPPQGYPP QG PPQ AP A PP Sbjct: 251 YPPPQGYPPQGYPPQGYPPQGAYPPQGAYPPQGYPP-----QGAPPQGAPPAAAPP 301 Score = 75.1 bits (183), Expect = 2e-12 Identities = 37/65 (56%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEG-YPPPG-YPPPGYPPQGYPPQGYPPPG 213 P PP Y PPQGYPP+GY +G YPP G YPP GYPPQG PPQG PP Sbjct: 249 PAYPPPQGY----------PPQGYPPQGYPPQGAYPPQGAYPPQGYPPQGAPPQGAPPAA 298 Query: 214 YPPQG 228 PPQG Sbjct: 299 APPQG 303 [127][TOP] >UniRef100_B4H3I7 GL11806 n=1 Tax=Drosophila persimilis RepID=B4H3I7_DROPE Length = 537 Score = 86.3 bits (212), Expect = 1e-15 Identities = 38/62 (61%), Positives = 42/62 (67%), Gaps = 2/62 (3%) Frame = +1 Query: 160 PPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQY--APQYAQPPPPHHHNNSNNSS 333 PPGYPPQGYP QGYP GYPPQGYP P + QG PPQY AP PPPP+H+ S Sbjct: 9 PPGYPPQGYPAQGYPQQGYPPQGYPQPGFIQQGNPPQYYGAPPGQGPPPPNHYYGSVPPP 68 Query: 334 SP 339 +P Sbjct: 69 AP 70 Score = 73.9 bits (180), Expect = 5e-12 Identities = 37/68 (54%), Positives = 41/68 (60%), Gaps = 7/68 (10%) Frame = +1 Query: 97 PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPP-------PYSAQ 255 PPQGYP +GY ++GYPP GYP PG+ QG PPQ Y P P QG PPP P A Sbjct: 13 PPQGYPAQGYPQQGYPPQGYPQPGFIQQGNPPQYYGAP--PGQGPPPPNHYYGSVPPPAP 70 Query: 256 GYPPQYAP 279 PPQ AP Sbjct: 71 TLPPQDAP 78 Score = 70.9 bits (172), Expect = 4e-11 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = +1 Query: 100 PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP--GYPPQGYPPPPYSAQGYPPQY 273 P GYPP+GY +GYP GYPP GYP G+ QG PP G PP PPPP G P Sbjct: 9 PPGYPPQGYPAQGYPQQGYPPQGYPQPGFIQQGNPPQYYGAPPGQGPPPPNHYYGSVPPP 68 Query: 274 AP 279 AP Sbjct: 69 AP 70 [128][TOP] >UniRef100_B0CS37 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CS37_LACBS Length = 335 Score = 86.3 bits (212), Expect = 1e-15 Identities = 48/99 (48%), Positives = 50/99 (50%) Frame = +1 Query: 1 ARGKASN*QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQ 180 A KAS R PP PP G+PPP G PP G G PPPG PPPG PP Sbjct: 136 AAAKASATGARAARRAPPSGSTPPGSPPPGSPPP-GSPPPG-PPPGSPPPG-PPPGSPPP 192 Query: 181 GYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 G PP G PPPG PP G PPP G PP +P PP Sbjct: 193 GSPPPGSPPPGSPPPGSPPPGSPPPGSPPSGSPPSRSPP 231 Score = 81.6 bits (200), Expect = 2e-14 Identities = 45/90 (50%), Positives = 50/90 (55%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 ++ PP G+ PP G PP G G PPPG PPPG PP G PP G PPPG PP G PPP Sbjct: 149 RRAPPSGSTPP-GSPPPGSPPPGSPPPG-PPPGSPPPG-PPPGSPPPGSPPPGSPPP--- 202 Query: 250 AQGYPPQYAPQYAQPPPPHHHNNSNNSSSP 339 G PP +P PPP + S S SP Sbjct: 203 --GSPPPGSPPPGSPPPGSPPSGSPPSRSP 230 Score = 72.4 bits (176), Expect = 1e-11 Identities = 39/80 (48%), Positives = 41/80 (51%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P +PP PP G+PPP G PP G G PPPG PPPG PP G PP G PP P Sbjct: 178 PGSPPPG------PPPGSPPP-GSPPPGSPPPGSPPPGSPPPGSPPPGSPPSGSPPSRSP 230 Query: 220 PQGYPPPPYSAQGYPPQYAP 279 P G P A G P AP Sbjct: 231 PSG---TPSGAAGASPSRAP 247 Score = 65.1 bits (157), Expect = 2e-09 Identities = 38/85 (44%), Positives = 39/85 (45%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P PP S PP G+PPP G PP G G PPPG PPPG PP G PP PP G P Sbjct: 183 PGPPPGS------PPPGSPPP-GSPPPGSPPPGSPPPGSPPPGSPPSGSPPSRSPPSGTP 235 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQP 294 P A P P A P Sbjct: 236 SGAAGASPSRA----PSEGPSEATP 256 [129][TOP] >UniRef100_Q3BDN4 Rhodopsin (Fragment) n=1 Tax=Metasepia tullbergi RepID=Q3BDN4_9MOLL Length = 306 Score = 85.9 bits (211), Expect = 1e-15 Identities = 48/77 (62%), Positives = 49/77 (63%), Gaps = 5/77 (6%) Frame = +1 Query: 55 MSYYNQQQ---PPVGTPPPQG-YPPEGYGKEGYPPPGYPPPGYPPQGYPP-QGYPPPGYP 219 M QQQ PP G PPQG YPP+G GYPP GYPPP PPQGYPP QGYPP GYP Sbjct: 240 MQKMQQQQAAYPPQGAYPPQGGYPPQG----GYPPQGYPPP--PPQGYPPPQGYPPQGYP 293 Query: 220 PQGYPPPPYSAQGYPPQ 270 PQG PP QG P Q Sbjct: 294 PQGAPP-----QGAPTQ 305 Score = 78.6 bits (192), Expect = 2e-13 Identities = 41/64 (64%), Positives = 42/64 (65%), Gaps = 2/64 (3%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQG-YPPQGYPPPGYPPQGYPPPP-YSAQGYPPQYAPQ 282 YPP+G YPP G GYPPQG YPPQGYPPP PPQGYPPP Y QGYPPQ AP Sbjct: 250 YPPQG----AYPPQG----GYPPQGGYPPQGYPPP--PPQGYPPPQGYPPQGYPPQGAPP 299 Query: 283 YAQP 294 P Sbjct: 300 QGAP 303 [130][TOP] >UniRef100_B4NJ85 GK13847 n=1 Tax=Drosophila willistoni RepID=B4NJ85_DROWI Length = 675 Score = 85.9 bits (211), Expect = 1e-15 Identities = 44/72 (61%), Positives = 46/72 (63%) Frame = -1 Query: 293 G*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSG 114 G Y G G P Y GGGYP GG PGGGYP GGYP GG+PGGG+PGGGYP YP G Sbjct: 301 GHGYPGGNYPGYPGGGYPGGGYPGGGYPGGGYP-GGYPGGGFPGGGFPGGGYPG-GYPGG 358 Query: 113 G*PCGGGVPTGG 78 P GGG GG Sbjct: 359 PFPGGGGSNNGG 370 Score = 80.1 bits (196), Expect = 7e-14 Identities = 43/75 (57%), Positives = 47/75 (62%) Frame = -1 Query: 302 GGGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPY 123 G G Y G GG P Y GGGYP GG P GGYP GG+P GG+PGGGYP GGYP P+ Sbjct: 303 GYPGGNYPGYPGGGYPGGGYPGGGYPGGGYP-GGYPGGGFPGGGFPGGGYP-GGYPGGPF 360 Query: 122 PSGG*PCGGGVPTGG 78 P GG GG +GG Sbjct: 361 PGGGGSNNGGHNSGG 375 Score = 78.6 bits (192), Expect = 2e-13 Identities = 46/77 (59%), Positives = 49/77 (63%), Gaps = 5/77 (6%) Frame = -1 Query: 296 GG*AY*G-AY*G-G*PCAEYGGGGYPCG---G*PGGGYPCGGYPCGGYPGGGYPGGGYPS 132 GG Y G Y G G P ++ G GYP G G PGGGYP GGYP GGYPGGGYP GGYP Sbjct: 280 GGHGYPGHGYPGHGYPGGDHPGHGYPGGNYPGYPGGGYPGGGYPGGGYPGGGYP-GGYPG 338 Query: 131 FPYPSGG*PCGGGVPTG 81 +P GG P GGG P G Sbjct: 339 GGFPGGGFP-GGGYPGG 354 Score = 77.4 bits (189), Expect = 5e-13 Identities = 40/65 (61%), Positives = 40/65 (61%), Gaps = 3/65 (4%) Frame = -1 Query: 263 G*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*P---CGGG 93 G P Y G GYP G PG GYP G YP GYPGGGYPGGGYP YP GG P GGG Sbjct: 283 GYPGHGYPGHGYPGGDHPGHGYPGGNYP--GYPGGGYPGGGYPGGGYPGGGYPGGYPGGG 340 Query: 92 VPTGG 78 P GG Sbjct: 341 FPGGG 345 Score = 63.5 bits (153), Expect = 7e-09 Identities = 35/62 (56%), Positives = 39/62 (62%), Gaps = 4/62 (6%) Frame = -1 Query: 266 GG*PCAEYGGGGYPCG----G*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*PCG 99 GG P Y GGGYP G G PGGG+P GGYP GGYPGG +PGGG + +GG G Sbjct: 320 GGYPGGGYPGGGYPGGYPGGGFPGGGFPGGGYP-GGYPGGPFPGGGGSN----NGGHNSG 374 Query: 98 GG 93 GG Sbjct: 375 GG 376 Score = 59.7 bits (143), Expect = 1e-07 Identities = 40/101 (39%), Positives = 45/101 (44%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 H+G P Y P G P GYP Y GYP GYP GYP GYP GYP Sbjct: 278 HKGGHGYPGHGYPGHGYPG-GDHPGHGYPGGNY--PGYPGGGYPGGGYPGGGYPGGGYPG 334 Query: 208 PGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNS 330 GYP G+P + GYP Y P P +N +NS Sbjct: 335 -GYPGGGFPGGGFPGGGYPGGY-PGGPFPGGGGSNNGGHNS 373 Score = 56.6 bits (135), Expect = 8e-07 Identities = 45/130 (34%), Positives = 52/130 (40%), Gaps = 29/130 (22%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQ--GYPPEGYGKEGYPPPGYPP-PGYP------------ 174 P PP YY Q PP PP Q PP PPG P PG P Sbjct: 55 PAPPPHHYYPHQPPP---PPIQHCNCPPG--------PPGLPGLPGEPGRNGEKGEKGEK 103 Query: 175 ----PQGYP----PQGYP-PPGYPPQGYPPPP-----YSAQGYPPQYAPQYAQPPPPHHH 312 +GYP P G P PPG P PPPP + +PP P PPPP H Sbjct: 104 GDKGDKGYPGLPGPPGLPGPPGIPAPVPPPPPPHHHHHHPHPHPPPSPPPPPSPPPPKDH 163 Query: 313 NNSNNSSSPG 342 ++ ++ SPG Sbjct: 164 HHHHHHPSPG 173 Score = 55.8 bits (133), Expect = 1e-06 Identities = 35/98 (35%), Positives = 39/98 (39%), Gaps = 23/98 (23%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEG--------------------YGKEGYPPPGYP 159 P PP Y Q P + P P +P +G G GYP GYP Sbjct: 231 PPPPPPPPYPPQIPWIPIPFPLPWPSKGDHHHNKGGNHKGGHHKGGDHKGGHGYPGHGYP 290 Query: 160 PPGYPPQGYPPQGYPP---PGYPPQGYPPPPYSAQGYP 264 GYP +P GYP PGYP GYP Y GYP Sbjct: 291 GHGYPGGDHPGHGYPGGNYPGYPGGGYPGGGYPGGGYP 328 [131][TOP] >UniRef100_A1DBR2 Annexin ANXC3.1 n=1 Tax=Neosartorya fischeri NRRL 181 RepID=A1DBR2_NEOFI Length = 487 Score = 85.9 bits (211), Expect = 1e-15 Identities = 55/118 (46%), Positives = 63/118 (53%), Gaps = 12/118 (10%) Frame = +1 Query: 25 QHRGHPTTPPMSYYN----QQQPPVGTPPPQGYPPEG-YGKEGYPPPG-YPPPG-YPPQG 183 Q + + PP + QQ P G PPPQ YPP+G Y + YPP G YPP YPPQ Sbjct: 62 QQQPYGAPPPQQQWTGQPPQQYPQGGHPPPQQYPPQGAYPQNQYPPQGQYPPQSQYPPQS 121 Query: 184 -YPPQG-YPPPG---YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 YPP G YPPPG YPPQG PP GYPP APQ PP ++ N +PG Sbjct: 122 QYPPHGQYPPPGQGQYPPQG-GYPPQGQPGYPPPQAPQPMPTPPSLGYD--PNQRAPG 176 Score = 77.8 bits (190), Expect = 4e-13 Identities = 49/102 (48%), Positives = 54/102 (52%), Gaps = 20/102 (19%) Frame = +1 Query: 52 PMSYYNQQQPPVGTPP--PQGYPPEGYGKEGYPPPGY--------PPP-----GYPPQGY 186 P ++ QQQ PP P GYPP+G + YPPPG PPP G PPQ Y Sbjct: 24 PGAHQQQQQQAPYYPPQQPGGYPPQGAPPQQYPPPGQYQQQPYGAPPPQQQWTGQPPQQY 83 Query: 187 PPQGYPPP-GYPPQG-YPPPPYSAQG-YPP--QYAPQYAQPP 297 P G+PPP YPPQG YP Y QG YPP QY PQ PP Sbjct: 84 PQGGHPPPQQYPPQGAYPQNQYPPQGQYPPQSQYPPQSQYPP 125 Score = 72.0 bits (175), Expect = 2e-11 Identities = 40/90 (44%), Positives = 42/90 (46%), Gaps = 12/90 (13%) Frame = +1 Query: 76 QPPVGTPPPQGYPPEGYGKEG------YPPPGYPPP---GYPPQGYPPQGYPPPG---YP 219 Q G PP Y GY + G P YPP GYPPQG PPQ YPPPG Sbjct: 5 QHTYGGPPQPPYNSAGYAQPGAHQQQQQQAPYYPPQQPGGYPPQGAPPQQYPPPGQYQQQ 64 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 P G PPP G PPQ PQ PPP + Sbjct: 65 PYGAPPPQQQWTGQPPQQYPQGGHPPPQQY 94 Score = 71.6 bits (174), Expect = 3e-11 Identities = 47/121 (38%), Positives = 50/121 (41%), Gaps = 32/121 (26%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKE-------GYPPPGYPPPGYPP-QGYPP 192 +P P Y Q PP PPP Y + YG G PP YP G+PP Q YPP Sbjct: 37 YPPQQPGGYPPQGAPPQQYPPPGQYQQQPYGAPPPQQQWTGQPPQQYPQGGHPPPQQYPP 96 Query: 193 QG------YPPPG-------------YPPQGYPPPPYSAQ-----GYPPQYAPQYAQPPP 300 QG YPP G YPP G PPP Q GYPPQ P Y P Sbjct: 97 QGAYPQNQYPPQGQYPPQSQYPPQSQYPPHGQYPPPGQGQYPPQGGYPPQGQPGYPPPQA 156 Query: 301 P 303 P Sbjct: 157 P 157 [132][TOP] >UniRef100_Q53U37 Putative uncharacterized protein n=1 Tax=Solanum lycopersicum RepID=Q53U37_SOLLC Length = 184 Score = 85.1 bits (209), Expect = 2e-15 Identities = 46/84 (54%), Positives = 51/84 (60%), Gaps = 6/84 (7%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPV--GTPPPQGYPPEGYG-KEGYPPP-GYPPPGYPPQG-YPP 192 H GHP Q PP G PP QGYPP+GY ++GYPP GYPP GYPPQG YPP Sbjct: 27 HHGHPG---------QYPPQHGGYPPQQGYPPQGYPPQQGYPPQQGYPPQGYPPQGGYPP 77 Query: 193 Q-GYPPPGYPPQGYPPPPYSAQGY 261 Q GYPP GYPP G+ P G+ Sbjct: 78 QQGYPPQGYPPAGHHGAPQHHSGH 101 Score = 71.6 bits (174), Expect = 3e-11 Identities = 45/80 (56%), Positives = 48/80 (60%), Gaps = 8/80 (10%) Frame = +1 Query: 127 GKEGYPPPGYPPP--GYPPQ-GYPPQGYPPP-GYPPQ-GYPPPPYSAQ-GYPPQ--YAPQ 282 G G+P YPP GYPPQ GYPPQGYPP GYPPQ GYPP Y Q GYPPQ Y PQ Sbjct: 26 GHHGHPGQ-YPPQHGGYPPQQGYPPQGYPPQQGYPPQQGYPPQGYPPQGGYPPQQGYPPQ 84 Query: 283 YAQPPPPHHHNNSNNSSSPG 342 PP HH ++S G Sbjct: 85 -GYPPAGHHGAPQHHSGHGG 103 [133][TOP] >UniRef100_B8LPB8 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=B8LPB8_PICSI Length = 76 Score = 85.1 bits (209), Expect = 2e-15 Identities = 50/114 (43%), Positives = 55/114 (48%) Frame = +1 Query: 58 SYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP 237 S YNQ+ + TPPPQGYPP EGYP Q YPP PPPGYP QG+PP Sbjct: 3 SNYNQKNQ-MTTPPPQGYPP-----EGYP-----------QAYPP---PPPGYPQQGFPP 42 Query: 238 PPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 YAP Q G +GCCA LCCCC+LDACF Sbjct: 43 TQ--------DYAPAQTQ------------QRGDGFWKGCCATLCCCCMLDACF 76 [134][TOP] >UniRef100_B6SXA9 Adhesive/proline-rich protein n=1 Tax=Zea mays RepID=B6SXA9_MAIZE Length = 78 Score = 85.1 bits (209), Expect = 2e-15 Identities = 48/101 (47%), Positives = 52/101 (51%), Gaps = 2/101 (1%) Frame = +1 Query: 103 QGYPPEGYGKEGYPPPG--YPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYA 276 Q PP G YPPPG YPPPG PQGYPPP Y PPP +A GYP Sbjct: 4 QAPPP---GTSAYPPPGTAYPPPG------QPQGYPPPAYG----APPPMAAGGYP---- 46 Query: 277 PQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 PPP NN G L+GC AALCCCC+L+ CF Sbjct: 47 -----PPPQEDSKGGNN----GFLKGCLAALCCCCMLNMCF 78 [135][TOP] >UniRef100_Q3BDP2 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis australis RepID=Q3BDP2_9MOLL Length = 294 Score = 85.1 bits (209), Expect = 2e-15 Identities = 39/54 (72%), Positives = 40/54 (74%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ 270 YPP+GY PPP PP GYPPQGYPPQGYPP GYPPQGYPPP QG PPQ Sbjct: 250 YPPQGY-----PPP--PPQGYPPQGYPPQGYPPQGYPPQGYPPP----QGPPPQ 292 Score = 82.0 bits (201), Expect = 2e-14 Identities = 38/59 (64%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP-GYPPQG 228 M QQ PPQGYPP +GYPP GYPP GYPPQGYPPQGYPPP G PPQG Sbjct: 237 MQKMQAQQQQQAAYPPQGYPPPP--PQGYPPQGYPPQGYPPQGYPPQGYPPPQGPPPQG 293 Score = 81.3 bits (199), Expect = 3e-14 Identities = 38/55 (69%), Positives = 38/55 (69%) Frame = +1 Query: 139 YPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 YPP GYPPP PPQGYPPQGYPP GYPPQGYPP QGYPP Q PPP Sbjct: 250 YPPQGYPPP--PPQGYPPQGYPPQGYPPQGYPP-----QGYPP------PQGPPP 291 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG 198 +G+P PP Y PPQGYPP+GY +GYPP GYP PPQG PPQG Sbjct: 253 QGYPPPPPQGY-----------PPQGYPPQGYPPQGYPPQGYP----PPQGPPPQG 293 [136][TOP] >UniRef100_A0CMY9 Chromosome undetermined scaffold_22, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CMY9_PARTE Length = 197 Score = 85.1 bits (209), Expect = 2e-15 Identities = 60/116 (51%), Positives = 64/116 (55%), Gaps = 12/116 (10%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQ-QPPVGTPPPQG-YPPEGYGKEGYPPPG-YPPPG-YPPQG-YPPQ 195 +G+ TTPP Q Q P G PPQG YPP+G YPP G YPP G YPPQG YPPQ Sbjct: 11 QGYGTTPPPPPAGQLGQYPQGQYPPQGQYPPQGQ----YPPQGQYPPQGQYPPQGQYPPQ 66 Query: 196 G-YPPPG-YPPQGYPPPPYSAQGYPP-QYAPQYAQPP----PPHHHNNSNNSSSPG 342 G YPP G YPPQG PPP YPP QY PQ PP PP + PG Sbjct: 67 GQYPPQGQYPPQGQYPPPGQ---YPPGQYPPQGQYPPQGQYPPQQYPQQPGYYPPG 119 Score = 79.3 bits (194), Expect = 1e-13 Identities = 57/111 (51%), Positives = 59/111 (53%), Gaps = 26/111 (23%) Frame = +1 Query: 49 PPMSYYNQ----------------QQPPVGTPPPQG-YPPEG-YGKEG-YPPPG-YPPPG 168 PP Y Q PP G PPQG YPP+G Y +G YPP G YPP G Sbjct: 8 PPAQGYGTTPPPPPAGQLGQYPQGQYPPQGQYPPQGQYPPQGQYPPQGQYPPQGQYPPQG 67 Query: 169 -YPPQG-YPPQG-YPPPG-YPPQGYPPP-PYSAQG-YPPQYAPQYAQPPPP 303 YPPQG YPPQG YPPPG YPP YPP Y QG YPPQ PQ PP Sbjct: 68 QYPPQGQYPPQGQYPPPGQYPPGQYPPQGQYPPQGQYPPQQYPQQPGYYPP 118 Score = 65.1 bits (157), Expect = 2e-09 Identities = 44/82 (53%), Positives = 45/82 (54%), Gaps = 13/82 (15%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG-YPPPG-YPPQG-YPP----PP--- 243 PPP P +GYG PPP YP YPPQG YPP G YPPQG YPP PP Sbjct: 6 PPP---PAQGYGTTPPPPPAGQLGQYPQGQYPPQGQYPPQGQYPPQGQYPPQGQYPPQGQ 62 Query: 244 YSAQG-YPP--QYAPQYAQPPP 300 Y QG YPP QY PQ PPP Sbjct: 63 YPPQGQYPPQGQYPPQGQYPPP 84 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/79 (44%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQG-YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQ 225 PP Y Q PP G PPQG YPP+ Y ++ PGY YPP GYP Q PG PQ Sbjct: 83 PPGQYPPGQYPPQGQYPPQGQYPPQQYPQQ----PGY----YPPGGYPQQ---VPGQYPQ 131 Query: 226 GYPPPPYSAQGYPPQYAPQ 282 G Q P Q PQ Sbjct: 132 GQTTTIIEIQQQPTQKPPQ 150 [137][TOP] >UniRef100_UPI0001BB0016 hypothetical protein Hoch_4084 n=1 Tax=Haliangium ochraceum DSM 14365 RepID=UPI0001BB0016 Length = 415 Score = 84.7 bits (208), Expect = 3e-15 Identities = 50/107 (46%), Positives = 55/107 (51%), Gaps = 16/107 (14%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPP----PGYPPQGYPP-- 192 +G+P PP QQPP P PQ +GY ++ PPP PP PGYP QGYPP Sbjct: 127 QGYPQQPPPQQGYPQQPPQQQPEPQ----QGYPQQQPPPPQPPPQQQQPGYPQQGYPPQQ 182 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYP--------PQYAPQ--YAQPPPP 303 QGYP PGYP Q P QGYP PQ PQ Y Q PPP Sbjct: 183 QGYPQPGYPQQQPQQQPAPQQGYPQQGPQQGYPQQQPQQGYPQQPPP 229 Score = 77.0 bits (188), Expect = 6e-13 Identities = 48/99 (48%), Positives = 52/99 (52%), Gaps = 13/99 (13%) Frame = +1 Query: 31 RGHPTTPPMSY------YNQQQPPVGTPPPQGYPPEGYGKEGYPPP--GYPPPGYPPQG- 183 +G+P PP Y QQQPP PPPQ P GY ++GYPP GYP PGYP Q Sbjct: 137 QGYPQQPPQQQPEPQQGYPQQQPPPPQPPPQQQQP-GYPQQGYPPQQQGYPQPGYPQQQP 195 Query: 184 ----YPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYA 288 P QGYP G P QGYP QGYP Q PQ A Sbjct: 196 QQQPAPQQGYPQQG-PQQGYPQQQ-PQQGYPQQPPPQPA 232 Score = 69.3 bits (168), Expect = 1e-10 Identities = 40/92 (43%), Positives = 44/92 (47%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q + P PP Y QQQ P PP QGYP + ++ PP P P QGYP Q P Sbjct: 81 QQQQQPPPPPQQGYPQQQQP---PPQQGYPQQPQQQQ--PPQQQPQQQQPQQGYPQQPPP 135 Query: 205 PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 GYP Q P QGYP Q P QPPP Sbjct: 136 QQGYPQQPPQQQPEPQQGYPQQQPPP-PQPPP 166 Score = 68.2 bits (165), Expect = 3e-10 Identities = 41/102 (40%), Positives = 45/102 (44%), Gaps = 9/102 (8%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q P P Y QQQ PPP P +GY ++ PPP P P Q PPQ P Sbjct: 64 QQPQQPGYSPQPDYQQQQQQQQPPPP---PQQGYPQQQQPPPQQGYPQQPQQQQPPQQQP 120 Query: 205 PPGYPPQGYPPPPYSAQGY---PPQYAPQ------YAQPPPP 303 P QGYP P QGY PPQ P+ QPPPP Sbjct: 121 QQQQPQQGYPQQPPPQQGYPQQPPQQQPEPQQGYPQQQPPPP 162 Score = 67.8 bits (164), Expect = 4e-10 Identities = 48/107 (44%), Positives = 53/107 (49%), Gaps = 17/107 (15%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTP----PPQGYPPEGYGKEGYP---PPGYPPP--GYPPQG 183 +G+P P QQQPP P P QGYP + ++GYP P P P GYP Q Sbjct: 104 QGYPQQP-----QQQQPPQQQPQQQQPQQGYPQQPPPQQGYPQQPPQQQPEPQQGYPQQQ 158 Query: 184 YPPQGYPP----PGYPPQGYPPPPYSAQGYP----PQYAPQYAQPPP 300 PP PP PGYP QGYPP QGYP PQ PQ QP P Sbjct: 159 PPPPQPPPQQQQPGYPQQGYPP---QQQGYPQPGYPQQQPQ-QQPAP 201 Score = 53.9 bits (128), Expect = 5e-06 Identities = 38/99 (38%), Positives = 42/99 (42%), Gaps = 9/99 (9%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQ--GYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 G PP Y P+ PQ GY P+ ++ PPP P QGYP Q PP Sbjct: 44 GANPAPPQPGYRPLPAPLQQQQPQQPGYSPQPDYQQQQQQQQPPPP--PQQGYPQQQQPP 101 Query: 208 PGYPPQGYPPPPYSAQGYPPQYAPQ-------YAQPPPP 303 P QGYP P Q PPQ PQ Y Q PPP Sbjct: 102 ---PQQGYPQQPQQQQ--PPQQQPQQQQPQQGYPQQPPP 135 [138][TOP] >UniRef100_B4FH66 Adhesive/proline-rich protein n=2 Tax=Zea mays RepID=B4FH66_MAIZE Length = 78 Score = 84.7 bits (208), Expect = 3e-15 Identities = 46/91 (50%), Positives = 50/91 (54%), Gaps = 5/91 (5%) Frame = +1 Query: 142 PPPG---YPPPG--YPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPH 306 PPPG YPPPG YPP G P Q YPPP Y PPP +A GYPP PP Sbjct: 6 PPPGTSAYPPPGTAYPPPGQP-QAYPPPAYGA----PPPMAAGGYPP----------PPQ 50 Query: 307 HHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 + N G L+GC AALCCCC+LD CF Sbjct: 51 QDSKGGND---GFLKGCLAALCCCCMLDMCF 78 [139][TOP] >UniRef100_A2EEE7 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2EEE7_TRIVA Length = 156 Score = 84.7 bits (208), Expect = 3e-15 Identities = 45/87 (51%), Positives = 47/87 (54%), Gaps = 5/87 (5%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP YY QQ P Q YPP+ Y PP YPP YPPQ YP Q YPP YP QG Sbjct: 67 PPQQYY-QQPYPQQPAQSQQYPPQSY-----PPQPYPPQNYPPQNYPQQEYPPQNYPQQG 120 Query: 229 YPPPPYS----AQGY-PPQYAPQYAQP 294 YPP P S +Q Y PPQY PQ P Sbjct: 121 YPPQPNSQVNASQPYQPPQYQPQAYSP 147 Score = 80.9 bits (198), Expect = 4e-14 Identities = 38/90 (42%), Positives = 47/90 (52%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 + + P G+ Q YPP+ Y ++ YP YPPQ YPPQ YPP YPPQ YP Sbjct: 53 KHRQPQGSVQQQQYPPQQYYQQPYPQQPAQSQQYPPQSYPPQPYPPQNYPPQNYP----- 107 Query: 250 AQGYPPQYAPQYAQPPPPHHHNNSNNSSSP 339 Q YPPQ PQ PP P+ N++ P Sbjct: 108 QQEYPPQNYPQQGYPPQPNSQVNASQPYQP 137 [140][TOP] >UniRef100_A0BVE0 Chromosome undetermined scaffold_13, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BVE0_PARTE Length = 369 Score = 84.7 bits (208), Expect = 3e-15 Identities = 46/104 (44%), Positives = 51/104 (49%), Gaps = 2/104 (1%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG-YPPQG-YPPQGYPPPGYPP 222 PP Y QQ PP PPP YPP G YPP YPPPG YPP G YPP YPP YPP Sbjct: 243 PPPGYPGQQPPPGQYPPPGQYPPPGQ----YPPGQYPPPGQYPPPGQYPPGQYPPGQYPP 298 Query: 223 QGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEG 354 G PPP + Q PPPP H+ + + + G Sbjct: 299 PGQYPPPQNTTVIIEQQG-----PPPPQQHSGGGGAVAGALIGG 337 Score = 84.0 bits (206), Expect = 5e-15 Identities = 54/101 (53%), Positives = 55/101 (54%), Gaps = 13/101 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEG-YGKEG-YPPPG-YPPPG-YPPQGY--PPQGY 201 P P + Q PP PPP YPP G Y G YPPPG YPPPG YPP G PP Y Sbjct: 183 PPQPQLQQPGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQQPPPGQY 242 Query: 202 PPPGYPPQGYPPPPYSAQG-YPP--QYAP-QYAQP---PPP 303 PPPGYP Q PP Y G YPP QY P QY P PPP Sbjct: 243 PPPGYPGQQPPPGQYPPPGQYPPPGQYPPGQYPPPGQYPPP 283 Score = 83.6 bits (205), Expect = 6e-15 Identities = 51/92 (55%), Positives = 51/92 (55%), Gaps = 7/92 (7%) Frame = +1 Query: 46 TPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPG-YPPQG-YPPQG-YPPPG 213 T P Q Q P PPP YPP G YPPPG YPPPG YPP G YPP G YPPPG Sbjct: 179 TQPPPPQPQLQQPGQYPPPGQYPPPGQ----YPPPGQYPPPGQYPPPGQYPPPGQYPPPG 234 Query: 214 Y--PPQGYPPPPYSAQGYPP-QYAPQYAQPPP 300 PP YPPP Y Q PP QY P PPP Sbjct: 235 QQPPPGQYPPPGYPGQQPPPGQYPPPGQYPPP 266 Score = 83.6 bits (205), Expect = 6e-15 Identities = 57/115 (49%), Positives = 60/115 (52%), Gaps = 20/115 (17%) Frame = +1 Query: 49 PPMSYY---NQQQPPVGTPPPQGYPPEG-YGKEG-YPPPG-------YPPPGYPPQGYPP 192 PP Y Q PP PPP YPP G Y G YPPPG YPPPGYP Q PP Sbjct: 195 PPPGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQYPPPGQQPPPGQYPPPGYPGQQPPP 254 Query: 193 QGYPPPG-YPPQG-YPPPPYSAQG-YPP--QYAP-QY--AQPPPPHHHNNSNNSS 333 YPPPG YPP G YPP Y G YPP QY P QY Q PPP + N++ Sbjct: 255 GQYPPPGQYPPPGQYPPGQYPPPGQYPPPGQYPPGQYPPGQYPPPGQYPPPQNTT 309 [141][TOP] >UniRef100_Q28640 Histidine-rich glycoprotein (Fragment) n=1 Tax=Oryctolagus cuniculus RepID=HRG_RABIT Length = 526 Score = 84.7 bits (208), Expect = 3e-15 Identities = 45/110 (40%), Positives = 54/110 (49%), Gaps = 16/110 (14%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQG----YPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 H HP PP ++ PP PP G +PP G G+PP G PP G+PP G PP Sbjct: 331 HGHHPHGPPPHGHHPHGPPPHGHPPHGPPPRHPPHGPPPHGHPPHGPPPHGHPPHGPPPH 390 Query: 196 GYPPPGYPPQGYPP------------PPYSAQGYPPQYAPQYAQPPPPHH 309 G+PP G PP G+PP PP +G PQ Q+A PPP H Sbjct: 391 GHPPHGPPPHGHPPHGHGFHDHGPCDPPSHKEG--PQDLHQHAMGPPPKH 438 Score = 82.0 bits (201), Expect = 2e-14 Identities = 37/87 (42%), Positives = 46/87 (52%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQY 273 PPP G+ P G G+PP G PPP +PP G PP G+PP G PP G+PP G+PP Sbjct: 338 PPPHGHHPHGPPPHGHPPHG-PPPRHPPHGPPPHGHPPHGPPPHGHPPHGPPPHGHPPHG 396 Query: 274 APQYAQPPPPHHHNNSNNSSSPGCLEG 354 P + PP H ++ P EG Sbjct: 397 PPPHGHPPHGHGFHDHGPCDPPSHKEG 423 Score = 76.3 bits (186), Expect = 1e-12 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQY 273 PPP G+ P G G+ P G PP G+PP G PP+ +PP G PP G+PP G+PP Sbjct: 328 PPPHGHHPHGPPPHGHHPHGPPPHGHPPHGPPPR-HPPHGPPPHGHPPHGPPPHGHPPHG 386 Query: 274 APQYAQP---PPPHHH 312 P + P PPPH H Sbjct: 387 PPPHGHPPHGPPPHGH 402 [142][TOP] >UniRef100_UPI0000E495BC PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E495BC Length = 2645 Score = 84.3 bits (207), Expect = 4e-15 Identities = 46/105 (43%), Positives = 50/105 (47%), Gaps = 9/105 (8%) Frame = +1 Query: 67 NQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP-GYPPQGY 231 NQ P G PP PQG PP+G ++G PP G PP G PPQG PP G PPP G P QG Sbjct: 1896 NQGMPQQGIPPQGMPPQGMPPQGMPQQGIPPQGIPPQGMPPQGMPPHGMPPPQGMPQQGM 1955 Query: 232 P----PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEG 354 P P QG PPQ P PP + PG G Sbjct: 1956 PRGIMPQGMLPQGMPPQGMPPQGMPPQGMPPQGMHPGMMPGTQGG 2000 Score = 77.4 bits (189), Expect = 5e-13 Identities = 39/84 (46%), Positives = 43/84 (51%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP S ++ Q G P G PP + G P G P G PPQG PPQG PP G P QG Sbjct: 1867 PPNSMASEMQK--GFPQGMGPPPNS-NQSGLPNQGMPQQGIPPQGMPPQGMPPQGMPQQG 1923 Query: 229 YPPPPYSAQGYPPQYAPQYAQPPP 300 PP QG PPQ P + PPP Sbjct: 1924 IPPQGIPPQGMPPQGMPPHGMPPP 1947 Score = 77.4 bits (189), Expect = 5e-13 Identities = 42/88 (47%), Positives = 44/88 (50%), Gaps = 14/88 (15%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTP----PPQGYPPEGYGKEGYPPPGYPPP----------GYPPQGY 186 PP Q PP G P PPQG PP+G +G PP G PPP G PQG Sbjct: 1905 PPQGMPPQGMPPQGMPQQGIPPQGIPPQGMPPQGMPPHGMPPPQGMPQQGMPRGIMPQGM 1964 Query: 187 PPQGYPPPGYPPQGYPPPPYSAQGYPPQ 270 PQG PP G PPQG PP QG PPQ Sbjct: 1965 LPQGMPPQGMPPQGMPP-----QGMPPQ 1987 Score = 57.4 bits (137), Expect = 5e-07 Identities = 39/103 (37%), Positives = 42/103 (40%), Gaps = 29/103 (28%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYP--------------PEGYGKEGYPPPGYPPPGYPPQGY 186 PP Q PP G PPPQG P P+G +G PP G PP G PPQG Sbjct: 1930 PPQGMPPQGMPPHGMPPPQGMPQQGMPRGIMPQGMLPQGMPPQGMPPQGMPPQGMPPQGM 1989 Query: 187 PP------QGYPP-PGYPPQGY--------PPPPYSAQGYPPQ 270 P QG P PG+ QG P P A G P Q Sbjct: 1990 HPGMMPGTQGGPSGPGFLLQGVPGLGMSKPPRPAAPASGLPSQ 2032 [143][TOP] >UniRef100_UPI0000E4936E PREDICTED: similar to conserved hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4936E Length = 615 Score = 84.3 bits (207), Expect = 4e-15 Identities = 50/95 (52%), Positives = 53/95 (55%), Gaps = 20/95 (21%) Frame = +1 Query: 79 PPVGTP--PPQG---YPPEGYGKEGYPPPG----------YPPPGYPP--QGYPPQGYPP 207 PP G P PPQG YPP+G ++GYPPPG YPPPG PP QGYPP G P Sbjct: 426 PPGGQPGFPPQGQPGYPPQG--QQGYPPPGQPGVPPPGQGYPPPGAPPPGQGYPPPGAPQ 483 Query: 208 P---GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P GYPP G P P QGYP P A PPPP Sbjct: 484 PGQQGYPPPGQPGMPPPGQGYP---LPGQAGPPPP 515 Score = 77.4 bits (189), Expect = 5e-13 Identities = 53/126 (42%), Positives = 57/126 (45%), Gaps = 37/126 (29%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPP-QGYPPEGY---GKEGYPPPGYPPPGYPPQGYP---- 189 G P PP Q PP G PPP QGYPP G G++GYPPPG P P QGYP Sbjct: 453 GQPGVPPPG---QGYPPPGAPPPGQGYPPPGAPQPGQQGYPPPGQPGMPPPGQGYPLPGQ 509 Query: 190 -------PQGYPPPGYP--PQGY-------PPPPYSAQGYPPQ-------------YAPQ 282 P+GYPPPG P P G PPP Y+A PQ YAPQ Sbjct: 510 AGPPPPGPEGYPPPGQPGMPGGVSGEEGLAPPPTYTAAVGGPQEVSGEKGSFGSVLYAPQ 569 Query: 283 YAQPPP 300 Y P Sbjct: 570 YPYYDP 575 Score = 68.6 bits (166), Expect = 2e-10 Identities = 41/74 (55%), Positives = 43/74 (58%), Gaps = 16/74 (21%) Frame = +1 Query: 127 GKEGYPP---PGYPPPGYPPQGYPPQG---YPPPGY-----PPQGYPPP--PYSAQGYPP 267 G+ G PP PG+PP G P GYPPQG YPPPG P QGYPPP P QGYPP Sbjct: 421 GQPGAPPGGQPGFPPQGQP--GYPPQGQQGYPPPGQPGVPPPGQGYPPPGAPPPGQGYPP 478 Query: 268 QYAPQYAQ---PPP 300 APQ Q PPP Sbjct: 479 PGAPQPGQQGYPPP 492 [144][TOP] >UniRef100_B6TAP4 Rhodopsin-like receptor n=1 Tax=Zea mays RepID=B6TAP4_MAIZE Length = 115 Score = 84.3 bits (207), Expect = 4e-15 Identities = 45/106 (42%), Positives = 57/106 (53%), Gaps = 7/106 (6%) Frame = +1 Query: 100 PQGYPPEGYGKEGYPPPGYPPPG--YPPQGYPP---QGYPPPGYPPQGYPPPP--YSAQG 258 P+ YPP GY + YPPP PP G YPP PP QGY G P GYPPP Y G Sbjct: 7 PESYPPPGY-SQPYPPPQAPPQGPYYPPPQQPPPGYQGYFNDGQQPYGYPPPQGGYYHHG 65 Query: 259 YPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDAC 396 + + + HHH++ ++ G L+G AALCCCC++D C Sbjct: 66 H-HHHNDHHHHHHGHHHHHHEDDDCCLGFLKGWLAALCCCCMMDEC 110 [145][TOP] >UniRef100_A8IES3 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IES3_CHLRE Length = 699 Score = 84.3 bits (207), Expect = 4e-15 Identities = 46/95 (48%), Positives = 48/95 (50%), Gaps = 10/95 (10%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG-YPPPG---- 213 PP++ P PP G PP G GYPPPG PPPG P GYPP G YPPPG Sbjct: 560 PPLTAAPTMHPGGHAAPPPGAPPPG-APGGYPPPGAPPPGAPGGGYPPPGAYPPPGAPPP 618 Query: 214 ---YPPQGYPPPPYSAQGYPP--QYAPQYAQPPPP 303 YPP P YS G PP Y P A PPPP Sbjct: 619 PGSYPPGAAPAGSYSTPGAPPPGAYPPPSAPPPPP 653 Score = 73.2 bits (178), Expect = 9e-12 Identities = 53/122 (43%), Positives = 55/122 (45%), Gaps = 33/122 (27%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPG-YPPPGY-PPQG-YPP- 192 GH PP + PP G P PP G PP G GYPPPG YPPPG PP G YPP Sbjct: 572 GHAAPPPGA------PPPGAPGGYPPPGAPPPGAPGGGYPPPGAYPPPGAPPPPGSYPPG 625 Query: 193 ---------QGYPPPG-YPPQGYPPPP-------------YSAQG---YPPQYAPQYAQP 294 G PPPG YPP PPPP Y+A G P Y P A P Sbjct: 626 AAPAGSYSTPGAPPPGAYPPPSAPPPPPPGAPGGYPAPGGYAAPGSYPAPGGYPPPGAAP 685 Query: 295 PP 300 PP Sbjct: 686 PP 687 [146][TOP] >UniRef100_Q3BDN7 Rhodopsin (Fragment) n=1 Tax=Heteroteuthis hawaiiensis RepID=Q3BDN7_9MOLL Length = 294 Score = 84.3 bits (207), Expect = 4e-15 Identities = 43/73 (58%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQG-YPPQGYPPPGYPPQGY 231 M QQP PPQGYPP+GY PP GYPP GYPPQG YPPQGYPP G PPQG Sbjct: 231 MQAQQAQQPAY---PPQGYPPQGYPP---PPQGYPPQGYPPQGAYPPQGYPPQGAPPQGA 284 Query: 232 PPPPYSAQGYPPQ 270 PP Q PP+ Sbjct: 285 PP-----QAAPPE 292 Score = 83.6 bits (205), Expect = 6e-15 Identities = 40/56 (71%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = +1 Query: 139 YPPPGYPPPGYPP--QGYPPQGYPPPG-YPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 YPP GYPP GYPP QGYPPQGYPP G YPPQGYPP QG PPQ AP A PP Sbjct: 241 YPPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYPP-----QGAPPQGAPPQAAPP 291 Score = 77.0 bits (188), Expect = 6e-13 Identities = 38/69 (55%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPGYPPQGYPPQGY 201 Q P PP Y Q PP PPQGYPP+GY PP G YPP GYPPQG PPQG Sbjct: 234 QQAQQPAYPPQGYPPQGYPP----PPQGYPPQGY-----PPQGAYPPQGYPPQGAPPQGA 284 Query: 202 PPPGYPPQG 228 PP PP+G Sbjct: 285 PPQAAPPEG 293 Score = 70.5 bits (171), Expect = 6e-11 Identities = 34/51 (66%), Positives = 34/51 (66%), Gaps = 6/51 (11%) Frame = +1 Query: 163 PGYPPQGYPPQGYPPPGYPPQGYPP---PP---YSAQGYPPQYAPQYAQPP 297 P YPPQGYPPQGYPPP PQGYPP PP Y QGYPPQ AP PP Sbjct: 239 PAYPPQGYPPQGYPPP---PQGYPPQGYPPQGAYPPQGYPPQGAPPQGAPP 286 [147][TOP] >UniRef100_Q6PKY9 Annexin ANXC3.1 n=1 Tax=Aspergillus fumigatus RepID=Q6PKY9_ASPFU Length = 464 Score = 84.3 bits (207), Expect = 4e-15 Identities = 55/118 (46%), Positives = 63/118 (53%), Gaps = 12/118 (10%) Frame = +1 Query: 25 QHRGHPT--TPPMSY--YNQQQPPVGTPPPQ----GYPPEGYGKEGYPPPG-YPPPG-YP 174 Q G+P PP + Q Q P G PPPQ G PP+ Y + G+PPP YPP G YP Sbjct: 39 QPGGYPPQGAPPQQFPPSGQYQQPYGAPPPQQQWPGQPPQQYPQGGHPPPQQYPPQGAYP 98 Query: 175 PQGYPPQG-YPPPG-YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 YPPQG YPP G YPPQG PP GYPP APQ PP ++ N +PG Sbjct: 99 QNQYPPQGQYPPHGQYPPQG-GYPPQGQPGYPPPQAPQPMPTPPSLGYD--PNQRAPG 153 Score = 77.4 bits (189), Expect = 5e-13 Identities = 46/92 (50%), Positives = 51/92 (55%), Gaps = 10/92 (10%) Frame = +1 Query: 52 PMSYYNQQQP---PVGTPPPQGYPPEGYGKEGY--PPPGYPPPGYPPQGYPPQGYPPP-G 213 P +Y QQP P PPQ +PP G ++ Y PPP PG PPQ YP G+PPP Sbjct: 31 PAPFYPPQQPGGYPPQGAPPQQFPPSGQYQQPYGAPPPQQQWPGQPPQQYPQGGHPPPQQ 90 Query: 214 YPPQG-YPPPPYSAQG-YPP--QYAPQYAQPP 297 YPPQG YP Y QG YPP QY PQ PP Sbjct: 91 YPPQGAYPQNQYPPQGQYPPHGQYPPQGGYPP 122 Score = 71.2 bits (173), Expect = 3e-11 Identities = 38/83 (45%), Positives = 41/83 (49%), Gaps = 9/83 (10%) Frame = +1 Query: 88 GTPPPQGYPPEGYGKEG----YPPPGYPPP---GYPPQGYPPQGYPPPG--YPPQGYPPP 240 G PP Y GY + G P P YPP GYPPQG PPQ +PP G P G PPP Sbjct: 9 GGPPQPPYNSAGYAQPGAHQQQPAPFYPPQQPGGYPPQGAPPQQFPPSGQYQQPYGAPPP 68 Query: 241 PYSAQGYPPQYAPQYAQPPPPHH 309 G PPQ PQ PPP + Sbjct: 69 QQQWPGQPPQQYPQGGHPPPQQY 91 [148][TOP] >UniRef100_C4JJZ7 Putative uncharacterized protein n=1 Tax=Uncinocarpus reesii 1704 RepID=C4JJZ7_UNCRE Length = 451 Score = 84.3 bits (207), Expect = 4e-15 Identities = 44/107 (41%), Positives = 52/107 (48%), Gaps = 4/107 (3%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG----YPPPGYPPQGYPPQGY 201 G PT PP QQ P G PPPQ P + YG YPPPG +P P YPP G P G+ Sbjct: 13 GPPTYPPPQQQQQQYPSYGAPPPQYPPQQTYGAPSYPPPGPYGHHPQPAYPPHG-SPYGH 71 Query: 202 PPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 P PP G+PPP + P +P Y PPP ++ PG Sbjct: 72 TPSPQPPYGHPPP------HHPPPSPGYGHLPPPTPNSGPVFHGQPG 112 Score = 57.0 bits (136), Expect = 6e-07 Identities = 42/108 (38%), Positives = 43/108 (39%), Gaps = 24/108 (22%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP-----QGYPPQGYPPPGYP 219 MSYY PPP GYP G PP YPP Q YP G PPP YP Sbjct: 1 MSYY---------PPPSGYP------------GGPPT-YPPPQQQQQQYPSYGAPPPQYP 38 Query: 220 PQ------GYPPP-PY------------SAQGYPPQYAPQYAQPPPPH 306 PQ YPPP PY S G+ P P Y PPP H Sbjct: 39 PQQTYGAPSYPPPGPYGHHPQPAYPPHGSPYGHTPSPQPPYGHPPPHH 86 [149][TOP] >UniRef100_B0Y9H7 Annexin ANXC3.1 n=1 Tax=Aspergillus fumigatus A1163 RepID=B0Y9H7_ASPFC Length = 464 Score = 84.3 bits (207), Expect = 4e-15 Identities = 55/118 (46%), Positives = 63/118 (53%), Gaps = 12/118 (10%) Frame = +1 Query: 25 QHRGHPT--TPPMSY--YNQQQPPVGTPPPQ----GYPPEGYGKEGYPPPG-YPPPG-YP 174 Q G+P PP + Q Q P G PPPQ G PP+ Y + G+PPP YPP G YP Sbjct: 39 QPGGYPPQGAPPQQFPPSGQYQQPYGAPPPQQQWPGQPPQQYPQGGHPPPQQYPPQGAYP 98 Query: 175 PQGYPPQG-YPPPG-YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 YPPQG YPP G YPPQG PP GYPP APQ PP ++ N +PG Sbjct: 99 QNQYPPQGQYPPHGQYPPQG-GYPPQGQPGYPPPQAPQPMPTPPSLGYD--PNQRAPG 153 Score = 77.4 bits (189), Expect = 5e-13 Identities = 46/92 (50%), Positives = 51/92 (55%), Gaps = 10/92 (10%) Frame = +1 Query: 52 PMSYYNQQQP---PVGTPPPQGYPPEGYGKEGY--PPPGYPPPGYPPQGYPPQGYPPP-G 213 P +Y QQP P PPQ +PP G ++ Y PPP PG PPQ YP G+PPP Sbjct: 31 PAPFYPPQQPGGYPPQGAPPQQFPPSGQYQQPYGAPPPQQQWPGQPPQQYPQGGHPPPQQ 90 Query: 214 YPPQG-YPPPPYSAQG-YPP--QYAPQYAQPP 297 YPPQG YP Y QG YPP QY PQ PP Sbjct: 91 YPPQGAYPQNQYPPQGQYPPHGQYPPQGGYPP 122 Score = 73.6 bits (179), Expect = 7e-12 Identities = 39/83 (46%), Positives = 42/83 (50%), Gaps = 9/83 (10%) Frame = +1 Query: 88 GTPPPQGYPPEGYGKEG----YPPPGYPPP---GYPPQGYPPQGYPPPG--YPPQGYPPP 240 G PP Y GYG+ G P P YPP GYPPQG PPQ +PP G P G PPP Sbjct: 9 GGPPQPPYNSAGYGQPGAHQQQPAPFYPPQQPGGYPPQGAPPQQFPPSGQYQQPYGAPPP 68 Query: 241 PYSAQGYPPQYAPQYAQPPPPHH 309 G PPQ PQ PPP + Sbjct: 69 QQQWPGQPPQQYPQGGHPPPQQY 91 [150][TOP] >UniRef100_C5X5A6 Putative uncharacterized protein Sb02g029510 n=1 Tax=Sorghum bicolor RepID=C5X5A6_SORBI Length = 113 Score = 83.6 bits (205), Expect = 6e-15 Identities = 46/107 (42%), Positives = 52/107 (48%), Gaps = 19/107 (17%) Frame = +1 Query: 133 EGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP---- 300 E YPPPGY P YPP PPQG P YPP PPPP QGY Y PPP Sbjct: 8 ESYPPPGYAQP-YPPPQAPPQG---PFYPPPQQPPPP-GYQGYFNNGQQPYGYPPPRDGH 62 Query: 301 ---------------PHHHNNSNNSSSPGCLEGCCAALCCCCLLDAC 396 HHH++ ++ G L+G AALCCCC+LD C Sbjct: 63 HHHGHHHHHDDHHHHHHHHHHEDDDCCLGFLKGWLAALCCCCMLDEC 109 [151][TOP] >UniRef100_UPI0000586AEB PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000586AEB Length = 523 Score = 83.2 bits (204), Expect = 8e-15 Identities = 61/124 (49%), Positives = 66/124 (53%), Gaps = 31/124 (25%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPP--EGYGK-----EGYPPP--GY----PPP 165 Q +G+P PP Y Q PPPQGYPP +GY + +GYPPP GY PPP Sbjct: 8 QAQGYPA-PPQQGYQQ-------PPPQGYPPPQQGYQQPPPQAQGYPPPQQGYQQNAPPP 59 Query: 166 --GYPP--QGYPP--QGY----PPP--GYPP--QGYPPPPYSAQGYPPQ----YAPQYAQ 291 GYPP QGYPP QGY PPP GYPP QG PPP QGY P AP Sbjct: 60 QQGYPPPQQGYPPPQQGYQQNAPPPQQGYPPSQQGQAPPPPQQQGYQPNAPVAAAPLQQA 119 Query: 292 PPPP 303 PPPP Sbjct: 120 PPPP 123 Score = 67.8 bits (164), Expect = 4e-10 Identities = 48/100 (48%), Positives = 51/100 (51%), Gaps = 11/100 (11%) Frame = +1 Query: 73 QQPPVGTPPPQGYP-PEGYGKEGYPPPGYPPP--GY---PPQ--GYPP--QGYPPPGYPP 222 QQPP P QGYP P G + PP GYPPP GY PPQ GYPP QGY PP Sbjct: 3 QQPP---PQAQGYPAPPQQGYQQPPPQGYPPPQQGYQQPPPQAQGYPPPQQGYQQNAPPP 59 Query: 223 QGYPPPPYSAQGY-PPQYAPQYAQPPPPHHHNNSNNSSSP 339 Q PPP QGY PPQ Q PPP + S +P Sbjct: 60 QQGYPPP--QQGYPPPQQGYQQNAPPPQQGYPPSQQGQAP 97 Score = 55.1 bits (131), Expect = 2e-06 Identities = 38/91 (41%), Positives = 43/91 (47%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP 210 +G+P PP Y Q PP P QGYPP ++G PP PP QGY P P Sbjct: 68 QGYP--PPQQGYQQNAPP----PQQGYPP---SQQGQAPP--PP---QQQGYQPNA-PVA 112 Query: 211 GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P Q PPPP S Q PPQ +Q P P Sbjct: 113 AAPLQQAPPPPQSGQVPPPQQGQAPSQLPNP 143 [152][TOP] >UniRef100_UPI00006A03ED MGC69562 protein. n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A03ED Length = 408 Score = 83.2 bits (204), Expect = 8e-15 Identities = 45/96 (46%), Positives = 45/96 (46%), Gaps = 8/96 (8%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGY----PPEGYGKEGYPPPGYPPP----GYPPQGYPPQ 195 P TP Q PP PP G PP G PPPG PPP PP G PP Sbjct: 266 PGTPAPPVPPPQLPPAPVVPPPGVHPPVPPPSLPPPGVPPPGVPPPPPNPAVPPPGVPPP 325 Query: 196 GYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 G PPPG PP G PPPP A G PP AP PP P Sbjct: 326 GIPPPGIPPPGVPPPP--APGVPPPPAPGVPLPPTP 359 Score = 79.7 bits (195), Expect = 9e-14 Identities = 43/95 (45%), Positives = 43/95 (45%), Gaps = 6/95 (6%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 HP PP S PP G PPP P PPPG PPPG PP G PP G PPP Sbjct: 290 HPPVPPPSLPPPGVPPPGVPPPPPNP-------AVPPPGVPPPGIPPPGIPPPGVPPP-- 340 Query: 217 PPQGYPPPPY------SAQGYPPQYAPQYAQPPPP 303 P G PPPP G PP AP PP P Sbjct: 341 PAPGVPPPPAPGVPLPPTPGVPPPPAPGVPPPPAP 375 Score = 67.8 bits (164), Expect = 4e-10 Identities = 42/101 (41%), Positives = 43/101 (42%), Gaps = 13/101 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY----PPPGYPPQGYPPQGYP- 204 P PP PP GTP P PP+ PPPG PPP PP G PP G P Sbjct: 252 PPPPPGGLPMPPMPP-GTPAPPVPPPQLPPAPVVPPPGVHPPVPPPSLPPPGVPPPGVPP 310 Query: 205 --------PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PPG PP G PPP G PP AP PP P Sbjct: 311 PPPNPAVPPPGVPPPGIPPPGIPPPGVPPPPAPGVPPPPAP 351 Score = 64.3 bits (155), Expect = 4e-09 Identities = 43/108 (39%), Positives = 44/108 (40%), Gaps = 18/108 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYP----PEGYGKEGYPPPGYPP-PGYPPQGY---- 186 G PPM + PP PPP G P P G PPP PP P PP G Sbjct: 240 GIQARPPMP---ENMPP---PPPGGLPMPPMPPGTPAPPVPPPQLPPAPVVPPPGVHPPV 293 Query: 187 PPQGYPPPGYPPQGYPPPP---------YSAQGYPPQYAPQYAQPPPP 303 PP PPPG PP G PPPP G PP P PPPP Sbjct: 294 PPPSLPPPGVPPPGVPPPPPNPAVPPPGVPPPGIPPPGIPPPGVPPPP 341 Score = 60.5 bits (145), Expect = 6e-08 Identities = 39/91 (42%), Positives = 41/91 (45%), Gaps = 2/91 (2%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP-QGYPPPG 213 +P PP PP G PPP G PP P PG PPP P PP G PPP Sbjct: 314 NPAVPPPGVPPPGIPPPGIPPP-GVPPP-------PAPGVPPPPAPGVPLPPTPGVPPP- 364 Query: 214 YPPQGYPPPPYSAQG-YPPQYAPQYAQPPPP 303 P G PPPP A G PP P +PP P Sbjct: 365 -PAPGVPPPPAPAPGVLPPGPMPPMMRPPLP 394 [153][TOP] >UniRef100_UPI00006A03EC MGC69562 protein. n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A03EC Length = 413 Score = 83.2 bits (204), Expect = 8e-15 Identities = 45/96 (46%), Positives = 45/96 (46%), Gaps = 8/96 (8%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGY----PPEGYGKEGYPPPGYPPP----GYPPQGYPPQ 195 P TP Q PP PP G PP G PPPG PPP PP G PP Sbjct: 266 PGTPAPPVPPPQLPPAPVVPPPGVHPPVPPPSLPPPGVPPPGVPPPPPNPAVPPPGVPPP 325 Query: 196 GYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 G PPPG PP G PPPP A G PP AP PP P Sbjct: 326 GIPPPGIPPPGVPPPP--APGVPPPPAPGVPLPPTP 359 Score = 79.7 bits (195), Expect = 9e-14 Identities = 43/95 (45%), Positives = 43/95 (45%), Gaps = 6/95 (6%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 HP PP S PP G PPP P PPPG PPPG PP G PP G PPP Sbjct: 290 HPPVPPPSLPPPGVPPPGVPPPPPNP-------AVPPPGVPPPGIPPPGIPPPGVPPP-- 340 Query: 217 PPQGYPPPPY------SAQGYPPQYAPQYAQPPPP 303 P G PPPP G PP AP PP P Sbjct: 341 PAPGVPPPPAPGVPLPPTPGVPPPPAPGVPPPPAP 375 Score = 67.8 bits (164), Expect = 4e-10 Identities = 42/101 (41%), Positives = 43/101 (42%), Gaps = 13/101 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY----PPPGYPPQGYPPQGYP- 204 P PP PP GTP P PP+ PPPG PPP PP G PP G P Sbjct: 252 PPPPPGGLPMPPMPP-GTPAPPVPPPQLPPAPVVPPPGVHPPVPPPSLPPPGVPPPGVPP 310 Query: 205 --------PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PPG PP G PPP G PP AP PP P Sbjct: 311 PPPNPAVPPPGVPPPGIPPPGIPPPGVPPPPAPGVPPPPAP 351 Score = 64.3 bits (155), Expect = 4e-09 Identities = 43/108 (39%), Positives = 44/108 (40%), Gaps = 18/108 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYP----PEGYGKEGYPPPGYPP-PGYPPQGY---- 186 G PPM + PP PPP G P P G PPP PP P PP G Sbjct: 240 GIQARPPMP---ENMPP---PPPGGLPMPPMPPGTPAPPVPPPQLPPAPVVPPPGVHPPV 293 Query: 187 PPQGYPPPGYPPQGYPPPP---------YSAQGYPPQYAPQYAQPPPP 303 PP PPPG PP G PPPP G PP P PPPP Sbjct: 294 PPPSLPPPGVPPPGVPPPPPNPAVPPPGVPPPGIPPPGIPPPGVPPPP 341 Score = 56.6 bits (135), Expect = 8e-07 Identities = 39/89 (43%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP-QGYPPPG 213 +P PP PP G PPP G PP P PG PPP P PP G PPP Sbjct: 314 NPAVPPPGVPPPGIPPPGIPPP-GVPPP-------PAPGVPPPPAPGVPLPPTPGVPPP- 364 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 P G PPPP A G PP AP P P Sbjct: 365 -PAPGVPPPP--APGVPPP-APGVLPPGP 389 [154][TOP] >UniRef100_A3Q762 Putative conserved transmembrane protein n=1 Tax=Mycobacterium sp. JLS RepID=A3Q762_MYCSJ Length = 398 Score = 83.2 bits (204), Expect = 8e-15 Identities = 41/68 (60%), Positives = 44/68 (64%) Frame = +1 Query: 97 PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYA 276 P +GYPP GY ++GYPPPGY GYPP GY QGYPPPGY GYPPP Y PP Y Sbjct: 11 PGRGYPPPGY-QQGYPPPGYQQ-GYPPPGYQ-QGYPPPGYQ-HGYPPPGYQHGYPPPGYP 66 Query: 277 PQYAQPPP 300 PQ PP Sbjct: 67 PQQGYAPP 74 Score = 79.3 bits (194), Expect = 1e-13 Identities = 44/75 (58%), Positives = 46/75 (61%), Gaps = 12/75 (16%) Frame = +1 Query: 79 PPVGTPPP---QGYPPEGYGKEGYPPPGY----PPPGY----PPQGYPPQGYPPPGYPP- 222 P G PPP QGYPP GY ++GYPPPGY PPPGY PP GY GYPPPGYPP Sbjct: 11 PGRGYPPPGYQQGYPPPGY-QQGYPPPGYQQGYPPPGYQHGYPPPGY-QHGYPPPGYPPQ 68 Query: 223 QGYPPPPYSAQGYPP 267 QGY PP G P Sbjct: 69 QGYAPPGVIKPGVIP 83 Score = 69.7 bits (169), Expect = 1e-10 Identities = 39/70 (55%), Positives = 40/70 (57%), Gaps = 7/70 (10%) Frame = +1 Query: 49 PPMSYYNQQQPP---VGTPPP---QGYPPEGYGKEGYPPPGYPPPGYPPQGYPP-QGYPP 207 PP Y PP G PPP QGYPP GY + GYPPPGY GYPP GYPP QGY P Sbjct: 16 PPPGYQQGYPPPGYQQGYPPPGYQQGYPPPGY-QHGYPPPGY-QHGYPPPGYPPQQGYAP 73 Query: 208 PGYPPQGYPP 237 PG G P Sbjct: 74 PGVIKPGVIP 83 Score = 65.1 bits (157), Expect = 2e-09 Identities = 34/59 (57%), Positives = 36/59 (61%) Frame = +1 Query: 136 GYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHH 312 G P GYPPPGY QGYPPPGY QGYPPP Y QGYPP Q+ PPP + H Sbjct: 9 GGPGRGYPPPGYQ------QGYPPPGYQ-QGYPPPGYQ-QGYPPP-GYQHGYPPPGYQH 58 [155][TOP] >UniRef100_A1UMS7 Putative conserved transmembrane protein n=2 Tax=Mycobacterium RepID=A1UMS7_MYCSK Length = 398 Score = 83.2 bits (204), Expect = 8e-15 Identities = 41/68 (60%), Positives = 44/68 (64%) Frame = +1 Query: 97 PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYA 276 P +GYPP GY ++GYPPPGY GYPP GY QGYPPPGY GYPPP Y PP Y Sbjct: 11 PGRGYPPPGY-QQGYPPPGYQQ-GYPPPGYQ-QGYPPPGYQ-HGYPPPGYQHGYPPPGYP 66 Query: 277 PQYAQPPP 300 PQ PP Sbjct: 67 PQQGYAPP 74 Score = 79.7 bits (195), Expect = 9e-14 Identities = 44/75 (58%), Positives = 46/75 (61%), Gaps = 12/75 (16%) Frame = +1 Query: 79 PPVGTPPP---QGYPPEGYGKEGYPPPGY----PPPGY----PPQGYPPQGYPPPGYPP- 222 P G PPP QGYPP GY ++GYPPPGY PPPGY PP GY GYPPPGYPP Sbjct: 11 PGRGYPPPGYQQGYPPPGY-QQGYPPPGYQQGYPPPGYQHGYPPPGY-QHGYPPPGYPPQ 68 Query: 223 QGYPPPPYSAQGYPP 267 QGY PP G P Sbjct: 69 QGYAPPDVIKPGVIP 83 Score = 67.0 bits (162), Expect = 6e-10 Identities = 38/70 (54%), Positives = 39/70 (55%), Gaps = 7/70 (10%) Frame = +1 Query: 49 PPMSYYNQQQPP---VGTPPP---QGYPPEGYGKEGYPPPGYPPPGYPPQGYPP-QGYPP 207 PP Y PP G PPP QGYPP GY + GYPPPGY GYPP GYPP QGY P Sbjct: 16 PPPGYQQGYPPPGYQQGYPPPGYQQGYPPPGY-QHGYPPPGY-QHGYPPPGYPPQQGYAP 73 Query: 208 PGYPPQGYPP 237 P G P Sbjct: 74 PDVIKPGVIP 83 Score = 65.1 bits (157), Expect = 2e-09 Identities = 34/59 (57%), Positives = 36/59 (61%) Frame = +1 Query: 136 GYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHH 312 G P GYPPPGY QGYPPPGY QGYPPP Y QGYPP Q+ PPP + H Sbjct: 9 GGPGRGYPPPGYQ------QGYPPPGYQ-QGYPPPGYQ-QGYPPP-GYQHGYPPPGYQH 58 [156][TOP] >UniRef100_B9RG84 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RG84_RICCO Length = 89 Score = 83.2 bits (204), Expect = 8e-15 Identities = 50/115 (43%), Positives = 54/115 (46%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MS+Y+ QQ PV PPP YPP PP PP QG P PP GYP + Sbjct: 1 MSHYSHQQAPVYPPPPTSYPP--------PPSQLYPPPQAQQG-PYVAPPPVGYPMK--- 48 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 S GY PQ QPPP S GC G CA +CCCCLLDACF Sbjct: 49 ----SGVGY----IPQNQQPPP------SETKQRGGCCRGFCAGMCCCCLLDACF 89 [157][TOP] >UniRef100_B7G9U8 Predicted protein n=1 Tax=Phaeodactylum tricornutum CCAP 1055/1 RepID=B7G9U8_PHATR Length = 561 Score = 83.2 bits (204), Expect = 8e-15 Identities = 51/115 (44%), Positives = 55/115 (47%), Gaps = 25/115 (21%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQ-----GYPP---EGYGKEGYPPP--GYPPPG------- 168 P +PP+ PP G PPP G PP +GYG GYPPP GYPPP Sbjct: 37 PHSPPLGGIGPPPPPQGGPPPGNSRGGGPPPPSHQGYG--GYPPPHMGYPPPSGPEGQAP 94 Query: 169 YPPQGY--------PPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 YPP+GY P G PPGYPP G PP G PQY PPPPHH Sbjct: 95 YPPRGYENAPPYPGPGYGQHPPGYPPYGMPP-----YGMYPQYQHSMYGPPPPHH 144 Score = 66.6 bits (161), Expect = 8e-10 Identities = 47/118 (39%), Positives = 51/118 (43%), Gaps = 16/118 (13%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPP-VGTPPPQG------YPPEGYGKE--------GYPPPGYPPPG 168 G P P Y PP +G PPP G YPP GY G PPGYPP G Sbjct: 63 GGPPPPSHQGYGGYPPPHMGYPPPSGPEGQAPYPPRGYENAPPYPGPGYGQHPPGYPPYG 122 Query: 169 YPPQG-YPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSP 339 PP G YP + G PP +P PP+ G PPQ P Y P P NSN P Sbjct: 123 MPPYGMYPQYQHSMYGPPPPHHPYPPH---GQPPQ-QPYYGDPNMP-GGGNSNGPHPP 175 [158][TOP] >UniRef100_Q3BDP3 Rhodopsin (Fragment) n=1 Tax=Lolliguncula brevis RepID=Q3BDP3_9MOLL Length = 296 Score = 83.2 bits (204), Expect = 8e-15 Identities = 42/67 (62%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP-GYPPQGYPPPPY 246 QQ PPPQGYPP+GY PPP PPQGYPPQGYPPP GYPPQGYPPP Sbjct: 243 QQAAQPAYPPPQGYPPQGY----------PPP--PPQGYPPQGYPPPQGYPPQGYPPP-- 288 Query: 247 SAQGYPP 267 QG PP Sbjct: 289 --QGPPP 293 Score = 74.3 bits (181), Expect = 4e-12 Identities = 35/51 (68%), Positives = 35/51 (68%), Gaps = 2/51 (3%) Frame = +1 Query: 148 PGYPPP-GYPPQGYPPQGYPPPGYPPQGYPPPP-YSAQGYPPQYAPQYAQP 294 P YPPP GYPPQGYPP PP GYPPQGYPPP Y QGYPP P A P Sbjct: 248 PAYPPPQGYPPQGYPPP--PPQGYPPQGYPPPQGYPPQGYPPPQGPPPAGP 296 Score = 64.3 bits (155), Expect = 4e-09 Identities = 34/64 (53%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-GYPPPGYPPQGYPPQGY 201 Q P PP Y PP G PPP PP+GY +GYPPP GYPP GYP PPQG Sbjct: 243 QQAAQPAYPPPQGY----PPQGYPPP---PPQGYPPQGYPPPQGYPPQGYP----PPQGP 291 Query: 202 PPPG 213 PP G Sbjct: 292 PPAG 295 Score = 60.5 bits (145), Expect = 6e-08 Identities = 28/48 (58%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGK-EGYPPPGYPPPGYPPQGYP 189 PP Y Q PP PPPQGYPP+GY +GYPP GYPPP PP P Sbjct: 252 PPQGYPPQGYPP---PPPQGYPPQGYPPPQGYPPQGYPPPQGPPPAGP 296 Score = 58.2 bits (139), Expect = 3e-07 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 4/50 (8%) Frame = +1 Query: 163 PGYPPQGYPPQGYPPPGY---PPQGYPPPPY-SAQGYPPQYAPQYAQPPP 300 P YPP PQGYPP GY PPQGYPP Y QGYPPQ P PPP Sbjct: 248 PAYPP----PQGYPPQGYPPPPPQGYPPQGYPPPQGYPPQGYPPPQGPPP 293 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/48 (52%), Positives = 28/48 (58%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYP 174 +G+P PP Y PP G PPPQGYPP+GY PPP PPP P Sbjct: 259 QGYPPPPPQGY-----PPQGYPPPQGYPPQGY-----PPPQGPPPAGP 296 [159][TOP] >UniRef100_Q0D327 Rhodopsin (Fragment) n=1 Tax=Sepiella japonica RepID=Q0D327_9MOLL Length = 154 Score = 83.2 bits (204), Expect = 8e-15 Identities = 48/78 (61%), Positives = 49/78 (62%), Gaps = 8/78 (10%) Frame = +1 Query: 55 MSYYNQQQ---PPVGTPPPQG-YPPEGYGKEGYPPP---GYPPPGYPPQGYPPQGYPP-P 210 M QQQ PP G PPQG YPP+G GYPPP GYPP GYPP PPQGYPP Sbjct: 88 MQKMQQQQAAYPPQGAYPPQGGYPPQG----GYPPPPQGGYPPQGYPP---PPQGYPPAQ 140 Query: 211 GYPPQGYPPPPYSAQGYP 264 GYPPQGYPPP QG P Sbjct: 141 GYPPQGYPPP----QGAP 154 Score = 73.9 bits (180), Expect = 5e-12 Identities = 43/76 (56%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Frame = +1 Query: 73 QQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 QQ PP YPP+G GYPP G YPPP P GYPPQGYPPP PQGYPP Sbjct: 92 QQQQAAYPPQGAYPPQG----GYPPQGGYPPP--PQGGYPPQGYPPP---PQGYPP---- 138 Query: 250 AQGYPPQYAPQYAQPP 297 AQGYPPQ PP Sbjct: 139 AQGYPPQ----GYPPP 150 [160][TOP] >UniRef100_Q0D317 Rhodopsin (Fragment) n=1 Tax=Galiteuthis sp. JMS-2004 RepID=Q0D317_9MOLL Length = 298 Score = 83.2 bits (204), Expect = 8e-15 Identities = 46/72 (63%), Positives = 47/72 (65%), Gaps = 3/72 (4%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG-YPPQG-YPPQG-YPPPGYPPQGYPPP 240 QQQP PPP GYPP +GYPP GYPP G YPPQG YPPQG YPP GYPPQG PP Sbjct: 238 QQQPAY--PPPAGYPP----PQGYPPQGYPPQGAYPPQGAYPPQGAYPPQGYPPQGAPP- 290 Query: 241 PYSAQGYPPQYA 276 QG PP A Sbjct: 291 ----QGAPPAAA 298 Score = 75.1 bits (183), Expect = 2e-12 Identities = 38/55 (69%), Positives = 38/55 (69%), Gaps = 5/55 (9%) Frame = +1 Query: 148 PGYPPP-GYPP-QGYPPQGYPPPG-YPPQGYPPP--PYSAQGYPPQYAPQYAQPP 297 P YPPP GYPP QGYPPQGYPP G YPPQG PP Y QGYPPQ AP PP Sbjct: 241 PAYPPPAGYPPPQGYPPQGYPPQGAYPPQGAYPPQGAYPPQGYPPQGAPPQGAPP 295 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/59 (54%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG-YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 G+P PP Y Q PP G PPQG YPP+G YPP GYPPQG PPQG PP Sbjct: 248 GYP--PPQGYPPQGYPPQGAYPPQGAYPPQG---------AYPPQGYPPQGAPPQGAPP 295 [161][TOP] >UniRef100_Q8AVV0 Sf3a2-prov protein n=1 Tax=Xenopus laevis RepID=Q8AVV0_XENLA Length = 405 Score = 82.8 bits (203), Expect = 1e-14 Identities = 43/92 (46%), Positives = 43/92 (46%), Gaps = 4/92 (4%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPP----PGYPPQGYPPQGYPP 207 P PP PP G PPP PP G PPPG PP P PP G PP G P Sbjct: 271 PPVPPPQLPPAPVPPPGVPPP--VPPPSLPPPGVPPPGVPPLPPNPSVPPPGVPPPGIRP 328 Query: 208 PGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PG PP G PPPP G PP AP PP P Sbjct: 329 PGIPPPGVPPPP--TPGVPPPPAPGVPPPPTP 358 Score = 74.7 bits (182), Expect = 3e-12 Identities = 43/88 (48%), Positives = 43/88 (48%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P PP S PP G PPP G PP PPPG PPPG P G PP G PPP P Sbjct: 290 PPVPPPSL-----PPPGVPPP-GVPPLP-PNPSVPPPGVPPPGIRPPGIPPPGVPPP--P 340 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 G PPPP A G PP P PP P Sbjct: 341 TPGVPPPP--APGVPPPPTPGVPPPPAP 366 Score = 54.3 bits (129), Expect = 4e-06 Identities = 41/102 (40%), Positives = 42/102 (41%), Gaps = 12/102 (11%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-----------GYPPPGYPPQ 180 G P PP N PP G PPP G P G G PPP G PPP Sbjct: 306 GVPPLPP----NPSVPPPGVPPP-GIRPPGIPPPGVPPPPTPGVPPPPAPGVPPP----- 355 Query: 181 GYPPQGYPPPGYPPQGYPPPPYSAQG-YPPQYAPQYAQPPPP 303 P G PPP P G PPPP A G PP P +PP P Sbjct: 356 --PTPGVPPP--PAPGVPPPP--APGVLPPGPMPPMMRPPLP 391 [162][TOP] >UniRef100_C6T398 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=C6T398_SOYBN Length = 161 Score = 82.8 bits (203), Expect = 1e-14 Identities = 61/135 (45%), Positives = 67/135 (49%), Gaps = 2/135 (1%) Frame = -2 Query: 403 LRSRHPIDSNSREQHNSLLSNQGSMNCCCYYDDEVVVVERIEERTEEDNLALSMVAVDIL 224 LRS HP DS+SR Q NSL +NQG +N + ERIEER ED A A D L Sbjct: 42 LRSTHPKDSSSRGQPNSLPNNQGRLNFV-----DGAEAERIEERRAEDTPAPGRAAEDSL 96 Query: 223 VVDNPAEDILAVDILVVDIPVVDIPVADILPFRIPPADNLVAAEFRRVAVV--DCNNSLV 50 V A DI V IP I D LPFR PPA NL A E R AVV CNNSL Sbjct: 97 V---------AADIPAVGIPAAGILAVDSLPFRTPPAYNLAAVELRLAAVVAAGCNNSLR 147 Query: 49 VL*GGHGVVNCLLCL 5 G + +CL Sbjct: 148 ---NGVSEIGIFICL 159 [163][TOP] >UniRef100_A5C9F0 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5C9F0_VITVI Length = 296 Score = 82.8 bits (203), Expect = 1e-14 Identities = 54/114 (47%), Positives = 55/114 (48%), Gaps = 23/114 (20%) Frame = +1 Query: 49 PPMSYYN--QQQPPVGTPPPQGYPPE------GYGKEGYPPP-GYPPPGYPPQG-YPPQG 198 PP Y QQ+ P PPQGYPP GY GYPPP G PP YPP G YP G Sbjct: 139 PPQQCYPPPQQRYPPPAYPPQGYPPAKYSSPFGYPASGYPPPCGLPPAEYPPPGSYPAAG 198 Query: 199 YPPP-GYPPQGYPPP-PYSAQGYPPQ-------YAPQYAQP----PPPHHHNNS 321 YP P G PP YPPP Y A GYPP Y P P PPP H S Sbjct: 199 YPSPCGLPPAEYPPPGSYPAAGYPPPGGHPAVGYPPLGGHPPVGYPPPGGHPTS 252 Score = 77.8 bits (190), Expect = 4e-13 Identities = 42/77 (54%), Positives = 47/77 (61%), Gaps = 5/77 (6%) Frame = +1 Query: 49 PPMSYYNQQQP-PVGTPPPQGYPPEGYGKEGYPPPG-YPPPGYPPQG-YPPQGYPPP-GY 216 PP SY P P G PP + PP Y GYPPPG +P GYPP G +PP GYPPP G+ Sbjct: 190 PPGSYPAAGYPSPCGLPPAEYPPPGSYPAAGYPPPGGHPAVGYPPLGGHPPVGYPPPGGH 249 Query: 217 PPQGYPPP-PYSAQGYP 264 P GYPPP + A GYP Sbjct: 250 PTSGYPPPGGHPAAGYP 266 Score = 77.0 bits (188), Expect = 6e-13 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 5/98 (5%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYP-PEGYGKEGYPPPG-YPPPGYPPQG-YPPQGYP 204 G+P PP + PP G+ P GYP P G YPPPG YP GYPP G +P GYP Sbjct: 176 GYP--PPCGLPPAEYPPPGSYPAAGYPSPCGLPPAEYPPPGSYPAAGYPPPGGHPAVGYP 233 Query: 205 P-PGYPPQGYPPPP-YSAQGYPPQYAPQYAQPPPPHHH 312 P G+PP GYPPP + GYPP A P P H Sbjct: 234 PLGGHPPVGYPPPGGHPTSGYPPPGGHPAAGYPAPGGH 271 Score = 64.3 bits (155), Expect = 4e-09 Identities = 37/76 (48%), Positives = 38/76 (50%), Gaps = 15/76 (19%) Frame = +1 Query: 121 GYGKEGYPPPG-------YPPPG--YPPQGYPPQGYPPPGYPPQGYPPPPYS------AQ 255 GY Y PP YPPP YPP P Q YPPP YPPQGYPP YS A Sbjct: 119 GYDAGNYRPPHMACPQQYYPPPQQCYPP---PQQRYPPPAYPPQGYPPAKYSSPFGYPAS 175 Query: 256 GYPPQYAPQYAQPPPP 303 GYPP A+ PPP Sbjct: 176 GYPPPCGLPPAEYPPP 191 [164][TOP] >UniRef100_B1N5N3 Putative uncharacterized protein n=1 Tax=Entamoeba histolytica HM-1:IMSS RepID=B1N5N3_ENTHI Length = 343 Score = 82.8 bits (203), Expect = 1e-14 Identities = 52/108 (48%), Positives = 58/108 (53%), Gaps = 9/108 (8%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP----PGYPPPGYPPQGYPP 192 Q +G+P P Y Q Q PPPQGYP + YPP P YPP GYP YPP Sbjct: 242 QFQGYPQQQPYPYPQQYQ----YPPPQGYPQQ---PGQYPPQQSYPQYPPQGYPQ--YPP 292 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPP---QYAPQ--YAQPPPPHHHNNS 321 QGYP YPPQGYP Y QGYP QY PQ Y Q PP +H+ + Sbjct: 293 QGYPQ--YPPQGYPQ--YPPQGYPQQPGQYPPQQGYPQYPPQAYHSQA 336 [165][TOP] >UniRef100_Q7S9H3 Putative uncharacterized protein n=1 Tax=Neurospora crassa RepID=Q7S9H3_NEUCR Length = 825 Score = 82.8 bits (203), Expect = 1e-14 Identities = 47/98 (47%), Positives = 52/98 (53%), Gaps = 6/98 (6%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEG-YGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 HP PP + Y Q PP PPP Y P+ YG+ YPPP YPP Y P G PP PPPG Sbjct: 135 HP--PPPAVYGQF-PPAAPPPPSQYAPQPPYGQPQYPPP-YPPSNYYPNGVPP---PPPG 187 Query: 214 -YPPQGY----PPPPYSAQGYPPQYAPQYAQPPPPHHH 312 YPPQ Y PP P PP Y Y+ PP P +H Sbjct: 188 AYPPQPYSQPGPPLPVPPPPVPPPYPSSYSGPPQPEYH 225 Score = 71.2 bits (173), Expect = 3e-11 Identities = 38/90 (42%), Positives = 43/90 (47%), Gaps = 2/90 (2%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP--G 213 P PP +YY PP PPP YPP+ Y + G P P PPP PP G P P Sbjct: 169 PPYPPSNYYPNGVPP---PPPGAYPPQPYSQPGPPLPVPPPPVPPPYPSSYSGPPQPEYH 225 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 Y P PP P PP +AP + PPPP Sbjct: 226 YSPGQQPPYPPPTGWVPPPFAPPHLPPPPP 255 Score = 61.2 bits (147), Expect = 3e-08 Identities = 43/119 (36%), Positives = 49/119 (41%), Gaps = 34/119 (28%) Frame = +1 Query: 49 PPMSYYNQQQPPV---GTPPP---QGYPPEGYGKEGYPPP-------GYPPPG-----YP 174 P ++ Y QPP G PPP Q YPP + PPP +PPP +P Sbjct: 87 PTITRYGPPQPPAYPPGAPPPPSIQAYPPASFPPPPPPPPLPTYSGSYHPPPPAVYGQFP 146 Query: 175 PQGYPPQG----------------YPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P PP YPP Y P G PPPP A YPPQ Y+QP PP Sbjct: 147 PAAPPPPSQYAPQPPYGQPQYPPPYPPSNYYPNGVPPPPPGA--YPPQ---PYSQPGPP 200 Score = 60.8 bits (146), Expect = 4e-08 Identities = 46/121 (38%), Positives = 58/121 (47%), Gaps = 23/121 (19%) Frame = +1 Query: 25 QHR-GHPTTPPMSYYNQQQPPVGT---PPPQGYPPEGYGKEGYP--PPGYPPP----GYP 174 QH+ GH + + ++++ P V PP QG YG P PPG PPP YP Sbjct: 55 QHQEGHSSDRNAASHDKKGPVVTRYPLPPSQGPTITRYGPPQPPAYPPGAPPPPSIQAYP 114 Query: 175 PQGYPPQGYPP--PGYPPQGYPPPPYSAQGYPP-------QYAPQ--YAQP--PPPHHHN 315 P +PP PP P Y +PPPP +PP QYAPQ Y QP PPP+ + Sbjct: 115 PASFPPPPPPPPLPTYSGSYHPPPPAVYGQFPPAAPPPPSQYAPQPPYGQPQYPPPYPPS 174 Query: 316 N 318 N Sbjct: 175 N 175 [166][TOP] >UniRef100_Q2H239 Putative uncharacterized protein n=1 Tax=Chaetomium globosum RepID=Q2H239_CHAGB Length = 904 Score = 82.8 bits (203), Expect = 1e-14 Identities = 48/114 (42%), Positives = 53/114 (46%), Gaps = 11/114 (9%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPP-PGY------PPQGYPP 192 G+ PP +Y Q P PPQ YG YPP YPP PGY PP PP Sbjct: 282 GYQPPPPPPHYGQYPAPPA--PPQYVQQSPYGPPSYPPAQYPPAPGYYAPGAAPPPAPPP 339 Query: 193 QGYPPPGYPPQGY----PPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 YPP YPPQ Y PPPP S+ YPPQ P PPPH+ + PG Sbjct: 340 PSYPPGTYPPQQYGLPPPPPPSSSAAYPPQ--PGSTPYPPPHYPPQPPPTPPPG 391 Score = 81.3 bits (199), Expect = 3e-14 Identities = 47/100 (47%), Positives = 47/100 (47%), Gaps = 8/100 (8%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTP--PPQGYPPE-GYGKEGY-PPPGYPPPGYPPQGYPPQ 195 H G PP QQ P G P PP YPP GY G PPP PPP YPP YPPQ Sbjct: 291 HYGQYPAPPAPPQYVQQSPYGPPSYPPAQYPPAPGYYAPGAAPPPAPPPPSYPPGTYPPQ 350 Query: 196 GY----PPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 Y PPP YPP P S PP Y PQ PPP Sbjct: 351 QYGLPPPPPPSSSAAYPPQPGSTPYPPPHYPPQPPPTPPP 390 Score = 70.5 bits (171), Expect = 6e-11 Identities = 41/99 (41%), Positives = 42/99 (42%), Gaps = 14/99 (14%) Frame = +1 Query: 52 PMSYYNQQQPPV------GTPPPQGYPPEGYGKEGYPPPGY----PPPGYPPQGYPPQ-- 195 P SY Q PP G PP PP Y YPP Y PPP YPPQ Sbjct: 312 PPSYPPAQYPPAPGYYAPGAAPPPAPPPPSYPPGTYPPQQYGLPPPPPPSSSAAYPPQPG 371 Query: 196 --GYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPH 306 YPPP YPPQ P PP A Y P P Y P P + Sbjct: 372 STPYPPPHYPPQPPPTPPPGAFHYTPSQPPPYPPPQPQY 410 Score = 65.5 bits (158), Expect = 2e-09 Identities = 46/106 (43%), Positives = 48/106 (45%), Gaps = 13/106 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPP--VGTPPPQ------GYPPEGYGKEGYPPPGYP--PPGYPPQG-- 183 P PP SY PP G PPP YPP+ G YPPP YP PP PP G Sbjct: 335 PAPPPPSYPPGTYPPQQYGLPPPPPPSSSAAYPPQP-GSTPYPPPHYPPQPPPTPPPGAF 393 Query: 184 -YPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNN 318 Y P PP YPP P P YS PP + P YA PP H N Sbjct: 394 HYTPS--QPPPYPP---PQPQYSP---PPGWVPPYAGPPSTPHSAN 431 Score = 60.8 bits (146), Expect = 4e-08 Identities = 40/106 (37%), Positives = 46/106 (43%), Gaps = 14/106 (13%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGT---PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP- 192 QH+ H + ++ P+ T PPP P YG PPP YP G P PP Sbjct: 207 QHKEHGKSERSGSSRDKKGPIVTHYPPPPPATPATPYGPS--PPPPYPL-GVTPPPPPPP 263 Query: 193 ---QGYPPPGYPPQGY-------PPPPYSAQGYPPQYAPQYAQPPP 300 QGY P GYPP Y PPPP+ Q P PQY Q P Sbjct: 264 GTAQGYSPAGYPPNPYPGGYQPPPPPPHYGQYPAPPAPPQYVQQSP 309 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/66 (46%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Frame = +1 Query: 139 YPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPP--------YSAQGYPPQYAPQYAQP 294 YPPP PP P Y P PPP YP PPPP YS GYPP P QP Sbjct: 231 YPPP---PPATPATPYGPS--PPPPYPLGVTPPPPPPPGTAQGYSPAGYPPNPYPGGYQP 285 Query: 295 PPPHHH 312 PPP H Sbjct: 286 PPPPPH 291 [167][TOP] >UniRef100_UPI000023E1CE hypothetical protein FG05064.1 n=1 Tax=Gibberella zeae PH-1 RepID=UPI000023E1CE Length = 115 Score = 82.4 bits (202), Expect = 1e-14 Identities = 51/118 (43%), Positives = 54/118 (45%), Gaps = 6/118 (5%) Frame = +1 Query: 64 YNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP-QGYPPQGYPPPGYPPQGYPPP 240 + Q PP PP G P YG GY Y G PP QGY Q P GYP Q P P Sbjct: 3 FKQDAPPPAYGPPPGAPQPTYG--GYQQDPYQQGGAPPPQGYYQQAPPQMGYPQQQGPFP 60 Query: 241 PYSAQG-YPPQYAPQYAQPPP----PHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 + QG YPPQ P Y QPPP PH N G + G A L CCC LD F Sbjct: 61 --AGQGPYPPQQGP-YGQPPPQGYYPHDDQRGNGGGGGGLMTGLLAGLACCCCLDCLF 115 [168][TOP] >UniRef100_B9ZLI6 Putative uncharacterized protein n=1 Tax=Thioalkalivibrio sp. K90mix RepID=B9ZLI6_9GAMM Length = 234 Score = 82.4 bits (202), Expect = 1e-14 Identities = 41/90 (45%), Positives = 46/90 (51%), Gaps = 3/90 (3%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPP---PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP 210 P PP + Q + P G PP PQG PP+G +G PP G PP G PPQG PPQG PP Sbjct: 122 PGEPPGARDPQGRDPQGAPPGQGPQGQPPQGQPPQGQPPQGQPPQGQPPQGQPPQGQPPQ 181 Query: 211 GYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 G PP G PP A+ PPP Sbjct: 182 GQPPGGQDMPPRDAEPPGGTSGDGPGDPPP 211 Score = 80.5 bits (197), Expect = 5e-14 Identities = 42/98 (42%), Positives = 46/98 (46%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PP QQ+ PP P+G +G PPG P G PPQG PPQG PP G PPQG Sbjct: 109 PPQQRDPQQRDVEPGEPPGARDPQGRDPQG-APPGQGPQGQPPQGQPPQGQPPQGQPPQG 167 Query: 229 YPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 PP QG PPQ P Q PP +S G Sbjct: 168 QPPQGQPPQGQPPQGQPPGGQDMPPRDAEPPGGTSGDG 205 Score = 70.9 bits (172), Expect = 4e-11 Identities = 41/93 (44%), Positives = 42/93 (45%), Gaps = 20/93 (21%) Frame = +1 Query: 79 PPVGTPP---PQGYPPEGYGKE-------------GYPPPGYPPPGYPPQGYPP----QG 198 PP G PP P G PP G G+ G PP P G PQG PP QG Sbjct: 88 PPGGAPPGGTPGGAPPPGQGEPPQQRDPQQRDVEPGEPPGARDPQGRDPQGAPPGQGPQG 147 Query: 199 YPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PP G PPQG PP QG PPQ P QPP Sbjct: 148 QPPQGQPPQGQPPQGQPPQGQPPQGQPPQGQPP 180 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/84 (40%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP 210 +G PP Q QPP G PPQG PP+G +G PP G PP G Q PP+ PP Sbjct: 143 QGPQGQPPQGQPPQGQPPQG-QPPQGQPPQGQPPQGQPPQGQPPGG---QDMPPRDAEPP 198 Query: 211 GYPP---QGYPPPPYSAQGYPPQY 273 G G PPP G P + Sbjct: 199 GGTSGDGPGDPPPTEGGMGDEPSF 222 [169][TOP] >UniRef100_UPI0000EB0B28 Histidine-rich glycoprotein precursor (Histidine-proline-rich glycoprotein) (HPRG). n=1 Tax=Canis lupus familiaris RepID=UPI0000EB0B28 Length = 551 Score = 81.6 bits (200), Expect = 2e-14 Identities = 40/108 (37%), Positives = 51/108 (47%), Gaps = 14/108 (12%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPP--------------PQGYPPEGYGKEGYPPPGYPPP 165 H GHP PP PP G PP P G PP G+ G+ P G+PP Sbjct: 276 HFGHPHGPPP----HGPPPHGPPPHGHHPHGPCPHGRPPFGPPPHGHPPHGHHPHGHPPH 331 Query: 166 GYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 G+ P G+PP + P G+ P G+PP + G+PP P + PP HH Sbjct: 332 GHHPHGHPPHKHHPHGHHPHGHPPHEHHPHGHPPHGPPPHGPPPHEHH 379 Score = 80.9 bits (198), Expect = 4e-14 Identities = 42/109 (38%), Positives = 53/109 (48%), Gaps = 15/109 (13%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYP----------P 177 H HP P +PP G PPP G+PP G+ G+PP G+ P G+P P Sbjct: 296 HGHHPHGP----CPHGRPPFG-PPPHGHPPHGHHPHGHPPHGHHPHGHPPHKHHPHGHHP 350 Query: 178 QGYP-----PQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 G+P P G+PP G PP G PP + G+PP P + PP HH Sbjct: 351 HGHPPHEHHPHGHPPHGPPPHGPPPHEHHPHGHPPHGPPPHGPPPHEHH 399 Score = 80.9 bits (198), Expect = 4e-14 Identities = 39/99 (39%), Positives = 49/99 (49%), Gaps = 5/99 (5%) Frame = +1 Query: 28 HRGHPTT-PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP 192 H HP PP ++ PP P P G+PP + G+PP G PP G PP + P Sbjct: 321 HGHHPHGHPPHGHHPHGHPPHKHHPHGHHPHGHPPHEHHPHGHPPHGPPPHGPPPHEHHP 380 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 G+PP G PP G PP + G+PP P + PP HH Sbjct: 381 HGHPPHGPPPHGPPPHEHHPHGHPPHGPPPHGPPPHEHH 419 Score = 74.3 bits (181), Expect = 4e-12 Identities = 40/110 (36%), Positives = 50/110 (45%), Gaps = 16/110 (14%) Frame = +1 Query: 28 HRGHPTT-PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 H HP PP ++ PP G PPP G PP + G+PP G PP G PP + P G+P Sbjct: 346 HGHHPHGHPPHEHHPHGHPPHG-PPPHGPPPHEHHPHGHPPHGPPPHGPPPHEHHPHGHP 404 Query: 205 PPGYPPQGYPPPPYSAQGYPPQY---------------APQYAQPPPPHH 309 P G PP G PP + G+ P P ++Q P HH Sbjct: 405 PHGPPPHGPPPHEHHPHGHHPHKHHPHDHDFHDHGPCDLPPHSQSPQDHH 454 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/80 (38%), Positives = 38/80 (47%) Frame = +1 Query: 100 PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 P G PP G PP G PP G+ P G P G PP G PP G+PP + G+PP Sbjct: 280 PHGPPPHGP-----PPHGPPPHGHHPHGPCPHGRPPFGPPPHGHPPHGHHPHGHPPHGHH 334 Query: 280 QYAQPPPPHHHNNSNNSSSP 339 + PP HH + + P Sbjct: 335 PHGHPPHKHHPHGHHPHGHP 354 Score = 53.1 bits (126), Expect = 9e-06 Identities = 31/103 (30%), Positives = 41/103 (39%), Gaps = 11/103 (10%) Frame = +1 Query: 34 GHPT-------TPPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQ 180 GHP PP ++ PP G PP P + P G+ G PP G PP + P Sbjct: 362 GHPPHGPPPHGPPPHEHHPHGHPPHGPPPHGPPPHEHHPHGHPPHGPPPHGPPPHEHHPH 421 Query: 181 GYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 G+ P + P + + P PQ + Q PPP H Sbjct: 422 GHHPHKHHPHDHDFHDHGPCDLPPHSQSPQDHHRQGQGPPPQH 464 [170][TOP] >UniRef100_B8Q2W3 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W3_9MOLL Length = 448 Score = 81.6 bits (200), Expect = 2e-14 Identities = 40/66 (60%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQG-YPPQGYPPP-GYPPQGYPPPP 243 QQ PPQGYPP+GY PP GYPP GYPPQG YPPQGYPPP G PPQ PP Sbjct: 384 QQAQQQAAYPPQGYPPQGYPP---PPQGYPPQGYPPQGAYPPQGYPPPQGAPPQAAPPEG 440 Query: 244 YSAQGY 261 Q Y Sbjct: 441 VDNQAY 446 Score = 80.9 bits (198), Expect = 4e-14 Identities = 38/57 (66%), Positives = 40/57 (70%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 YPP+GY +GYPPP P GYPPQGYPPQG YPPQGYPPP QG PPQ AP Sbjct: 392 YPPQGYPPQGYPPP---PQGYPPQGYPPQG----AYPPQGYPPP----QGAPPQAAP 437 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/60 (56%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = +1 Query: 58 SYYNQQQPPVG-TPPPQGYPPEGYGKEG-YPPPGYPPPGYPPQGYPPQGYPPPGYPPQGY 231 +Y Q PP G PPPQGYPP+GY +G YPP GYP PPQG PPQ PP G Q Y Sbjct: 391 AYPPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYP----PPQGAPPQAAPPEGVDNQAY 446 Score = 65.5 bits (158), Expect = 2e-09 Identities = 34/55 (61%), Positives = 35/55 (63%), Gaps = 5/55 (9%) Frame = +1 Query: 169 YPPQGYPPQGYPPPGYPPQGYPPPPYSAQG-YPPQ-YAPQYAQPP---PPHHHNN 318 YPPQGYPPQGYPPP PQGYPP Y QG YPPQ Y P PP PP +N Sbjct: 392 YPPQGYPPQGYPPP---PQGYPPQGYPPQGAYPPQGYPPPQGAPPQAAPPEGVDN 443 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +1 Query: 178 QGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ-YAPQYAQPP 297 Q YPP GYPPQGYPPPP QGYPPQ Y PQ A PP Sbjct: 385 QAQQQAAYPPQGYPPQGYPPPP---QGYPPQGYPPQGAYPP 422 [171][TOP] >UniRef100_B8Q2W2 Opsin n=1 Tax=Euprymna scolopes RepID=B8Q2W2_9MOLL Length = 448 Score = 81.6 bits (200), Expect = 2e-14 Identities = 40/66 (60%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQG-YPPQGYPPP-GYPPQGYPPPP 243 QQ PPQGYPP+GY PP GYPP GYPPQG YPPQGYPPP G PPQ PP Sbjct: 384 QQAQQQAAYPPQGYPPQGYPP---PPQGYPPQGYPPQGAYPPQGYPPPQGAPPQAAPPEG 440 Query: 244 YSAQGY 261 Q Y Sbjct: 441 VDNQAY 446 Score = 80.9 bits (198), Expect = 4e-14 Identities = 38/57 (66%), Positives = 40/57 (70%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 YPP+GY +GYPPP P GYPPQGYPPQG YPPQGYPPP QG PPQ AP Sbjct: 392 YPPQGYPPQGYPPP---PQGYPPQGYPPQG----AYPPQGYPPP----QGAPPQAAP 437 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/60 (56%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = +1 Query: 58 SYYNQQQPPVG-TPPPQGYPPEGYGKEG-YPPPGYPPPGYPPQGYPPQGYPPPGYPPQGY 231 +Y Q PP G PPPQGYPP+GY +G YPP GYP PPQG PPQ PP G Q Y Sbjct: 391 AYPPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYP----PPQGAPPQAAPPEGVDNQAY 446 Score = 65.5 bits (158), Expect = 2e-09 Identities = 34/55 (61%), Positives = 35/55 (63%), Gaps = 5/55 (9%) Frame = +1 Query: 169 YPPQGYPPQGYPPPGYPPQGYPPPPYSAQG-YPPQ-YAPQYAQPP---PPHHHNN 318 YPPQGYPPQGYPPP PQGYPP Y QG YPPQ Y P PP PP +N Sbjct: 392 YPPQGYPPQGYPPP---PQGYPPQGYPPQGAYPPQGYPPPQGAPPQAAPPEGVDN 443 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +1 Query: 178 QGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ-YAPQYAQPP 297 Q YPP GYPPQGYPPPP QGYPPQ Y PQ A PP Sbjct: 385 QAQQQAAYPPQGYPPQGYPPPP---QGYPPQGYPPQGAYPP 422 [172][TOP] >UniRef100_B4PDZ5 GE20284 n=1 Tax=Drosophila yakuba RepID=B4PDZ5_DROYA Length = 573 Score = 81.6 bits (200), Expect = 2e-14 Identities = 46/104 (44%), Positives = 51/104 (49%), Gaps = 24/104 (23%) Frame = +1 Query: 64 YNQQQPP----VGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGY 231 ++QQ PP PP QG P ++G P GYP GYP QGYP QGYP GY P GY Sbjct: 6 FSQQDPPPMGFASAPPQQGNP-----QQGNPQQGYPQHGYPQQGYPQQGYPQQGYRPSGY 60 Query: 232 P--------PPPYSA---------QGYPPQY---APQYAQPPPP 303 P PPP S QGYPPQ+ P Y P PP Sbjct: 61 PQTGHSWNAPPPQSGFSGYPPPPQQGYPPQFYGAPPGYGSPHPP 104 [173][TOP] >UniRef100_C8Z410 EC1118_1B15_1475p n=1 Tax=Saccharomyces cerevisiae EC1118 RepID=C8Z410_YEAST Length = 133 Score = 81.6 bits (200), Expect = 2e-14 Identities = 46/125 (36%), Positives = 52/125 (41%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q RG+P YY QQQ G QGY +GY ++GY GY GY QGY QGY Sbjct: 34 QERGYPPQQQQQYYQQQQQHPGYYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGYN 93 Query: 205 PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCL 384 G+ P Y Q PP N GCL C AALC CC Sbjct: 94 QQGHQQ------------------PVYVQQQPPQRGNE-------GCLAACLAALCICCT 128 Query: 385 LDACF 399 +D F Sbjct: 129 MDMLF 133 [174][TOP] >UniRef100_C5GES0 Metacaspase CasA n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GES0_AJEDR Length = 455 Score = 81.6 bits (200), Expect = 2e-14 Identities = 53/119 (44%), Positives = 57/119 (47%), Gaps = 17/119 (14%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP-----GYPPQGYPPQ- 195 G+P PP Y Q P G PPPQ YPP+ YG GYPP G PPP GY P PQ Sbjct: 15 GYP--PPQQQYPPQ--PYGAPPPQQYPPQSYG--GYPPQGPPPPQQNQYGYTPHTPSPQP 68 Query: 196 ----GY--PPPGYPPQGYPPPPYSAQGYPPQYAPQY-----AQPPPPHHHNNSNNSSSP 339 GY PPP P G PP S PP AP Y A PP P + NS N+ P Sbjct: 69 PYNGGYHAPPPQQPMYGALPPHPSVSPQPPNGAPMYSGRAGAAPPAPSPYPNSYNNQRP 127 Score = 64.7 bits (156), Expect = 3e-09 Identities = 38/79 (48%), Positives = 41/79 (51%), Gaps = 15/79 (18%) Frame = +1 Query: 109 YPPEGY--GKEGYPPPGYPPPGYPPQGY---PPQGYPPP---GYPPQGYPPPPYSAQGYP 264 YP +GY G+ GYPPP YPPQ Y PPQ YPP GYPPQG PPP + GY Sbjct: 4 YPSQGYAGGQGGYPPPQQQ---YPPQPYGAPPPQQYPPQSYGGYPPQGPPPPQQNQYGYT 60 Query: 265 PQ-------YAPQYAQPPP 300 P Y Y PPP Sbjct: 61 PHTPSPQPPYNGGYHAPPP 79 [175][TOP] >UniRef100_A2QAL8 Similarity to hypothetical protein CAF32129.1 - Aspergillus fumigatus n=1 Tax=Aspergillus niger CBS 513.88 RepID=A2QAL8_ASPNC Length = 113 Score = 81.6 bits (200), Expect = 2e-14 Identities = 52/122 (42%), Positives = 57/122 (46%), Gaps = 7/122 (5%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQ---GYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQ 225 MSY QPP PPP G +G ++ Y GYP GY QGYPPQGY PP P Q Sbjct: 1 MSYNKPDQPPPSYPPPTHDAGPYHQGASQDYYNQGGYPQQGYN-QGYPPQGYGPP--PQQ 57 Query: 226 GYPPPPYSAQGYPPQYAPQYAQPPPP----HHHNNSNNSSSPGCLEGCCAALCCCCLLDA 393 GY P PPQ P Y PP + + SS G G AAL CCC LD Sbjct: 58 GYYGSP------PPQGQPMYYPPPQQQQGYYAGQDRGGSSGGGICAGIMAALACCCCLDI 111 Query: 394 CF 399 F Sbjct: 112 LF 113 [176][TOP] >UniRef100_UPI0001869EB0 hypothetical protein BRAFLDRAFT_131901 n=1 Tax=Branchiostoma floridae RepID=UPI0001869EB0 Length = 656 Score = 81.3 bits (199), Expect = 3e-14 Identities = 52/96 (54%), Positives = 54/96 (56%), Gaps = 8/96 (8%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGY--PPQGY---P 204 P+ PP + PP PPQG PP YG G PP GY PP PQGY PPQGY P Sbjct: 8 PSAPPK---DPAYPPQAGYPPQGPPPPQYGP-GPPPQGYAPP---PQGYAPPPQGYGPPP 60 Query: 205 PPGY--PPQGYPPPPYSAQGYPPQ-YAPQYAQPPPP 303 P GY PPQGY PPP G PPQ YAPQ QP P Sbjct: 61 PAGYAPPPQGYAPPP-QPYGAPPQGYAPQPVQPGYP 95 Score = 68.6 bits (166), Expect = 2e-10 Identities = 41/89 (46%), Positives = 44/89 (49%), Gaps = 15/89 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGY---PPEGYGKE-----GYPPPG---YPPPGYPPQ 180 G+ PP Y G PPPQGY PP+GYG G PPPG PPP P Sbjct: 182 GYGAPPPQGYGAPPPQGYGAPPPQGYEAPPPQGYGASPPGAYGAPPPGGYAQPPPPGPGY 241 Query: 181 GYPPQGY--PPPGY--PPQGYPPPPYSAQ 255 G P GY P PGY P GY PPP +AQ Sbjct: 242 GQPAPGYGQPAPGYGQPAPGYGPPPPAAQ 270 Score = 65.5 bits (158), Expect = 2e-09 Identities = 46/97 (47%), Positives = 50/97 (51%), Gaps = 19/97 (19%) Frame = +1 Query: 67 NQQQPPVGTPPPQGY---PPEGYGKEGYPPPGY---PPPGY---PPQGY---PPQGY--- 201 + ++P G PPPQGY PP+GYG PP GY PP GY PP Y PP GY Sbjct: 177 HSKEPGYGAPPPQGYGAPPPQGYGAP--PPQGYEAPPPQGYGASPPGAYGAPPPGGYAQP 234 Query: 202 PPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 PPPG P GY P A GY Q AP Y PPP Sbjct: 235 PPPGPGYGQPAPGYGQP---APGY-GQPAPGYGPPPP 267 [177][TOP] >UniRef100_A0R2X6 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis str. MC2 155 RepID=A0R2X6_MYCS2 Length = 377 Score = 81.3 bits (199), Expect = 3e-14 Identities = 43/83 (51%), Positives = 44/83 (53%), Gaps = 7/83 (8%) Frame = +1 Query: 76 QPPVGTPPPQ--GYPPEGYGKEGYPPPGYPPPGYPPQ-----GYPPQGYPPPGYPPQGYP 234 QPP PPP GYPP GYPPP P GYPP G PPQG PP PP GYP Sbjct: 4 QPPGNNPPPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYP 63 Query: 235 PPPYSAQGYPPQYAPQYAQPPPP 303 PPP G+PP Y PPPP Sbjct: 64 PPPQG--GFPPPPPGGYPPPPPP 84 Score = 78.6 bits (192), Expect = 2e-13 Identities = 48/102 (47%), Positives = 50/102 (49%), Gaps = 9/102 (8%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVG-----TPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYP 189 Q G+ PP Y PP G PP GYPP G G PP G PP PP GYP Sbjct: 4 QPPGNNPPPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYP 63 Query: 190 PQ---GYPPPGYPPQGYPPPPYSAQG-YPPQYAPQYAQPPPP 303 P G+PPP PP GYPPPP G YPP P A PPP Sbjct: 64 PPPQGGFPPP--PPGGYPPPPPPQGGSYPPPPPPGAAGYPPP 103 Score = 69.7 bits (169), Expect = 1e-10 Identities = 49/103 (47%), Positives = 51/103 (49%), Gaps = 18/103 (17%) Frame = +1 Query: 40 PTTPPMSYYNQQQP------PVG----TPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYP 189 P PP Y QP P G PPP GYPP G G+PPP PP GYPP P Sbjct: 29 PPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQG--GFPPP--PPGGYPPPP-P 83 Query: 190 PQG--YPPP------GYPPQGYPPPPYSAQGYPPQYAPQYAQP 294 PQG YPPP GYPP GYP P GYPP A + QP Sbjct: 84 PQGGSYPPPPPPGAAGYPPPGYPGGP--GAGYPP--AGGFGQP 122 Score = 61.2 bits (147), Expect = 3e-08 Identities = 42/93 (45%), Positives = 46/93 (49%), Gaps = 12/93 (12%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVG---TPPPQGYPPEGYGKEG-YPPP------GYPPPGYPPQG 183 G+P PP Y PP G PPP GYPP + G YPPP GYPPPGYP G Sbjct: 52 GYPPPPPPGGY--PPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPPGYP--G 107 Query: 184 YPPQGYPPPG--YPPQGYPPPPYSAQGYPPQYA 276 P GYPP G P GY P A G+ Y+ Sbjct: 108 GPGAGYPPAGGFGQPGGY--APVGAPGFGGAYS 138 [178][TOP] >UniRef100_Q6SSJ0 Rhodopsin (Fragment) n=1 Tax=Loligo pealei RepID=Q6SSJ0_LOLPE Length = 442 Score = 81.3 bits (199), Expect = 3e-14 Identities = 37/51 (72%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +1 Query: 148 PGYPPPGYPPQGYPPQGYPPP-GYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 P YPP GYPPQGYPPQGYPPP GYPPQGYPPP QG PQ P A PP Sbjct: 388 PAYPPQGYPPQGYPPQGYPPPQGYPPQGYPPP----QGPLPQGPPPQAAPP 434 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/66 (56%), Positives = 39/66 (59%), Gaps = 2/66 (3%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-GYPPPGY-PPQGYPPQGYPPPGYPPQG 228 M QQ PPQGYPP+GY +GYPPP GYPP GY PPQG PQG PP PPQG Sbjct: 377 MQKMQAQQAAQPAYPPQGYPPQGYPPQGYPPPQGYPPQGYPPPQGPLPQGPPPQAAPPQG 436 Query: 229 YPPPPY 246 Y Sbjct: 437 VDNQAY 442 Score = 74.3 bits (181), Expect = 4e-12 Identities = 34/53 (64%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPP-GYPPQGYPP-QGYPPPGYPPQGYPPPPYSAQGY 261 YPP+GY +GYPP GYPPP GYPPQGYPP QG P G PPQ PP Q Y Sbjct: 390 YPPQGYPPQGYPPQGYPPPQGYPPQGYPPPQGPLPQGPPPQAAPPQGVDNQAY 442 Score = 66.6 bits (161), Expect = 8e-10 Identities = 33/69 (47%), Positives = 34/69 (49%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 Q P PP Y Q PP G PPPQGYPP+GY PP G PQG PPQ P Sbjct: 383 QQAAQPAYPPQGYPPQGYPPQGYPPPQGYPPQGYP---------PPQGPLPQGPPPQAAP 433 Query: 205 PPGYPPQGY 231 P G Q Y Sbjct: 434 PQGVDNQAY 442 [179][TOP] >UniRef100_Q3BDP1 Rhodopsin (Fragment) n=1 Tax=Sepioteuthis lessoniana RepID=Q3BDP1_SEPLE Length = 288 Score = 81.3 bits (199), Expect = 3e-14 Identities = 36/57 (63%), Positives = 36/57 (63%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPP 240 QQQ PPQGYPP PP GYPPQGYPPQGYPP GYPPQGYPPP Sbjct: 243 QQQQQQAAYPPQGYPPP------------PPQGYPPQGYPPQGYPPQGYPPQGYPPP 287 Score = 79.0 bits (193), Expect = 2e-13 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = +1 Query: 139 YPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPP 267 YPP GYPPP PPQGYPPQGYPP GYPPQGYPP QGYPP Sbjct: 251 YPPQGYPPP--PPQGYPPQGYPPQGYPPQGYPP-----QGYPP 286 Score = 67.8 bits (164), Expect = 4e-10 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 6/58 (10%) Frame = +1 Query: 55 MSYYNQQQ----PPVG--TPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP 210 M QQQ PP G PPPQGYPP+ GYPP GYPPQGYPPQGYPPP Sbjct: 240 MQAQQQQQQAAYPPQGYPPPPPQGYPPQ----------GYPPQGYPPQGYPPQGYPPP 287 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/44 (65%), Positives = 29/44 (65%) Frame = +1 Query: 169 YPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 YPPQGYPP PP GYPPQGYPP Y QGYPPQ PPP Sbjct: 251 YPPQGYPPP--PPQGYPPQGYPPQGYPPQGYPPQ-----GYPPP 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP 165 +G+P PP Y PPQGYPP+GY +GYPP GYPPP Sbjct: 254 QGYPPPPPQGY-----------PPQGYPPQGYPPQGYPPQGYPPP 287 [180][TOP] >UniRef100_C3YAX6 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3YAX6_BRAFL Length = 507 Score = 81.3 bits (199), Expect = 3e-14 Identities = 52/96 (54%), Positives = 54/96 (56%), Gaps = 8/96 (8%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGY--PPQGY---P 204 P+ PP + PP PPQG PP YG G PP GY PP PQGY PPQGY P Sbjct: 8 PSAPPK---DPAYPPQAGYPPQGPPPPQYGP-GPPPQGYAPP---PQGYAPPPQGYGPPP 60 Query: 205 PPGY--PPQGYPPPPYSAQGYPPQ-YAPQYAQPPPP 303 P GY PPQGY PPP G PPQ YAPQ QP P Sbjct: 61 PAGYAPPPQGYAPPP-QPYGAPPQGYAPQPVQPGYP 95 Score = 68.6 bits (166), Expect = 2e-10 Identities = 41/89 (46%), Positives = 44/89 (49%), Gaps = 15/89 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGY---PPEGYGKE-----GYPPPG---YPPPGYPPQ 180 G+ PP Y G PPPQGY PP+GYG G PPPG PPP P Sbjct: 182 GYGAPPPQGYGAPPPQGYGAPPPQGYEAPPPQGYGASPPGAYGAPPPGGYAQPPPPGPGY 241 Query: 181 GYPPQGY--PPPGY--PPQGYPPPPYSAQ 255 G P GY P PGY P GY PPP +AQ Sbjct: 242 GQPAPGYGQPAPGYGQPAPGYGPPPPAAQ 270 Score = 65.1 bits (157), Expect = 2e-09 Identities = 46/95 (48%), Positives = 49/95 (51%), Gaps = 19/95 (20%) Frame = +1 Query: 73 QQPPVGTPPPQGY---PPEGYGKEGYPPPGY---PPPGY---PPQGY---PPQGY---PP 207 ++P G PPPQGY PP+GYG PP GY PP GY PP Y PP GY PP Sbjct: 179 KEPGYGAPPPQGYGAPPPQGYGAP--PPQGYEAPPPQGYGASPPGAYGAPPPGGYAQPPP 236 Query: 208 PG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 PG P GY P A GY Q AP Y PPP Sbjct: 237 PGPGYGQPAPGYGQP---APGY-GQPAPGYGPPPP 267 [181][TOP] >UniRef100_A2FNQ6 XYPPX repeat family protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2FNQ6_TRIVA Length = 238 Score = 81.3 bits (199), Expect = 3e-14 Identities = 48/79 (60%), Positives = 49/79 (62%), Gaps = 8/79 (10%) Frame = +1 Query: 85 VGTPPPQGYPPEGYGKEGYPPPG-YPPPG-YPPQ--GYPPQ-GYPPPGYPP-QGYPPPPY 246 V PPP GYPP+G YPPPG YPP G YPP YPPQ GYPP GYPP QGYPP Sbjct: 156 VTAPPPAGYPPQG----AYPPPGAYPPQGAYPPAPGAYPPQGGYPPQGYPPQQGYPP--- 208 Query: 247 SAQGYPPQ--YAPQYAQPP 297 QGYPPQ Y Q PP Sbjct: 209 -QQGYPPQGGYPGQPGYPP 226 Score = 78.2 bits (191), Expect = 3e-13 Identities = 48/83 (57%), Positives = 51/83 (61%), Gaps = 8/83 (9%) Frame = +1 Query: 46 TPPMSYYNQQQPPVGTPPPQGYPPEG-YGKEG-YPP-PGYPPP--GYPPQGYPP-QGYPP 207 T P++ PP G PP YPP G Y +G YPP PG PP GYPPQGYPP QGYPP Sbjct: 149 TGPITINVTAPPPAGYPPQGAYPPPGAYPPQGAYPPAPGAYPPQGGYPPQGYPPQQGYPP 208 Query: 208 -PGYPPQ-GYPPPPYSAQGYPPQ 270 GYPPQ GYP P GYPPQ Sbjct: 209 QQGYPPQGGYPGQP----GYPPQ 227 Score = 58.5 bits (140), Expect = 2e-07 Identities = 36/63 (57%), Positives = 36/63 (57%), Gaps = 14/63 (22%) Frame = +1 Query: 157 PPPGYPPQG-YPPQG-YPPPG--------YPPQ-GYPPPPY-SAQGYPPQ--YAPQYAQP 294 PP GYPPQG YPP G YPP G YPPQ GYPP Y QGYPPQ Y PQ P Sbjct: 160 PPAGYPPQGAYPPPGAYPPQGAYPPAPGAYPPQGGYPPQGYPPQQGYPPQQGYPPQGGYP 219 Query: 295 PPP 303 P Sbjct: 220 GQP 222 Score = 55.8 bits (133), Expect = 1e-06 Identities = 39/82 (47%), Positives = 41/82 (50%), Gaps = 19/82 (23%) Frame = +1 Query: 43 TTPPMSYYNQQ--QPPVGTPPPQG--------------YPPEGYGKEGYPPPGYPP-PGY 171 T PP + Y Q PP G PPQG YPP+GY P GYPP GY Sbjct: 157 TAPPPAGYPPQGAYPPPGAYPPQGAYPPAPGAYPPQGGYPPQGYP----PQQGYPPQQGY 212 Query: 172 PPQGYPPQGYP-PPGYPP-QGY 231 PPQG GYP PGYPP QGY Sbjct: 213 PPQG----GYPGQPGYPPQQGY 230 [182][TOP] >UniRef100_UPI00015DEFD1 Proline-rich protein 2 precursor (Proline-rich protein MP-3). n=1 Tax=Mus musculus RepID=UPI00015DEFD1 Length = 227 Score = 80.9 bits (198), Expect = 4e-14 Identities = 51/103 (49%), Positives = 54/103 (52%), Gaps = 13/103 (12%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 G PP++ Q PP G P PPQG PP G G + PP G PPPG PQ PPQG P Sbjct: 38 GSQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPG-GPQPRPPQGPP 95 Query: 205 PPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 PPG PPQG PPP P QG PP PQ P PPP Sbjct: 96 PPGGPQPRPPQGPPPPGGPQPRPPQGPPPPGGPQQRPPQGPPP 138 Score = 79.7 bits (195), Expect = 9e-14 Identities = 53/119 (44%), Positives = 55/119 (46%), Gaps = 19/119 (15%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG P Q PPQ Sbjct: 77 PQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPGGPQQR-PPQ 134 Query: 196 GYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQ---PPPPHHHNNSNNSSSP 339 G PPPG PPQG PPP P QG PP PQ PPPP H P Sbjct: 135 GPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPPPGPHPRPTQGPPP 193 Score = 76.6 bits (187), Expect = 8e-13 Identities = 50/105 (47%), Positives = 52/105 (49%), Gaps = 17/105 (16%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 105 PQGPPPPGGPQPRPPQGPPPPGGPQQRPPQGPPPPG-GPQQRPPQGPPPPG-GPQPRPPQ 162 Query: 196 GYPPPG----YPPQGYPPP---PYSAQGYPPQYAPQYAQP--PPP 303 G PPP PPQG PPP P QG PP PQ P PPP Sbjct: 163 GPPPPAGPQPRPPQGPPPPGPHPRPTQGPPPTGGPQQRPPQGPPP 207 Score = 70.9 bits (172), Expect = 4e-11 Identities = 48/112 (42%), Positives = 50/112 (44%), Gaps = 25/112 (22%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP QQ+PP G PPP QG PP G G + PP G PPP PQ PPQ Sbjct: 119 PQGPPPPGGPQQRPPQGPPPPGGPQQRPPQGPPPPG-GPQPRPPQGPPPPA-GPQPRPPQ 176 Query: 196 GYPPPG-----------------YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 G PPPG PPQG PPPP Q PPQ P P P Sbjct: 177 GPPPPGPHPRPTQGPPPTGGPQQRPPQG-PPPPGGPQPRPPQGPPPPTGPQP 227 Score = 64.7 bits (156), Expect = 3e-09 Identities = 42/88 (47%), Positives = 44/88 (50%), Gaps = 3/88 (3%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P NQ Q P PPP G PP ++G PPPG P P PPQG PP G P P P Sbjct: 19 PREELQNQIQIPNQRPPPSGSQPRPPVNGSQQGPPPPGGPQPR-PPQGPPPPGGPQPR-P 76 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PQG PPPP Q PP Q PPP Sbjct: 77 PQG-PPPPGGPQPRPP-------QGPPP 96 [183][TOP] >UniRef100_UPI0000195290 proline rich protein 2 n=1 Tax=Mus musculus RepID=UPI0000195290 Length = 316 Score = 80.9 bits (198), Expect = 4e-14 Identities = 51/103 (49%), Positives = 54/103 (52%), Gaps = 13/103 (12%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 G PP++ Q PP G P PPQG PP G G + PP G PPPG PQ PPQG P Sbjct: 38 GSQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPG-GPQPRPPQGPP 95 Query: 205 PPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 PPG PPQG PPP P QG PP PQ P PPP Sbjct: 96 PPGGPQPRPPQGPPPPGGPQPRPPQGPPPPGGPQQRPPQGPPP 138 Score = 79.3 bits (194), Expect = 1e-13 Identities = 53/119 (44%), Positives = 55/119 (46%), Gaps = 19/119 (15%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG P Q PPQ Sbjct: 77 PQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPGGPQQR-PPQ 134 Query: 196 GYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQ---PPPPHHHNNSNNSSSP 339 G PPPG PPQG PPP P QG PP PQ PPPP H P Sbjct: 135 GPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPPPGPHLRPTQGPPP 193 Score = 72.0 bits (175), Expect = 2e-11 Identities = 48/117 (41%), Positives = 50/117 (42%), Gaps = 17/117 (14%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYP---PPGYPPPGYPPQGYPPQGY 201 P PP QQ+PP G PPP G PP+G G P PP PPP PQ PPQG Sbjct: 119 PQGPPPPGGPQQRPPQGPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGP 178 Query: 202 PPPG---YPPQGYPPPPYSAQGYP--------PQYAPQYAQPPPPHHHNNSNNSSSP 339 PPPG P QG PP Q YP PQ P PPP H P Sbjct: 179 PPPGPHLRPTQGPPPTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPP 235 Score = 69.7 bits (169), Expect = 1e-10 Identities = 46/104 (44%), Positives = 49/104 (47%), Gaps = 16/104 (15%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP-------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG 198 P PP Q +PP G PPP QG PP G ++ YP PPP PQ PPQG Sbjct: 161 PQGPPPPAGPQPRPPQGPPPPGPHLRPTQGPPPTGGPQQRYPQS--PPPPGGPQPRPPQG 218 Query: 199 YPPPGYP---PQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 PPPG P P PPP P QG PP PQ P PPP Sbjct: 219 PPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTGGPQQRPPQGPPP 262 Score = 66.2 bits (160), Expect = 1e-09 Identities = 47/107 (43%), Positives = 48/107 (44%), Gaps = 22/107 (20%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTP---PPQGYPPEG----YGKEGYPPPG---YPPPGYPPQG-- 183 PT P Y Q PP G P PPQG PP G +G PP G P G PP G Sbjct: 193 PTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTGGP 252 Query: 184 --YPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP 294 PPQG PPPG PPQG PPP P QG P PQ P Sbjct: 253 QQRPPQGPPPPGGPQPRPPQGPPPPTGPQPRPTQGPHPTGGPQQTPP 299 Score = 64.7 bits (156), Expect = 3e-09 Identities = 42/88 (47%), Positives = 44/88 (50%), Gaps = 3/88 (3%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P NQ Q P PPP G PP ++G PPPG P P PPQG PP G P P P Sbjct: 19 PREELQNQIQIPNQRPPPSGSQPRPPVNGSQQGPPPPGGPQPR-PPQGPPPPGGPQPR-P 76 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PQG PPPP Q PP Q PPP Sbjct: 77 PQG-PPPPGGPQPRPP-------QGPPP 96 Score = 59.7 bits (143), Expect = 1e-07 Identities = 45/115 (39%), Positives = 47/115 (40%), Gaps = 23/115 (20%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYP--------- 174 +G P P Q PP G P Q Y PP G + PP G PPPG P Sbjct: 176 QGPPPPGPHLRPTQGPPPTGG-PQQRYPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPP 234 Query: 175 ---PQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQPPPPH 306 PQ P QG PP G PPQG PPP P QG PP PQ PH Sbjct: 235 PTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPTGPQPRPTQGPH 289 Score = 58.9 bits (141), Expect = 2e-07 Identities = 45/119 (37%), Positives = 50/119 (42%), Gaps = 34/119 (28%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPP---------------------QGYPPEGYGKEGYPPPG 153 +P +PP Q +PP G PPP QG PP G G + PP G Sbjct: 201 YPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTG-GPQQRPPQG 259 Query: 154 YPPPGYPPQGYPPQGYPPPGYP-------------PQGYPPPPYSAQGYPPQYAPQYAQ 291 PPPG PQ PPQG PPP P PQ PP + QG PPQ PQ Q Sbjct: 260 PPPPG-GPQPRPPQGPPPPTGPQPRPTQGPHPTGGPQQTPPLAGNPQG-PPQGRPQGPQ 316 [184][TOP] >UniRef100_Q0D326 Rhodopsin (Fragment) n=2 Tax=Euprymna RepID=Q0D326_9MOLL Length = 298 Score = 80.9 bits (198), Expect = 4e-14 Identities = 38/57 (66%), Positives = 40/57 (70%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 YPP+GY +GYPPP P GYPPQGYPPQG YPPQGYPPP QG PPQ AP Sbjct: 252 YPPQGYPPQGYPPP---PQGYPPQGYPPQG----AYPPQGYPPP----QGAPPQAAP 297 Score = 79.3 bits (194), Expect = 1e-13 Identities = 38/58 (65%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQG-YPPQGYPPP-GYPPQGYPP 237 QQ PPQGYPP+GY PP GYPP GYPPQG YPPQGYPPP G PPQ PP Sbjct: 244 QQAQQQAAYPPQGYPPQGYPP---PPQGYPPQGYPPQGAYPPQGYPPPQGAPPQAAPP 298 Score = 75.5 bits (184), Expect = 2e-12 Identities = 37/54 (68%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = +1 Query: 139 YPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGY-PPQYAPQYAQPP 297 YPP GYPP GYPP PPQGYPP GYPPQG PP QGY PPQ AP A PP Sbjct: 252 YPPQGYPPQGYPP---PPQGYPPQGYPPQGAYPP----QGYPPPQGAPPQAAPP 298 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/52 (59%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = +1 Query: 58 SYYNQQQPPVG-TPPPQGYPPEGYGKEG-YPPPGYPPPGYPPQGYPPQGYPP 207 +Y Q PP G PPPQGYPP+GY +G YPP GYP PPQG PPQ PP Sbjct: 251 AYPPQGYPPQGYPPPPQGYPPQGYPPQGAYPPQGYP----PPQGAPPQAAPP 298 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +1 Query: 178 QGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ-YAPQYAQPP 297 Q YPP GYPPQGYPPPP QGYPPQ Y PQ A PP Sbjct: 245 QAQQQAAYPPQGYPPQGYPPPP---QGYPPQGYPPQGAYPP 282 [185][TOP] >UniRef100_A2EG41 Uncharacterized Cys-rich domain containing protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2EG41_TRIVA Length = 228 Score = 80.9 bits (198), Expect = 4e-14 Identities = 49/92 (53%), Positives = 52/92 (56%), Gaps = 11/92 (11%) Frame = +1 Query: 94 PPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGY---PPQGYPPPGYPPQGYPPPPYSAQ 255 PPPQGY PP+GY PP GY PP PPQGY PPQ Y PP PPQ Y PPP Q Sbjct: 136 PPPQGYAPPPPQGYAPP--PPQGYAPP--PPQGYAPPPPQEYAPP--PPQEYAPPP--PQ 187 Query: 256 GYPPQYAPQYAQPPPP-----HHHNNSNNSSS 336 GY P YA PPPP H S++SSS Sbjct: 188 GYAPPPPQGYAVPPPPPPAPEHKKKKSSSSSS 219 Score = 76.3 bits (186), Expect = 1e-12 Identities = 47/94 (50%), Positives = 50/94 (53%), Gaps = 8/94 (8%) Frame = +1 Query: 79 PPVG--TPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGY---PPQGYPPPGYPPQGYP 234 PP G PPPQGY PP+GY PP GY PP PPQ Y PPQ Y PP PPQGY Sbjct: 137 PPQGYAPPPPQGYAPPPPQGYAPP--PPQGYAPP--PPQEYAPPPPQEYAPP--PPQGYA 190 Query: 235 PPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSS 336 PPP P YA PP P H ++SSS Sbjct: 191 PPP------PQGYAVPPPPPPAPEHKKKKSSSSS 218 Score = 68.2 bits (165), Expect = 3e-10 Identities = 42/105 (40%), Positives = 51/105 (48%), Gaps = 3/105 (2%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGY---PPQGY 201 +G+ PP Y PPPQGY P PP Y PP PPQ Y PPQGY Sbjct: 139 QGYAPPPPQGYAPPPPQGYAPPPPQGYAPP-------PPQEYAPP--PPQEYAPPPPQGY 189 Query: 202 PPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSS 336 PP PPQGY PP PP AP++ + ++S++SSS Sbjct: 190 APP--PPQGYAVPP------PPPPAPEHKKKKSSSSSSSSSSSSS 226 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/56 (57%), Positives = 34/56 (60%), Gaps = 3/56 (5%) Frame = +1 Query: 151 GYPPPGYPPQGY---PPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 GY PP PQGY PPQGY PP PPQGY PPP QGY P +YA PPP + Sbjct: 133 GYAPP---PQGYAPPPPQGYAPP--PPQGYAPPP--PQGYAPPPPQEYAPPPPQEY 181 [186][TOP] >UniRef100_A0CRV7 Chromosome undetermined scaffold_25, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CRV7_PARTE Length = 177 Score = 80.9 bits (198), Expect = 4e-14 Identities = 51/109 (46%), Positives = 54/109 (49%), Gaps = 8/109 (7%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG----YPPQ-GYPPQ--G 198 P PP Y PP PPP PP YG+ YP PGY PP YPP GYPP G Sbjct: 4 PPPPPYGY-----PPAQYPPP---PPPAYGQPPYPQPGYQPPPTGYPYPPTPGYPPPVGG 55 Query: 199 YPPPGYPPQ-GYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 YP PGYPP GYPP P GYPP PQ PP ++ S PG Sbjct: 56 YPQPGYPPAPGYPPTP----GYPP---PQPGYVPPTNYAQPYPPQSYPG 97 Score = 76.6 bits (187), Expect = 8e-13 Identities = 47/89 (52%), Positives = 49/89 (55%), Gaps = 6/89 (6%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVG-TPPPQGYPPEGYGKEGYPPP--GYPPPGYPP-QGYPP-QGY 201 +P PP +Y P G PPP GYP GYPPP GYP PGYPP GYPP GY Sbjct: 16 YPPPPPPAYGQPPYPQPGYQPPPTGYPYPP--TPGYPPPVGGYPQPGYPPAPGYPPTPGY 73 Query: 202 PPPGYPPQGYPPPPYSAQGYPPQ-YAPQY 285 PP P GY PP AQ YPPQ Y QY Sbjct: 74 PP---PQPGYVPPTNYAQPYPPQSYPGQY 99 Score = 56.6 bits (135), Expect = 8e-07 Identities = 35/87 (40%), Positives = 37/87 (42%), Gaps = 22/87 (25%) Frame = +1 Query: 145 PPGYPPPGYPPQGYPP--------QGYPPPGY--PPQGYPPPP----------YSAQGYP 264 PP PP GYPP YPP YP PGY PP GYP PP Y GYP Sbjct: 3 PPPPPPYGYPPAQYPPPPPPAYGQPPYPQPGYQPPPTGYPYPPTPGYPPPVGGYPQPGYP 62 Query: 265 PQ--YAPQYAQPPPPHHHNNSNNSSSP 339 P Y P PPP + N + P Sbjct: 63 PAPGYPPTPGYPPPQPGYVPPTNYAQP 89 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/66 (42%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Frame = +1 Query: 160 PPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPP-----QYAPQYAQPPPPHHHNNSN 324 PP PP GYPP YPPP PP Y PPY GY P Y P PPP + Sbjct: 3 PPPPPPYGYPPAQYPPP--PPPAYGQPPYPQPGYQPPPTGYPYPPTPGYPPPVGGYPQPG 60 Query: 325 NSSSPG 342 +PG Sbjct: 61 YPPAPG 66 [187][TOP] >UniRef100_B4FJV3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FJV3_MAIZE Length = 133 Score = 80.5 bits (197), Expect = 5e-14 Identities = 56/144 (38%), Positives = 57/144 (39%), Gaps = 44/144 (30%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP----------------------------- 147 MSYY QQ PPVG PP QG P PP Sbjct: 1 MSYYGQQ-PPVGVPPQQGAAPS-------PPVFDLSASLSSPKHLENLCVPRLLSVLYVI 52 Query: 148 ------------PGYP-PPGYPPQGYPPQGYPPP--GYPPQGYPPPPYSAQGYPPQYAPQ 282 PGYP GYPP GYPP GYPPP GYPPQGYP PQ Sbjct: 53 RLIIFRVRILISPGYPGKDGYPPAGYPPAGYPPPAQGYPPQGYP--------------PQ 98 Query: 283 YAQPPPPHHHNNSNNSSSPGCLEG 354 YAQPPPP SS P +EG Sbjct: 99 YAQPPPP----QQQQSSGPSFMEG 118 [188][TOP] >UniRef100_A7S7Y1 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S7Y1_NEMVE Length = 349 Score = 80.5 bits (197), Expect = 5e-14 Identities = 49/121 (40%), Positives = 53/121 (43%), Gaps = 28/121 (23%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG-----------------------YPPEGYGKEGYP 144 G PT+ P++Y P G PPP YPP G GYP Sbjct: 123 GPPTSQPVAYGY----PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPG----GYP 174 Query: 145 PPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYP-----PQYAPQYAQPPPPHH 309 P YPP YP Q YP QGYPP PPQ YP P Y QGYP PQ P YA P H Sbjct: 175 PTSYPPQPYPAQPYPQQGYPPQP-PPQAYPQPGYPPQGYPPTGPYPQTQPGYAGATPQAH 233 Query: 310 H 312 + Sbjct: 234 Y 234 Score = 68.6 bits (166), Expect = 2e-10 Identities = 44/103 (42%), Positives = 46/103 (44%), Gaps = 17/103 (16%) Frame = +1 Query: 46 TPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPP-------PGY--PPQGY---- 186 +P SY G P Q P YG PPP Y P PG PP + Sbjct: 109 SPAPSYPTASTMTTGPPTSQ---PVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTAS 165 Query: 187 ---PPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQ-YAQPPPP 303 PP GYPP YPPQ YP PY QGYPPQ PQ Y QP P Sbjct: 166 VYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYP 208 [189][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 80.5 bits (197), Expect = 5e-14 Identities = 45/106 (42%), Positives = 52/106 (49%), Gaps = 4/106 (3%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YPPPGYPPQGYPPQGYPP 207 +G P PP+ PP G PPP PP EG PPP PPP P +G PP PP Sbjct: 206 QGPPAPPPVE---GPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPP 262 Query: 208 PGYPPQGYPPP---PYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSS 336 P PP +PPP P G PP P PPPPH ++S +S S Sbjct: 263 PHGPPPHFPPPAEGPPPPHGPPPHSPPPSEGPPPPHGPSSSGSSLS 308 Score = 70.1 bits (170), Expect = 7e-11 Identities = 45/100 (45%), Positives = 50/100 (50%), Gaps = 9/100 (9%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-GYPPPGYPPQGYPP-QGYPP 207 G P PP + PP P PQG PP EG PPP G PPP + P G PP +G PP Sbjct: 184 GPPVPPPHPPPAEPAPPP-PPAPQG-PPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPP 241 Query: 208 PG-----YPPQGYPPPPYS--AQGYPPQYAPQYAQPPPPH 306 P PP PPPP+S G PP + P PPPPH Sbjct: 242 PAKVPPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPPPPH 281 Score = 66.2 bits (160), Expect = 1e-09 Identities = 44/109 (40%), Positives = 48/109 (44%), Gaps = 20/109 (18%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYP--PPGYPPPG--YPPQGYPPQGYPP 207 P PPM+ PP G PPP PP G P PP +PPP PP PQG P Sbjct: 154 PPPPPMA---GPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPA 210 Query: 208 P-----GYPPQGYPPPPYSAQGYPPQY-----------APQYAQPPPPH 306 P PP+G PPPP+S G PP AP PPPPH Sbjct: 211 PPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPH 259 Score = 65.1 bits (157), Expect = 2e-09 Identities = 38/90 (42%), Positives = 40/90 (44%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 G P PP PP PPP PP G PPP PPP +PP PP G PP Sbjct: 134 GPPVGPP-------PPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPP---PPAGPPPVA 183 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PP P PP + PP APQ PPP Sbjct: 184 GPPVPPPHPPPAEPAPPPPPAPQGPPAPPP 213 Score = 64.7 bits (156), Expect = 3e-09 Identities = 40/93 (43%), Positives = 40/93 (43%), Gaps = 1/93 (1%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ-GYP 204 HRG PP PPVG PPP PP PPP PPP P G PP G P Sbjct: 121 HRGRFMPPPPVLPG---PPVGPPPPPPPPP--------PPPPPPPPPPPMAGPPPPPGPP 169 Query: 205 PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PP PP PPP PP P PPPP Sbjct: 170 PPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPP 202 Score = 64.3 bits (155), Expect = 4e-09 Identities = 37/89 (41%), Positives = 39/89 (43%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P PP P G PPP G PP PPP PP PP P + PPP Sbjct: 145 PPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPA 204 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPPH 306 PQG PP P +G PP P PPPPH Sbjct: 205 PQG-PPAPPPVEGPPPPKGP----PPPPH 228 [190][TOP] >UniRef100_Q32L53 Glutamate [NMDA] receptor-associated protein 1 n=1 Tax=Bos taurus RepID=GRINA_BOVIN Length = 366 Score = 80.5 bits (197), Expect = 5e-14 Identities = 45/106 (42%), Positives = 51/106 (48%), Gaps = 3/106 (2%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG-YPPEGYGKEGYP--PPGYPPPGYPPQGYPPQGYP 204 G+P P S P G P PQ + P YG+ GYP P YP GYP YPP GYP Sbjct: 20 GYPGGPQPS----MAPYPGAPYPQAPFQPSPYGQPGYPQGPSPYPQGGYPQGPYPPGGYP 75 Query: 205 PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 YPP GYP PY GYP PQ PP P+ + + PG Sbjct: 76 QGPYPPGGYPQGPYPPGGYPQGPYPQSPFPPNPYGQPQAFPAQDPG 121 Score = 75.1 bits (183), Expect = 2e-12 Identities = 43/94 (45%), Positives = 46/94 (48%), Gaps = 5/94 (5%) Frame = +1 Query: 73 QQPPVGTPP-PQG---YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPP 240 Q P G P PQG YP GY + YPP GYP YPP GYP YPP GYP YP Sbjct: 43 QPSPYGQPGYPQGPSPYPQGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQGPYPQS 102 Query: 241 PYSAQGY-PPQYAPQYAQPPPPHHHNNSNNSSSP 339 P+ Y PQ P AQ P HH N + P Sbjct: 103 PFPPNPYGQPQAFP--AQDPGSPHHGNYHEEGPP 134 Score = 65.1 bits (157), Expect = 2e-09 Identities = 32/51 (62%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = -1 Query: 245 YGGGGYPCGG*P--GGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*PCG 99 YG GYP G P GGYP G YP GGYP G YP GGYP PYP GG P G Sbjct: 47 YGQPGYPQGPSPYPQGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQG 97 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = -1 Query: 245 YGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*P 105 Y GGYP G P GGYP G YP GGYP G YP GGYP PYP P Sbjct: 59 YPQGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQGPYPQSPFP 105 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/46 (58%), Positives = 28/46 (60%) Frame = -1 Query: 257 PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 P Y G YP GG P G YP GGYP G YP GGYP G YP P+P Sbjct: 60 PQGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQGPYPQSPFP 105 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/53 (54%), Positives = 29/53 (54%) Frame = -1 Query: 263 G*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*P 105 G P G YP GG P G YP GGYP G YP GGYP G YP YP G P Sbjct: 48 GQPGYPQGPSPYPQGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQGPYP 100 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/48 (56%), Positives = 28/48 (58%) Frame = -1 Query: 266 GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPY 123 GG P Y GGYP G P GGYP G YP GGYP G YP +P PY Sbjct: 62 GGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQGPYPQSPFPPNPY 109 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/100 (33%), Positives = 42/100 (42%), Gaps = 3/100 (3%) Frame = +1 Query: 34 GHPTTP---PMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 G+P P P Y Q P G P YPP GY + YPP GYP YP +PP Y Sbjct: 51 GYPQGPSPYPQGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQGPYPQSPFPPNPYG 110 Query: 205 PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSN 324 P P P P+ Y + PP +++N + Sbjct: 111 QPQAFPAQDPGSPHHG---------NYHEEGPPSYYDNQD 141 [191][TOP] >UniRef100_UPI0001982C02 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982C02 Length = 187 Score = 80.1 bits (196), Expect = 7e-14 Identities = 48/102 (47%), Positives = 52/102 (50%), Gaps = 9/102 (8%) Frame = +1 Query: 88 GTPPPQGYPPEGYGKEG--YPPPG---YPPPG---YPPQG-YPPQGYPPPGYPPQGYPPP 240 G PPQGYPP+GY + G YPP G YPP G YPPQG YPPQG GYPPQGYP Sbjct: 30 GQYPPQGYPPQGYPQHGGGYPPHGGGGYPPHGGGGYPPQGGYPPQG----GYPPQGYPQA 85 Query: 241 PYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAA 366 Y YPP Y P PH + + G AA Sbjct: 86 GYPPGSYPP---AAYPGPSAPHSGHGGMGTMLAGGAAAAAAA 124 Score = 77.8 bits (190), Expect = 4e-13 Identities = 45/77 (58%), Positives = 45/77 (58%), Gaps = 8/77 (10%) Frame = +1 Query: 73 QQPPVGTPPPQGYPPEGYGKEGYPP---PGYPP---PGYPPQ-GYPPQ-GYPPPGYPPQG 228 Q PP G PP QGYP G GYPP GYPP GYPPQ GYPPQ GYPP GYP G Sbjct: 31 QYPPQGYPP-QGYPQHG---GGYPPHGGGGYPPHGGGGYPPQGGYPPQGGYPPQGYPQAG 86 Query: 229 YPPPPYSAQGYPPQYAP 279 YPP Y YP AP Sbjct: 87 YPPGSYPPAAYPGPSAP 103 Score = 70.1 bits (170), Expect = 7e-11 Identities = 40/80 (50%), Positives = 43/80 (53%), Gaps = 10/80 (12%) Frame = +1 Query: 106 GYPPEGYGKEGYPPPGYPP--PGYPPQ---GYPPQ---GYPPP-GYPPQ-GYPPPPYSAQ 255 G+ Y +GYPP GYP GYPP GYPP GYPP GYPPQ GYPP Y Sbjct: 26 GHSSGQYPPQGYPPQGYPQHGGGYPPHGGGGYPPHGGGGYPPQGGYPPQGGYPPQGYPQA 85 Query: 256 GYPPQYAPQYAQPPPPHHHN 315 GYPP P A P P H+ Sbjct: 86 GYPPGSYPPAAYPGPSAPHS 105 Score = 55.1 bits (131), Expect = 2e-06 Identities = 35/65 (53%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = -1 Query: 266 GG*PCAEYGGGGYPCGG*PGGGYPC-GGYPC-GGYPGGGYPGGGYPSFPYPSGG*PCGGG 93 GG P +GGGGYP G GGGYP GGYP GGYP GYP GYP YP P G Sbjct: 47 GGYP--PHGGGGYPPHG--GGGYPPQGGYPPQGGYPPQGYPQAGYPPGSYPPAAYP-GPS 101 Query: 92 VPTGG 78 P G Sbjct: 102 APHSG 106 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/42 (54%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 79 PPVGTPPPQG-YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGY 201 PP G PPQG YPP+GY + GYPP YPP YP P G+ Sbjct: 66 PPQGGYPPQGGYPPQGYPQAGYPPGSYPPAAYPGPSAPHSGH 107 Score = 53.1 bits (126), Expect = 9e-06 Identities = 30/65 (46%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = -1 Query: 266 GG*PCAEYGGGGYPCGG*--PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPSGG*PCGGG 93 GG +GGGGYP G P GGYP GYP GYP G YP YP P G G Sbjct: 53 GGGGYPPHGGGGYPPQGGYPPQGGYPPQGYPQAGYPPGSYPPAAYPGPSAPHSGHGGMGT 112 Query: 92 VPTGG 78 + GG Sbjct: 113 MLAGG 117 [192][TOP] >UniRef100_Q3KQ95 MGC130851 protein n=1 Tax=Xenopus laevis RepID=Q3KQ95_XENLA Length = 152 Score = 80.1 bits (196), Expect = 7e-14 Identities = 55/129 (42%), Positives = 59/129 (45%), Gaps = 7/129 (5%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG-YPPQGYPPQGY 201 Q+ G+P P Y QP G PPP YP G GY PGYP P YP P GY Sbjct: 30 QYPGNPPGPVG--YQPGQP--GYPPPNQYPDNPPGPVGY-QPGYPAPNQYPGNPPGPVGY 84 Query: 202 PP--PGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPH----HHNNSNNSSSPGCLEGCCA 363 P PGY QGY P Y QG PP AP Y P ++ S CL C Sbjct: 85 QPGQPGY--QGY--PQYEWQGGPPANAPVYMDAPKNTVYVVEERRNDTSGDGACLTACWT 140 Query: 364 ALCCCCLLD 390 ALCCCCL D Sbjct: 141 ALCCCCLWD 149 [193][TOP] >UniRef100_B0BLS3 Putative uncharacterized protein LOC549193 n=1 Tax=Xenopus (Silurana) tropicalis RepID=B0BLS3_XENTR Length = 110 Score = 80.1 bits (196), Expect = 7e-14 Identities = 50/115 (43%), Positives = 54/115 (46%), Gaps = 7/115 (6%) Frame = +1 Query: 67 NQQQPPVGTPPPQGYPPEGYGKEGYPPPG-YP--PPGYPPQGYPPQGYPPPGYPPQGYPP 237 N + PP PP YPP G + GYP P YP PPG P GY P PGY QGY Sbjct: 2 NYENPPPYASPPAPYPPYGQQQPGYPVPNQYPGNPPG--PVGYQP---AQPGY--QGY-- 52 Query: 238 PPYSAQGYPPQYAPQYAQPPPPH----HHNNSNNSSSPGCLEGCCAALCCCCLLD 390 P Y QG PP AP Y P ++ S CL C ALCCCCL D Sbjct: 53 PQYGWQGAPPANAPVYMDAPKNTVYVVEERRNDTSGESACLTACWTALCCCCLWD 107 [194][TOP] >UniRef100_B4FLL6 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FLL6_MAIZE Length = 75 Score = 80.1 bits (196), Expect = 7e-14 Identities = 44/74 (59%), Positives = 45/74 (60%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP 234 MSYY QQ PPVG PP QGYP GK+GYPP GY PP GYPPP QGYP Sbjct: 1 MSYYGQQ-PPVGVPPQQGYP----GKDGYPPAGY----------PPAGYPPPA---QGYP 42 Query: 235 PPPYSAQGYPPQYA 276 P QGYPPQYA Sbjct: 43 P-----QGYPPQYA 51 [195][TOP] >UniRef100_Q23BZ5 XYPPX repeat family protein n=2 Tax=Tetrahymena thermophila RepID=Q23BZ5_TETTH Length = 242 Score = 80.1 bits (196), Expect = 7e-14 Identities = 55/105 (52%), Positives = 60/105 (57%), Gaps = 13/105 (12%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQP-PVGTP--PPQGYPPEG----YGKEGYPPP-GYPPP-GYPPQ- 180 +G+P P Y QQP PV P P Q YPP+ Y +GYPP GYPP GYPPQ Sbjct: 148 QGYPQYPAQQPYPGQQPYPVQQPYPPQQAYPPQAGYPQYPAQGYPPQQGYPPQQGYPPQQ 207 Query: 181 GYPPQ-GYPPP-GYPPQGYPPPPYSAQGYPPQYA-PQYAQPPPPH 306 GYPPQ GYPP GYPPQ QGYPPQ PQY PP P+ Sbjct: 208 GYPPQQGYPPQQGYPPQ---------QGYPPQQGYPQY--PPNPY 241 Score = 53.1 bits (126), Expect = 9e-06 Identities = 42/93 (45%), Positives = 47/93 (50%), Gaps = 7/93 (7%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYP--PPGYPPPGYPPQGYP-PQGYPPP 210 P ++Y QQ G P G+ P ++GYP P P PG P YP Q YPP Sbjct: 122 PDQQNVAYVVQQPVAYGQP---GFQP--VMQQGYPQYPAQQPYPGQQP--YPVQQPYPPQ 174 Query: 211 -GYPPQ-GYPPPPYSAQGYPPQ--YAPQYAQPP 297 YPPQ GYP Y AQGYPPQ Y PQ PP Sbjct: 175 QAYPPQAGYPQ--YPAQGYPPQQGYPPQQGYPP 205 [196][TOP] >UniRef100_C5DBI0 KLTH0A02794p n=1 Tax=Lachancea thermotolerans CBS 6340 RepID=C5DBI0_LACTC Length = 216 Score = 80.1 bits (196), Expect = 7e-14 Identities = 39/92 (42%), Positives = 43/92 (46%), Gaps = 18/92 (19%) Frame = +1 Query: 70 QQQPPVGTP------------------PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 Q+Q P G P P Q YP + Y ++ YP GY YP QGYP Q Sbjct: 55 QEQRPAGAPSAVKGDRKTPATEQRSGYPQQAYPQQPYSQQAYPQQGYGQQAYPQQGYPQQ 114 Query: 196 GYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQ 291 GYP GY PQ YP PY Q YP Q PQ Q Sbjct: 115 GYPQQGYYPQAYPQQPYYPQAYPQQQYPQQQQ 146 Score = 75.5 bits (184), Expect = 2e-12 Identities = 36/75 (48%), Positives = 39/75 (52%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP 210 R P T S Y QQ P Q YP +GYG++ YP GYP GYP QGY PQ YP Sbjct: 70 RKTPATEQRSGYPQQAYPQQPYSQQAYPQQGYGQQAYPQQGYPQQGYPQQGYYPQAYPQQ 129 Query: 211 GYPPQGYPPPPYSAQ 255 Y PQ YP Y Q Sbjct: 130 PYYPQAYPQQQYPQQ 144 Score = 72.0 bits (175), Expect = 2e-11 Identities = 37/103 (35%), Positives = 45/103 (43%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P P + ++ P T GYP + Y ++ Y YP GY Q YP QGYP GYP Sbjct: 59 PAGAPSAVKGDRKTPA-TEQRSGYPQQAYPQQPYSQQAYPQQGYGQQAYPQQGYPQQGYP 117 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCL 348 QGY P Y Q Y PQ PQ P + + G L Sbjct: 118 QQGYYPQAYPQQPYYPQAYPQQQYPQQQQGRKKFGGAMTGGLL 160 [197][TOP] >UniRef100_B6Q7Z7 Annexin ANXC3.2 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q7Z7_PENMQ Length = 446 Score = 80.1 bits (196), Expect = 7e-14 Identities = 54/119 (45%), Positives = 56/119 (47%), Gaps = 30/119 (25%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG-YPPEGYGKEGYPPPGYPPP----GYPP------Q 180 G+P P Y + PP G PP G YPP G YPPPG PPP GYPP Q Sbjct: 9 GYPPYPQQGYGH---PPPGAPPQGGYYPPPQQGH--YPPPGGPPPGQYGGYPPGPPPPAQ 63 Query: 181 GYPPQG-YPPP----------GY---PPQGYP-----PPPYSAQGYPPQYAPQYAQPPP 300 GYPP G YPPP GY PPQG P PPP G PP P Y PPP Sbjct: 64 GYPPHGAYPPPQHGAYPPQHGGYGQPPPQGPPAPYGHPPPPGPHGTPPAAQPGYGAPPP 122 Score = 78.2 bits (191), Expect = 3e-13 Identities = 48/86 (55%), Positives = 52/86 (60%), Gaps = 9/86 (10%) Frame = +1 Query: 76 QPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG--YPP--QG-YPPQGYPPPGYPPQGYPP- 237 +PP G PP YP +GYG +PPPG PP G YPP QG YPP G PPPG GYPP Sbjct: 5 EPPAGYPP---YPQQGYG---HPPPGAPPQGGYYPPPQQGHYPPPGGPPPG-QYGGYPPG 57 Query: 238 PPYSAQGYPPQYA---PQYAQPPPPH 306 PP AQGYPP A PQ+ PP H Sbjct: 58 PPPPAQGYPPHGAYPPPQHGAYPPQH 83 Score = 78.2 bits (191), Expect = 3e-13 Identities = 49/94 (52%), Positives = 51/94 (54%), Gaps = 10/94 (10%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP---GYPPPGYPPQ----GYPPQGYPP 207 PP Y Q G PPP P GY YPPP YPPPG PP GYPP G PP Sbjct: 6 PPAGYPPYPQQGYGHPPPGAPPQGGY----YPPPQQGHYPPPGGPPPGQYGGYPP-GPPP 60 Query: 208 P--GYPPQG-YPPPPYSAQGYPPQYAPQYAQPPP 300 P GYPP G YPPP + A YPPQ+ Y QPPP Sbjct: 61 PAQGYPPHGAYPPPQHGA--YPPQHG-GYGQPPP 91 [198][TOP] >UniRef100_P05143-2 Isoform 2 of Proline-rich protein 2 n=1 Tax=Mus musculus RepID=P05143-2 Length = 303 Score = 80.1 bits (196), Expect = 7e-14 Identities = 51/103 (49%), Positives = 54/103 (52%), Gaps = 13/103 (12%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 G PP++ Q PP G P PPQG PP G G + PP G PPPG PQ PPQG P Sbjct: 38 GSQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPG-GPQPRPPQGPP 95 Query: 205 PPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 PPG PPQG PPP P QG PP PQ P PPP Sbjct: 96 PPGGPQPRPPQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPP 138 Score = 77.8 bits (190), Expect = 4e-13 Identities = 51/106 (48%), Positives = 53/106 (50%), Gaps = 18/106 (16%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 77 PQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPG-GPQPRPPQ 134 Query: 196 GYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 G PPPG PPQG PPP P QG PP PQ P PPP Sbjct: 135 GPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPP 180 Score = 72.8 bits (177), Expect = 1e-11 Identities = 51/107 (47%), Positives = 53/107 (49%), Gaps = 19/107 (17%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG P Q PPQ Sbjct: 91 PQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPGGPQQR-PPQ 148 Query: 196 GYPPPGYP-----PQGYPPP----PYSAQGYPPQYAPQ--YAQPPPP 303 G PPPG PQG PPP P QG PP PQ Y Q PPP Sbjct: 149 GPPPPG-GPQPRPPQGPPPPAGPQPRPPQGPPPTGGPQQRYPQSPPP 194 Score = 72.0 bits (175), Expect = 2e-11 Identities = 49/120 (40%), Positives = 51/120 (42%), Gaps = 20/120 (16%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 105 PQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG-GPQQRPPQGPPPPG-GPQPRPPQ 162 Query: 196 GYPPPG----YPPQGYPPPPYSAQGYP--------PQYAPQYAQPPPPHHHNNSNNSSSP 339 G PPP PPQG PP Q YP PQ P PPP H P Sbjct: 163 GPPPPAGPQPRPPQGPPPTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPP 222 Score = 67.8 bits (164), Expect = 4e-10 Identities = 47/117 (40%), Positives = 50/117 (42%), Gaps = 29/117 (24%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEG----YGKEGYPPPGYPPPGYPPQGYP--- 189 P PP QQ+PP G PPP G PP+G G + PP G PP G P Q YP Sbjct: 133 PQGPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPAGPQPRPPQGPPPTGGPQQRYPQSP 192 Query: 190 -----PQGYPPPGYPPQGYP------------PPPYSAQGYPPQYAPQYAQP--PPP 303 PQ PP G PP G P P P QG PP PQ P PPP Sbjct: 193 PPPGGPQPRPPQGPPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTGGPQQRPPQGPPP 249 Score = 66.2 bits (160), Expect = 1e-09 Identities = 47/107 (43%), Positives = 48/107 (44%), Gaps = 22/107 (20%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTP---PPQGYPPEG----YGKEGYPPPG---YPPPGYPPQG-- 183 PT P Y Q PP G P PPQG PP G +G PP G P G PP G Sbjct: 180 PTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTGGP 239 Query: 184 --YPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP 294 PPQG PPPG PPQG PPP P QG P PQ P Sbjct: 240 QQRPPQGPPPPGGPQPRPPQGPPPPTGPQPRPTQGPHPTGGPQQTPP 286 Score = 64.7 bits (156), Expect = 3e-09 Identities = 42/88 (47%), Positives = 44/88 (50%), Gaps = 3/88 (3%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P NQ Q P PPP G PP ++G PPPG P P PPQG PP G P P P Sbjct: 19 PREELQNQIQIPNQRPPPSGSQPRPPVNGSQQGPPPPGGPQPR-PPQGPPPPGGPQPR-P 76 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PQG PPPP Q PP Q PPP Sbjct: 77 PQG-PPPPGGPQPRPP-------QGPPP 96 Score = 62.8 bits (151), Expect = 1e-08 Identities = 46/116 (39%), Positives = 48/116 (41%), Gaps = 27/116 (23%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTP----PPQGY---PPEGYGKEGYPPPGYPPPGYP-------- 174 P PP Q +PP G P P Q Y PP G + PP G PPPG P Sbjct: 161 PQGPPPPAGPQPRPPQGPPPTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGP 220 Query: 175 ----PQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQPPPPH 306 PQ P QG PP G PPQG PPP P QG PP PQ PH Sbjct: 221 PPTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPTGPQPRPTQGPH 276 Score = 58.9 bits (141), Expect = 2e-07 Identities = 45/119 (37%), Positives = 50/119 (42%), Gaps = 34/119 (28%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPP---------------------QGYPPEGYGKEGYPPPG 153 +P +PP Q +PP G PPP QG PP G G + PP G Sbjct: 188 YPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTG-GPQQRPPQG 246 Query: 154 YPPPGYPPQGYPPQGYPPPGYP-------------PQGYPPPPYSAQGYPPQYAPQYAQ 291 PPPG PQ PPQG PPP P PQ PP + QG PPQ PQ Q Sbjct: 247 PPPPG-GPQPRPPQGPPPPTGPQPRPTQGPHPTGGPQQTPPLAGNPQG-PPQGRPQGPQ 303 [199][TOP] >UniRef100_P05143 Proline-rich protein 2 n=1 Tax=Mus musculus RepID=PRP2_MOUSE Length = 317 Score = 80.1 bits (196), Expect = 7e-14 Identities = 51/103 (49%), Positives = 54/103 (52%), Gaps = 13/103 (12%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 G PP++ Q PP G P PPQG PP G G + PP G PPPG PQ PPQG P Sbjct: 38 GSQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPG-GPQPRPPQGPP 95 Query: 205 PPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 PPG PPQG PPP P QG PP PQ P PPP Sbjct: 96 PPGGPQPRPPQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPP 138 Score = 76.6 bits (187), Expect = 8e-13 Identities = 51/107 (47%), Positives = 53/107 (49%), Gaps = 19/107 (17%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG P Q PPQ Sbjct: 91 PQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPGGPQQR-PPQ 148 Query: 196 GYPPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQP-------PPP 303 G PPPG PPQG PPPP Q PPQ P A P PPP Sbjct: 149 GPPPPGGPQPRPPQG-PPPPAGPQPRPPQGPPPPAGPHLRPTQGPPP 194 Score = 75.9 bits (185), Expect = 1e-12 Identities = 48/99 (48%), Positives = 50/99 (50%), Gaps = 12/99 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 63 PQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPG-GPQPRPPQ 120 Query: 196 GYPPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 G PPPG PPQG PPPP Q PPQ P P P Sbjct: 121 GPPPPGGPQPRPPQG-PPPPGGPQQRPPQGPPPPGGPQP 158 Score = 75.1 bits (183), Expect = 2e-12 Identities = 51/107 (47%), Positives = 53/107 (49%), Gaps = 19/107 (17%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 105 PQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG-GPQQRPPQGPPPPG-GPQPRPPQ 162 Query: 196 GYPPPG----YPPQGYPPPPYS-----AQGYPPQYAPQ--YAQPPPP 303 G PPP PPQG PPPP QG PP PQ Y Q PPP Sbjct: 163 GPPPPAGPQPRPPQG-PPPPAGPHLRPTQGPPPTGGPQQRYPQSPPP 208 Score = 69.3 bits (168), Expect = 1e-10 Identities = 46/105 (43%), Positives = 49/105 (46%), Gaps = 17/105 (16%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G ++ YP PPP PQ PPQ Sbjct: 161 PQGPPPPAGPQPRPPQGPPPPAGPHLRPTQGPPPTGGPQQRYPQS--PPPPGGPQPRPPQ 218 Query: 196 GYPPPGYP---PQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 G PPPG P P PPP P QG PP PQ P PPP Sbjct: 219 GPPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTGGPQQRPPQGPPP 263 Score = 68.6 bits (166), Expect = 2e-10 Identities = 44/99 (44%), Positives = 47/99 (47%), Gaps = 12/99 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP--------- 192 P PP QQ+PP G PPP G P+ +G PPP P P PPQG PP Sbjct: 133 PQGPPPPGGPQQRPPQGPPPPGG--PQPRPPQGPPPPAGPQPR-PPQGPPPPAGPHLRPT 189 Query: 193 QGYPPPGYPPQGY---PPPPYSAQGYPPQYAPQYAQPPP 300 QG PP G P Q Y PPPP Q PPQ P P P Sbjct: 190 QGPPPTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPHP 228 Score = 66.2 bits (160), Expect = 1e-09 Identities = 47/107 (43%), Positives = 48/107 (44%), Gaps = 22/107 (20%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTP---PPQGYPPEG----YGKEGYPPPG---YPPPGYPPQG-- 183 PT P Y Q PP G P PPQG PP G +G PP G P G PP G Sbjct: 194 PTGGPQQRYPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTGGP 253 Query: 184 --YPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP 294 PPQG PPPG PPQG PPP P QG P PQ P Sbjct: 254 QQRPPQGPPPPGGPQPRPPQGPPPPTGPQPRPTQGPHPTGGPQQTPP 300 Score = 64.7 bits (156), Expect = 3e-09 Identities = 42/88 (47%), Positives = 44/88 (50%), Gaps = 3/88 (3%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P NQ Q P PPP G PP ++G PPPG P P PPQG PP G P P P Sbjct: 19 PREELQNQIQIPNQRPPPSGSQPRPPVNGSQQGPPPPGGPQPR-PPQGPPPPGGPQPR-P 76 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PQG PPPP Q PP Q PPP Sbjct: 77 PQG-PPPPGGPQPRPP-------QGPPP 96 Score = 58.9 bits (141), Expect = 2e-07 Identities = 45/119 (37%), Positives = 50/119 (42%), Gaps = 34/119 (28%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPP---------------------QGYPPEGYGKEGYPPPG 153 +P +PP Q +PP G PPP QG PP G G + PP G Sbjct: 202 YPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPPTGPQPRPTQGPPPTG-GPQQRPPQG 260 Query: 154 YPPPGYPPQGYPPQGYPPPGYP-------------PQGYPPPPYSAQGYPPQYAPQYAQ 291 PPPG PQ PPQG PPP P PQ PP + QG PPQ PQ Q Sbjct: 261 PPPPG-GPQPRPPQGPPPPTGPQPRPTQGPHPTGGPQQTPPLAGNPQG-PPQGRPQGPQ 317 Score = 58.2 bits (139), Expect = 3e-07 Identities = 44/112 (39%), Positives = 45/112 (40%), Gaps = 23/112 (20%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYP------------ 174 P P Q PP G P Q Y PP G + PP G PPPG P Sbjct: 180 PPAGPHLRPTQGPPPTGG-PQQRYPQSPPPPGGPQPRPPQGPPPPGGPHPRPTQGPPPTG 238 Query: 175 PQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQPPPPH 306 PQ P QG PP G PPQG PPP P QG PP PQ PH Sbjct: 239 PQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPTGPQPRPTQGPH 290 [200][TOP] >UniRef100_Q6GLH3 Splicing factor 3a, subunit 2, 66kDa n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q6GLH3_XENTR Length = 412 Score = 79.7 bits (195), Expect = 9e-14 Identities = 44/95 (46%), Positives = 44/95 (46%), Gaps = 6/95 (6%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 HP PP S PP G PPP PP PPPG PPPG PP G PP G PPP Sbjct: 290 HPPVPPPSL-----PPPGVPPPGVPPPPN---PAVPPPGVPPPGIPPPGIPPPGVPPP-- 339 Query: 217 PPQGYPPPPY------SAQGYPPQYAPQYAQPPPP 303 P G PPPP G PP AP PP P Sbjct: 340 PAPGVPPPPAPGVPLPPTPGVPPPPAPGVPPPPAP 374 Score = 75.9 bits (185), Expect = 1e-12 Identities = 40/91 (43%), Positives = 40/91 (43%), Gaps = 3/91 (3%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP---QGYPPP 210 P TP Q PP PP G P PPP PPPG PP G PP PPP Sbjct: 266 PGTPAPPVPPPQLPPAPVVPPPGVHPP------VPPPSLPPPGVPPPGVPPPPNPAVPPP 319 Query: 211 GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 G PP G PPP G PP AP PP P Sbjct: 320 GVPPPGIPPPGIPPPGVPPPPAPGVPPPPAP 350 Score = 66.2 bits (160), Expect = 1e-09 Identities = 44/107 (41%), Positives = 45/107 (42%), Gaps = 17/107 (15%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYP----PEGYGKEGYPPPGYPP-PGYPPQGY---- 186 G PPM + PP PPP G P P G PPP PP P PP G Sbjct: 240 GIQARPPMP---ENMPP---PPPGGLPMPPMPPGTPAPPVPPPQLPPAPVVPPPGVHPPV 293 Query: 187 PPQGYPPPGYPPQGYPPPPYSA--------QGYPPQYAPQYAQPPPP 303 PP PPPG PP G PPPP A G PP P PPPP Sbjct: 294 PPPSLPPPGVPPPGVPPPPNPAVPPPGVPPPGIPPPGIPPPGVPPPP 340 Score = 56.6 bits (135), Expect = 8e-07 Identities = 39/89 (43%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP-QGYPPPG 213 +P PP PP G PPP G PP P PG PPP P PP G PPP Sbjct: 313 NPAVPPPGVPPPGIPPPGIPPP-GVPPP-------PAPGVPPPPAPGVPLPPTPGVPPP- 363 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 P G PPPP A G PP AP P P Sbjct: 364 -PAPGVPPPP--APGVPPP-APGVLPPGP 388 Score = 53.5 bits (127), Expect = 7e-06 Identities = 36/88 (40%), Positives = 38/88 (43%), Gaps = 4/88 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGT---PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGY-PPQGYPPPGY 216 PP Q +PP+ PPP G P G P P PPP PP PP G PP Sbjct: 235 PPAINGIQARPPMPENMPPPPPGGLPMPPMPPGTPAPPVPPPQLPPAPVVPPPGVHPP-V 293 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 PP PPP G PP P A PPP Sbjct: 294 PPPSLPPPGVPPPGVPP--PPNPAVPPP 319 [201][TOP] >UniRef100_Q9LLZ9 Adhesive/proline-rich protein homolog n=1 Tax=Pinus taeda RepID=Q9LLZ9_PINTA Length = 86 Score = 79.7 bits (195), Expect = 9e-14 Identities = 49/89 (55%), Positives = 49/89 (55%) Frame = +1 Query: 130 KEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 K YP YP PGYP QGYP QGYP GYP QGYP Y Q P Q P Y Q PP Sbjct: 5 KYAYP---YPAPGYP-QGYP-QGYPQ-GYP-QGYPQG-YPQQAPPVQAPPAYGQQQPPRQ 56 Query: 310 HNNSNNSSSPGCLEGCCAALCCCCLLDAC 396 G LEGC AALCCCCLLD C Sbjct: 57 Q---------GFLEGCLAALCCCCLLDEC 76 [202][TOP] >UniRef100_A5BDW1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BDW1_VITVI Length = 300 Score = 79.7 bits (195), Expect = 9e-14 Identities = 46/86 (53%), Positives = 50/86 (58%), Gaps = 8/86 (9%) Frame = +1 Query: 67 NQQQPPVGTPPPQ--GY-PPEGYGKEGYPPP-GYPPPGYPPQG-YPPQGYPPP-GYPPQG 228 N + P + PP Q GY PP G+ GYPPP G PP YPP G YPP GYPPP GYP Sbjct: 191 NYRPPHMACPPQQSAGYSPPCGFPPVGYPPPCGLPPAEYPPPGVYPPAGYPPPGGYPAAE 250 Query: 229 YPPPP-YSAQGY-PPQYAPQYAQPPP 300 YPPP + A GY PP P PPP Sbjct: 251 YPPPSGHQAAGYSPPSEHPAAGYPPP 276 Score = 74.7 bits (182), Expect = 3e-12 Identities = 41/77 (53%), Positives = 43/77 (55%), Gaps = 4/77 (5%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPP-GYPPPGYPPQ-GYPPQGYPPPG-YPPQGYPPPP-YSAQGY 261 PP PP+ GY PP G+PP GYPP G PP YPPPG YPP GYPPP Y A Y Sbjct: 194 PPHMACPPQQ--SAGYSPPCGFPPVGYPPPCGLPPAEYPPPGVYPPAGYPPPGGYPAAEY 251 Query: 262 PPQYAPQYAQPPPPHHH 312 PP Q A PP H Sbjct: 252 PPPSGHQAAGYSPPSEH 268 Score = 68.9 bits (167), Expect = 2e-10 Identities = 40/81 (49%), Positives = 44/81 (54%), Gaps = 7/81 (8%) Frame = +1 Query: 46 TPPMSYYNQQQPPVGTPPPQG-----YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPP 210 +PP + PPVG PPP G YPP G YPP GYPPPG GYP YPPP Sbjct: 208 SPPCGF-----PPVGYPPPCGLPPAEYPPPGV----YPPAGYPPPG----GYPAAEYPPP 254 Query: 211 -GYPPQGY-PPPPYSAQGYPP 267 G+ GY PP + A GYPP Sbjct: 255 SGHQAAGYSPPSEHPAAGYPP 275 Score = 66.6 bits (161), Expect = 8e-10 Identities = 38/82 (46%), Positives = 42/82 (51%), Gaps = 7/82 (8%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP------GY-PPQGYPP 192 G+P PP + PP G PP GYPP G GYP YPPP GY PP +P Sbjct: 217 GYP--PPCGLPPAEYPPPGVYPPAGYPPPG----GYPAAEYPPPSGHQAAGYSPPSEHPA 270 Query: 193 QGYPPPGYPPQGYPPPPYSAQG 258 GYPPPG GYPP Y+ G Sbjct: 271 AGYPPPG----GYPPALYTLPG 288 Score = 61.6 bits (148), Expect = 3e-08 Identities = 36/78 (46%), Positives = 39/78 (50%), Gaps = 8/78 (10%) Frame = +1 Query: 121 GYGKEGYPPPGYPPP-----GY-PPQGYPPQGYPPP-GYPPQGYPPPP-YSAQGYPPQYA 276 GY Y PP P GY PP G+PP GYPPP G PP YPPP Y GYPP Sbjct: 186 GYDAGNYRPPHMACPPQQSAGYSPPCGFPPVGYPPPCGLPPAEYPPPGVYPPAGYPPPGG 245 Query: 277 PQYAQPPPPHHHNNSNNS 330 A+ PPP H + S Sbjct: 246 YPAAEYPPPSGHQAAGYS 263 [203][TOP] >UniRef100_A2ENJ3 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2ENJ3_TRIVA Length = 113 Score = 79.7 bits (195), Expect = 9e-14 Identities = 40/71 (56%), Positives = 43/71 (60%), Gaps = 4/71 (5%) Frame = +1 Query: 97 PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ-GYPPPGYPPQGY---PPPPYSAQGYP 264 P GYP +GY ++ YP YP GYPPQGYPPQ G PPP PPQGY PP YSA P Sbjct: 44 PQGGYPQQGYPQQPYPQQSYPQQGYPPQGYPPQGGVPPP--PPQGYAGPPPQNYSAPPSP 101 Query: 265 PQYAPQYAQPP 297 P YA PP Sbjct: 102 PPPPQGYAPPP 112 Score = 77.0 bits (188), Expect = 6e-13 Identities = 36/66 (54%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = +1 Query: 109 YPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQ-YAPQY 285 YP GY ++GYP YP YP QGYPPQGYPP G P PPPP G PPQ Y+ Sbjct: 43 YPQGGYPQQGYPQQPYPQQSYPQQGYPPQGYPPQGGVP---PPPPQGYAGPPPQNYSAPP 99 Query: 286 AQPPPP 303 + PPPP Sbjct: 100 SPPPPP 105 Score = 71.2 bits (173), Expect = 3e-11 Identities = 35/70 (50%), Positives = 38/70 (54%), Gaps = 7/70 (10%) Frame = +1 Query: 82 PVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGY----PPQGY---PPPGYPPQGYPPP 240 P G P QGYP + Y ++ YP GYPP GYPPQG PPQGY PP Y PPP Sbjct: 44 PQGGYPQQGYPQQPYPQQSYPQQGYPPQGYPPQGGVPPPPPQGYAGPPPQNYSAPPSPPP 103 Query: 241 PYSAQGYPPQ 270 P PPQ Sbjct: 104 PPQGYAPPPQ 113 Score = 69.3 bits (168), Expect = 1e-10 Identities = 38/71 (53%), Positives = 40/71 (56%), Gaps = 7/71 (9%) Frame = +1 Query: 52 PMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-GYPPPGYPPQGY---PPQGY---PPP 210 P Y QQ P P Q YP +GY +GYPP G PPP PPQGY PPQ Y P P Sbjct: 44 PQGGYPQQGYPQQPYPQQSYPQQGYPPQGYPPQGGVPPP--PPQGYAGPPPQNYSAPPSP 101 Query: 211 GYPPQGYPPPP 243 PPQGY PPP Sbjct: 102 PPPPQGYAPPP 112 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/53 (56%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +1 Query: 154 YPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQ-YAQPPPPHH 309 YP GYP QGYP Q YP YP QGYPP Y QG P PQ YA PPP ++ Sbjct: 43 YPQGGYPQQGYPQQPYPQQSYPQQGYPPQGYPPQGGVPPPPPQGYAGPPPQNY 95 [204][TOP] >UniRef100_P37705 Glycine-rich protein A3 n=1 Tax=Daucus carota RepID=GRP3_DAUCA Length = 195 Score = 79.7 bits (195), Expect = 9e-14 Identities = 39/71 (54%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP--GYPPQGYPPQGYPPPGYPPQGYPPPP 243 Q P G PPQGYPP G GYPP GYPP GYPPQGYPP G GYPPQGYPP Sbjct: 32 QYPPAAGGYPPQGYPPAG---GGYPPQGYPPAGGGYPPQGYPPAG---GGYPPQGYPPAG 85 Query: 244 YSAQGYPPQYA 276 + + P ++ Sbjct: 86 HHSGSSAPHHS 96 Score = 71.2 bits (173), Expect = 3e-11 Identities = 39/68 (57%), Positives = 40/68 (58%), Gaps = 7/68 (10%) Frame = +1 Query: 139 YPPPGYPPP--GYPPQGYPPQGYPPPGYPPQGYPPPP--YSAQGYPPQ---YAPQYAQPP 297 YPP YPP GYPPQGYPP G GYPPQGYPP Y QGYPP Y PQ PP Sbjct: 28 YPPGQYPPAAGGYPPQGYPPAG---GGYPPQGYPPAGGGYPPQGYPPAGGGYPPQ-GYPP 83 Query: 298 PPHHHNNS 321 HH +S Sbjct: 84 AGHHSGSS 91 Score = 54.3 bits (129), Expect = 4e-06 Identities = 38/78 (48%), Positives = 39/78 (50%), Gaps = 8/78 (10%) Frame = -1 Query: 296 GG*AY*GAY*GG*PCAEY--GGGGYPCGG*P--GGGYPCGGYP--CGGYPGGGYP--GGG 141 GG A G Y P +Y GGYP G P GGGYP GYP GGYP GYP GGG Sbjct: 20 GGLAGGGHY----PPGQYPPAAGGYPPQGYPPAGGGYPPQGYPPAGGGYPPQGYPPAGGG 75 Query: 140 YPSFPYPSGG*PCGGGVP 87 YP YP G G P Sbjct: 76 YPPQGYPPAGHHSGSSAP 93 [205][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 79.3 bits (194), Expect = 1e-13 Identities = 46/106 (43%), Positives = 46/106 (43%), Gaps = 18/106 (16%) Frame = +1 Query: 40 PTTPPMSY-------YNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGY---PPQ 180 P PP SY Y PP PPP Y PP YG PPP PPP Y PP Sbjct: 122 PPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPP 181 Query: 181 GYPPQGYPPPGYPPQGYPPPPYSAQG-----YPPQYAPQYAQPPPP 303 Y P PPP PP Y PPP A G PP P Y PPPP Sbjct: 182 AYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPP 227 Score = 79.3 bits (194), Expect = 1e-13 Identities = 43/96 (44%), Positives = 44/96 (45%), Gaps = 11/96 (11%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGY---PPQGYPPQGYPPP 210 PP Y PP PPP Y PP YG PPP PPP Y PP Y P PPP Sbjct: 155 PPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPP 214 Query: 211 GYPPQGYPPPPYSAQG-----YPPQYAPQYAQPPPP 303 PP Y PPP A G PP P Y+ PPPP Sbjct: 215 PPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPP 250 Score = 79.3 bits (194), Expect = 1e-13 Identities = 46/96 (47%), Positives = 47/96 (48%), Gaps = 8/96 (8%) Frame = +1 Query: 40 PTTPPMSY-YNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGY---PPQGYPPQG 198 P PP +Y Y PP PPP Y PP YG PPP PPP Y PP Y P Sbjct: 275 PPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYG----PPPPPPPPAYAPPPPPAYGPPA 330 Query: 199 YPPPGYPPQGY-PPPPYSAQGYPPQYAPQYAQPPPP 303 PPP PP Y PPPP A PP P YA PPPP Sbjct: 331 PPPPPPPPPAYAPPPPPPAYA-PPPPPPAYAPPPPP 365 Score = 79.0 bits (193), Expect = 2e-13 Identities = 44/98 (44%), Positives = 45/98 (45%), Gaps = 13/98 (13%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGY---PPQGYPPQGYPPP 210 PP Y PP PPP Y PP YG PPP PPP Y PP Y P PPP Sbjct: 178 PPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPP 237 Query: 211 GYPPQGY-------PPPPYSAQGYPPQYAPQYAQPPPP 303 PP Y PPPP +A G PP P Y PPPP Sbjct: 238 PPPPPAYSPPPPPPPPPPPAAYGPPP--PPAYGPPPPP 273 Score = 78.2 bits (191), Expect = 3e-13 Identities = 43/101 (42%), Positives = 44/101 (43%), Gaps = 13/101 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGY-------PPQGYP 189 P PP Y+ PP PPP Y PP YG PPP PP Y PP P Sbjct: 236 PPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPP 295 Query: 190 PQGY---PPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P Y PPP Y P PPPP A PP Y P PPPP Sbjct: 296 PPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPP 336 Score = 76.6 bits (187), Expect = 8e-13 Identities = 45/105 (42%), Positives = 47/105 (44%), Gaps = 20/105 (19%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGY-----PPQGYPPQGY- 201 PP Y PP PPP Y PP YG PPP PPP Y PP PP Y Sbjct: 201 PPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYG 260 Query: 202 --PPPGY--PPQGYPPPPYSAQGY-------PPQYAPQYAQPPPP 303 PPP Y PP PPPP +A Y PP P Y+ PPPP Sbjct: 261 PPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPP 305 Score = 74.3 bits (181), Expect = 4e-12 Identities = 38/91 (41%), Positives = 39/91 (42%), Gaps = 3/91 (3%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGY---PPP 210 P PP +Y P PPP PP PPP Y PP PP PP Y PPP Sbjct: 99 PPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPP 158 Query: 211 GYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 Y P PPPP Y P P Y PPPP Sbjct: 159 AYGPPPPPPPPPPPPAYGPPPPPAYGPPPPP 189 Score = 73.6 bits (179), Expect = 7e-12 Identities = 39/88 (44%), Positives = 39/88 (44%), Gaps = 3/88 (3%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGY---PPPGYP 219 PP Y PP PPP PP Y PPP Y PP PP PP Y PPP Y Sbjct: 84 PPPVYAPPPPPPAYAPPP---PPPAYAPP--PPPAYAPPPPPPPPPPPPSYGPPPPPAYG 138 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 P PPPP Y P P Y PPPP Sbjct: 139 PPPPPPPPPPPPAYGPPPPPAYGPPPPP 166 Score = 73.6 bits (179), Expect = 7e-12 Identities = 43/104 (41%), Positives = 43/104 (41%), Gaps = 19/104 (18%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGY---PPQGYPPQGYPPP 210 PP Y PP PPP Y PP YG PPP PPP Y PP Y P PPP Sbjct: 109 PPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPP 168 Query: 211 GYPPQGY---------PPPPYSAQGYPPQYA----PQYAQPPPP 303 PP Y PPPP PP Y P Y PPPP Sbjct: 169 PPPPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPP 212 Score = 71.2 bits (173), Expect = 3e-11 Identities = 40/94 (42%), Positives = 41/94 (43%), Gaps = 6/94 (6%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPV-GTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 P PP +Y PP PPP Y P PPP Y PP PP Y P PPP Sbjct: 90 PPPPPPAYAPPPPPPAYAPPPPPAYAPPPPPPPPPPPPSYGPP--PPPAYGPPPPPPPPP 147 Query: 217 PPQGYPPPPYSAQG-----YPPQYAPQYAQPPPP 303 PP Y PPP A G PP P Y PPPP Sbjct: 148 PPPAYGPPPPPAYGPPPPPPPPPPPPAYGPPPPP 181 Score = 70.1 bits (170), Expect = 7e-11 Identities = 41/98 (41%), Positives = 43/98 (43%), Gaps = 10/98 (10%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPE----GYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 P PP +Y P G PPP PP YG PPP PPP Y P P G PP Sbjct: 252 PPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPP 311 Query: 208 PGYPPQGYPPPPYS------AQGYPPQYAPQYAQPPPP 303 P PP PPPP + PP P YA PPPP Sbjct: 312 PPPPPAYAPPPPPAYGPPAPPP--PPPPPPAYAPPPPP 347 Score = 67.8 bits (164), Expect = 4e-10 Identities = 38/97 (39%), Positives = 41/97 (42%), Gaps = 9/97 (9%) Frame = +1 Query: 40 PTTPPMSYYNQQQ---------PPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP 192 P PP +Y + + PP PPP Y P PPP Y PP PP PP Sbjct: 56 PPPPPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAPPP------PPPAYAPPPPPPAYAPP 109 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PPP Y P PPPP Y P P Y PPPP Sbjct: 110 ---PPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPP 143 Score = 65.1 bits (157), Expect = 2e-09 Identities = 39/94 (41%), Positives = 41/94 (43%), Gaps = 4/94 (4%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 G P PP PP PP PP YG PPP PPP Y P PP Y PP Sbjct: 308 GPPPPPP--------PPAYAPP----PPPAYGPPAPPPPPPPPPAYAPPP-PPPAYAPPP 354 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQ----YAQPPPP 303 PP PPPP PP+Y+P Y P PP Sbjct: 355 PPPAYAPPPP------PPKYSPAPIVVYGPPAPP 382 Score = 61.6 bits (148), Expect = 3e-08 Identities = 39/100 (39%), Positives = 41/100 (41%), Gaps = 12/100 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPV----GTPPPQGY---PPEGYGKEGYPPP-----GYPPPGYPPQG 183 P PP Y+ PP PPP Y PP YG PPP Y PP PP Sbjct: 291 PPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAY 350 Query: 184 YPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PP PPP Y P PPPP + Y P PPPP Sbjct: 351 APPP--PPPAYAPP--PPPPKYSPAPIVVYGPPAPPPPPP 386 Score = 56.2 bits (134), Expect = 1e-06 Identities = 37/84 (44%), Positives = 37/84 (44%), Gaps = 10/84 (11%) Frame = +1 Query: 82 PVGTPPPQGYPPEGYGK-------EGYP-PPGY--PPPGYPPQGYPPQGYPPPGYPPQGY 231 P PPP PP Y G P PP Y PPP Y P PP PPP PP Y Sbjct: 52 PAPQPPP---PPPAYDDCDEIVLVPGKPAPPAYAPPPPVYAPPPPPPAYAPPP--PPPAY 106 Query: 232 PPPPYSAQGYPPQYAPQYAQPPPP 303 PPP PP YAP PPPP Sbjct: 107 APPP------PPAYAPPPPPPPPP 124 [206][TOP] >UniRef100_UPI00015DEFD0 proline rich protein HaeIII subfamily 1 n=1 Tax=Mus musculus RepID=UPI00015DEFD0 Length = 261 Score = 79.3 bits (194), Expect = 1e-13 Identities = 52/116 (44%), Positives = 55/116 (47%), Gaps = 26/116 (22%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPGYP---------- 174 G PP++ Q PP G P PPQG PP G G + PP G PPPG P Sbjct: 38 GFQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPGVPQPRPPQGPPP 96 Query: 175 ---PQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 PQ PPQG PPPG PPQG PPP P QG PP PQ P PPP Sbjct: 97 PGGPQQRPPQGPPPPGGPQHRPPQGPPPPGGPQPRPPQGPPPPGGPQLRPPQGPPP 152 Score = 78.6 bits (192), Expect = 2e-13 Identities = 49/99 (49%), Positives = 51/99 (51%), Gaps = 12/99 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 77 PQGPPPPGVPQPRPPQGPPPPGGPQQRPPQGPPPPG-GPQHRPPQGPPPPG-GPQPRPPQ 134 Query: 196 GYPPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 G PPPG PPQG PPPP Q PPQ P A P P Sbjct: 135 GPPPPGGPQLRPPQG-PPPPAGPQPRPPQGPPPPAGPQP 172 Score = 73.6 bits (179), Expect = 7e-12 Identities = 51/118 (43%), Positives = 53/118 (44%), Gaps = 30/118 (25%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYP------- 174 P PP QQ+PP G PPP QG PP G G + PP G PPPG P Sbjct: 91 PQGPPPPGGPQQRPPQGPPPPGGPQHRPPQGPPPPG-GPQPRPPQGPPPPGGPQLRPPQG 149 Query: 175 ------PQGYPPQGYPPPG----YPPQGYP---PPPYSAQGYPPQYAPQYAQP--PPP 303 PQ PPQG PPP PPQG P P P QG PP PQ P PPP Sbjct: 150 PPPPAGPQPRPPQGPPPPAGPQPRPPQGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPP 207 Score = 67.0 bits (162), Expect = 6e-10 Identities = 51/122 (41%), Positives = 55/122 (45%), Gaps = 29/122 (23%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQG---YPPEG----YGKEGYPPPGYPPPGYP--- 174 QHR P PP Q +PP G PPP G PP+G G + PP G PPP P Sbjct: 115 QHRP-PQGPPPPGGPQPRPPQGPPPPGGPQLRPPQGPPPPAGPQPRPPQGPPPPAGPQPR 173 Query: 175 ---------PQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYA--QPP 297 PQ P QG PP G PPQG PPP P QG PP PQ + Q P Sbjct: 174 PPQGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPGGPQPSPTQGP 233 Query: 298 PP 303 PP Sbjct: 234 PP 235 Score = 66.2 bits (160), Expect = 1e-09 Identities = 42/103 (40%), Positives = 45/103 (43%), Gaps = 11/103 (10%) Frame = +1 Query: 67 NQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYP--------PQGYPPQGYPPPG 213 NQ Q P PPP G+ PP ++G PPPG P P P PQ PPQG PPPG Sbjct: 25 NQIQIPNQRPPPSGFQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG 84 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 PQ PP G P Q PQ PP H PG Sbjct: 85 V-PQPRPPQGPPPPGGPQQRPPQGPPPPGGPQHRPPQGPPPPG 126 Score = 65.9 bits (159), Expect = 1e-09 Identities = 44/100 (44%), Positives = 46/100 (46%), Gaps = 15/100 (15%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPGYPPPGYPPQG----YPPQG 198 P PP Q +PP G PPP G PP+G G P P G PP G PPQG Sbjct: 147 PQGPPPPAGPQPRPPQGPPPPAGPQPRPPQGPPTTG--PQPRPTQGPPPTGGPQQRPPQG 204 Query: 199 YPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP 294 PPPG PPQG PPP P QG PP PQ P Sbjct: 205 PPPPGGPQPRPPQGPPPPGGPQPSPTQGPPPTGGPQQTPP 244 Score = 61.6 bits (148), Expect = 3e-08 Identities = 42/91 (46%), Positives = 45/91 (49%), Gaps = 7/91 (7%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPG----YPPQGYP 189 +G PTT P Q PP G P PPQG PP G G + PP G PPPG P QG P Sbjct: 176 QGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPPPG-GPQPRPPQGPPPPGGPQPSPTQGPP 234 Query: 190 PQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQ 282 P G PQ PP + QG PPQ PQ Sbjct: 235 PTG------GPQQTPPLAGNTQG-PPQGRPQ 258 [207][TOP] >UniRef100_B8C8Q8 Predicted protein n=1 Tax=Thalassiosira pseudonana CCMP1335 RepID=B8C8Q8_THAPS Length = 516 Score = 79.3 bits (194), Expect = 1e-13 Identities = 50/121 (41%), Positives = 57/121 (47%), Gaps = 15/121 (12%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPE---GYGKEGYPP--PGYPP---PGYPPQ 180 Q+ G+P + + PP G P GYPP G GYPP PGYPP PGYPP Sbjct: 246 QYPGYPPHAGIGGAHGPLPPQGVVAPGGYPPAPHLGMPPYGYPPHYPGYPPQGYPGYPPY 305 Query: 181 GYP---PQGYP---PPGYPPQGYPP-PPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSP 339 GYP PQGYP P + PQGYP PP + Y Y P P PH + P Sbjct: 306 GYPGVTPQGYPGQHPQQHLPQGYPGYPPMAPYPYGGHYPPYSTPPRGPHQYLEQPPWGRP 365 Query: 340 G 342 G Sbjct: 366 G 366 [208][TOP] >UniRef100_B8AU64 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AU64_ORYSI Length = 74 Score = 79.3 bits (194), Expect = 1e-13 Identities = 43/80 (53%), Positives = 45/80 (56%), Gaps = 6/80 (7%) Frame = +1 Query: 178 QGYPP--QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYA----QPPPPHHHNNSNNSSSP 339 QG PP YPPPG GYPPP Y A PP A Y QPPPP + S Sbjct: 4 QGPPPGTAAYPPPG---TGYPPPAYGA---PPPVAADYGGYQQQPPPPPQDSQSRGD--- 54 Query: 340 GCLEGCCAALCCCCLLDACF 399 G L+GCCAALCCCCLLD CF Sbjct: 55 GFLKGCCAALCCCCLLDMCF 74 [209][TOP] >UniRef100_A9VE52 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VE52_MONBE Length = 458 Score = 79.3 bits (194), Expect = 1e-13 Identities = 40/91 (43%), Positives = 48/91 (52%), Gaps = 5/91 (5%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTP--PPQGYP---PEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 PP ++ Q PP P PPQ +P P+ Y PP YPP +P Q + PQ YPP Sbjct: 364 PPQAHTPQAYPPQAYPYNPPQTHPHDPPQAYPYN--PPQAYPPQAHPSQAHSPQAYPPQA 421 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPH 306 YPPQ YP Y +Q +PPQ P Q P PH Sbjct: 422 YPPQAYPSQAYPSQAHPPQAYP--PQAPSPH 450 Score = 79.3 bits (194), Expect = 1e-13 Identities = 36/82 (43%), Positives = 42/82 (51%), Gaps = 1/82 (1%) Frame = +1 Query: 37 HPTTPPMSY-YNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPG 213 HP PP +Y YN PPQ YPP+ + + + P YPP YPPQ YP Q YP Sbjct: 386 HPHDPPQAYPYN---------PPQAYPPQAHPSQAHSPQAYPPQAYPPQAYPSQAYPSQA 436 Query: 214 YPPQGYPPPPYSAQGYPPQYAP 279 +PPQ YPP S G P P Sbjct: 437 HPPQAYPPQAPSPHGRPWSQQP 458 [210][TOP] >UniRef100_A0E3L2 Chromosome undetermined scaffold_77, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0E3L2_PARTE Length = 344 Score = 79.3 bits (194), Expect = 1e-13 Identities = 52/91 (57%), Positives = 53/91 (58%), Gaps = 6/91 (6%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPP-PGYPP-PGYPPQ-GYPPQ-GYPP 207 P PP Y QQ P PP GYPP+ YPP PGY P PGYP Q GYPPQ GYPP Sbjct: 4 PPYPPPGYPGQQGQP-NYPPQPGYPPQ----PNYPPQPGYAPQPGYPTQPGYPPQPGYPP 58 Query: 208 P-GYPPQ-GYPPPPYSAQGYPPQYAPQYAQP 294 GYPPQ GYPP P GYPPQ Y QP Sbjct: 59 QAGYPPQTGYPPQP----GYPPQTG--YPQP 83 Score = 77.0 bits (188), Expect = 6e-13 Identities = 51/87 (58%), Positives = 54/87 (62%), Gaps = 12/87 (13%) Frame = +1 Query: 76 QPPVGTPPPQGYPPEGYGKEGYPP-PGYPP-PGYPPQ-GYPPQ-GYPP-PGYPPQ-GYPP 237 QPP PP GYP + G+ YPP PGYPP P YPPQ GY PQ GYP PGYPPQ GYPP Sbjct: 3 QPPY---PPPGYPGQ-QGQPNYPPQPGYPPQPNYPPQPGYAPQPGYPTQPGYPPQPGYPP 58 Query: 238 ----PPYSAQGYPPQ--YAPQYAQPPP 300 PP + GYPPQ Y PQ P P Sbjct: 59 QAGYPPQT--GYPPQPGYPPQTGYPQP 83 Score = 68.9 bits (167), Expect = 2e-10 Identities = 41/71 (57%), Positives = 41/71 (57%), Gaps = 16/71 (22%) Frame = +1 Query: 139 YPPPGYP----PPGYPPQ-GYPPQ-GYPP-PGYPPQ-------GYPPPPYSAQGYPPQ-- 270 YPPPGYP P YPPQ GYPPQ YPP PGY PQ GYPP P GYPPQ Sbjct: 6 YPPPGYPGQQGQPNYPPQPGYPPQPNYPPQPGYAPQPGYPTQPGYPPQP----GYPPQAG 61 Query: 271 YAPQYAQPPPP 303 Y PQ PP P Sbjct: 62 YPPQTGYPPQP 72 Score = 59.3 bits (142), Expect = 1e-07 Identities = 38/82 (46%), Positives = 40/82 (48%), Gaps = 12/82 (14%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQ---------PPVGTPPPQGYPPEGYGKEGYPPPGYPP-PGYPPQ 180 +G P PP Y Q P G P GYPP+ PGYPP GYPPQ Sbjct: 15 QGQPNYPPQPGYPPQPNYPPQPGYAPQPGYPTQPGYPPQ---------PGYPPQAGYPPQ 65 Query: 181 -GYPPQGYPPPGYPPQ-GYPPP 240 GYPPQ PGYPPQ GYP P Sbjct: 66 TGYPPQ----PGYPPQTGYPQP 83 [211][TOP] >UniRef100_A8N3U3 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8N3U3_COPC7 Length = 554 Score = 79.3 bits (194), Expect = 1e-13 Identities = 51/100 (51%), Positives = 53/100 (53%), Gaps = 10/100 (10%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEG-YPPPGYPPPGYPPQGYPP-QGYPP-- 207 P PP S Y PP P P YPP G G YPPP P GYP GYPP QGYP Sbjct: 15 PGQPPASPY---PPPGAAPQPGQYPPPGGAPPGQYPPPPGAPQGYP--GYPPAQGYPAYP 69 Query: 208 --PGYPP----QGYPPPPYSAQGYPPQYAPQYAQPPPPHH 309 PGYPP GYP PP +A G PPQ A Y PP PH+ Sbjct: 70 AYPGYPPPGGYPGYPTPP-AAPGQPPQQAGHY--PPYPHY 106 Score = 72.0 bits (175), Expect = 2e-11 Identities = 46/104 (44%), Positives = 49/104 (47%), Gaps = 17/104 (16%) Frame = +1 Query: 52 PMSYYNQQQPPVGTPPPQGYPPEGYGKEG--YPPPGYPPPG-YPPQGYPPQGYPPPGYPP 222 P + P G PP YPP G + YPPPG PPG YPP PQGYP GYPP Sbjct: 4 PAAQNQPAAPAPGQPPASPYPPPGAAPQPGQYPPPGGAPPGQYPPPPGAPQGYP--GYPP 61 Query: 223 -QGYP--------PPPYSAQGYP-----PQYAPQYAQPPPPHHH 312 QGYP PPP GYP P PQ A PP+ H Sbjct: 62 AQGYPAYPAYPGYPPPGGYPGYPTPPAAPGQPPQQAGHYPPYPH 105 Score = 59.3 bits (142), Expect = 1e-07 Identities = 35/88 (39%), Positives = 40/88 (45%), Gaps = 12/88 (13%) Frame = +1 Query: 115 PEGYGKEGYPPPGYPPPG-YPPQGYPPQG--YPPPGYPPQG-YPPPPYSAQGYP------ 264 P + P PG PP YPP G PQ YPPPG P G YPPPP + QGYP Sbjct: 4 PAAQNQPAAPAPGQPPASPYPPPGAAPQPGQYPPPGGAPPGQYPPPPGAPQGYPGYPPAQ 63 Query: 265 --PQYAPQYAQPPPPHHHNNSNNSSSPG 342 P Y PPP + ++PG Sbjct: 64 GYPAYPAYPGYPPPGGYPGYPTPPAAPG 91 Score = 55.1 bits (131), Expect = 2e-06 Identities = 45/116 (38%), Positives = 48/116 (41%), Gaps = 26/116 (22%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGYP--PEGYGKEGYPPPG---YPP-PGYPPQG-YP 189 +G+P PP Y G PPP GYP P G PP YPP P YPP G YP Sbjct: 54 QGYPGYPPAQGYPAYPAYPGYPPPGGYPGYPTPPAAPGQPPQQAGHYPPYPHYPPYGAYP 113 Query: 190 PQG-----YPPPGYP----------PQGYPPPPYSAQGYPPQYAPQ----YAQPPP 300 G YPPPG P G P P Q Q APQ +A PPP Sbjct: 114 GYGAAYGAYPPPGAPGATPAVGEQGKDGSAPTPAGGQ-QQQQQAPQPQTPFAPPPP 168 [212][TOP] >UniRef100_A1CP48 Putative uncharacterized protein n=1 Tax=Aspergillus clavatus RepID=A1CP48_ASPCL Length = 122 Score = 79.3 bits (194), Expect = 1e-13 Identities = 52/127 (40%), Positives = 56/127 (44%), Gaps = 7/127 (5%) Frame = +1 Query: 40 PTTPPMSYYN--QQQPPVGTPPPQGYPPEGYGKEG--YPPPGYPPPGYPPQGY---PPQG 198 P PP SY P TPPP G + Y ++G YPPP P P GY PPQG Sbjct: 6 PDGPPPSYPAPVHDAGPYNTPPPGGANHDMYNQQGGYYPPPQNYGPPQPDYGYGTPPPQG 65 Query: 199 YPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCC 378 P PPQGYP Q YPPQ P Y + SS G G AAL CC Sbjct: 66 QPMYYPPPQGYP----QQQPYPPQQQPGY------YADERGGGSSGGGICAGIMAALACC 115 Query: 379 CLLDACF 399 C LD F Sbjct: 116 CCLDILF 122 [213][TOP] >UniRef100_UPI00015B4AC1 PREDICTED: similar to conserved hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B4AC1 Length = 1110 Score = 79.0 bits (193), Expect = 2e-13 Identities = 46/100 (46%), Positives = 47/100 (47%), Gaps = 7/100 (7%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTP----PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 HRG PP S PP G P PP G PP G G PP G PP G PP G PP Sbjct: 575 HRG----PPHSGSPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPH 630 Query: 196 GYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP---PPH 306 G PP G PP G PP G PP P + PP PPH Sbjct: 631 GGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPH 670 Score = 74.3 bits (181), Expect = 4e-12 Identities = 43/96 (44%), Positives = 43/96 (44%), Gaps = 5/96 (5%) Frame = +1 Query: 28 HRGHPTT-PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP 192 H G P PP PP G PP P G PP G G PP G PP G PP G PP Sbjct: 585 HGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPP 644 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 G PP G PP G PP G PP Y PPP Sbjct: 645 HGGPPHGGPPHGGPPHGGPPHGGPPHGGSPYGGPPP 680 Score = 73.6 bits (179), Expect = 7e-12 Identities = 41/97 (42%), Positives = 44/97 (45%), Gaps = 7/97 (7%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 H + P + PP PP P G PP G G PP G PP G PP G PP G P Sbjct: 559 HGSPPHGGMSHGDYPPHRGPPHSGSPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGP 618 Query: 205 PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP---PPH 306 P G PP G PP G PP P + PP PPH Sbjct: 619 PHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPH 655 Score = 72.0 bits (175), Expect = 2e-11 Identities = 46/108 (42%), Positives = 48/108 (44%), Gaps = 15/108 (13%) Frame = +1 Query: 28 HRGHPTT-PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPP 192 H G P PP PP G PP P G PP G G PP G PP G PP G PP Sbjct: 595 HGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPP 654 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPPQY-APQYAQPP---------PPH 306 G PP G PP G PP S G PP + P + PP PPH Sbjct: 655 HGGPPHGGPPHGGPPHGGSPYGGPPPHGGPPHGGPPLGGPMQHGGPPH 702 Score = 69.7 bits (169), Expect = 1e-10 Identities = 39/90 (43%), Positives = 40/90 (44%), Gaps = 9/90 (10%) Frame = +1 Query: 64 YNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP------GYPPQGYPPQGYPPPGYPPQ 225 Y P G PPP G PP G G PP PP G PP G PP G PP G PP Sbjct: 546 YGGPPPHHGGPPPHGSPPHGGMSHGDYPPHRGPPHSGSPHGGPPHGGPPHGGPPHGGPPH 605 Query: 226 GYPPPPYSAQGYPPQYAPQYAQPP---PPH 306 G PP G PP P + PP PPH Sbjct: 606 GGPPHGGPPHGGPPHGGPPHGGPPHGGPPH 635 Score = 60.5 bits (145), Expect = 6e-08 Identities = 43/105 (40%), Positives = 47/105 (44%), Gaps = 15/105 (14%) Frame = +1 Query: 37 HPTTPPM--SYYNQQQPPVGTPP------PQGYPPEGYGKEGYPPPGYPPP---GYPPQG 183 H PP S+++ PP G PP P G PP G PP G PPP G PP G Sbjct: 505 HDGGPPYRGSHHDGGGPPYGGPPHEGGGQPYGGPPPHDG----PPYGGPPPHHGGPPPHG 560 Query: 184 YPPQGYPPPG-YPPQGYPPPPYSAQGYPPQYAPQYAQPP---PPH 306 PP G G YPP PP S G PP P + PP PPH Sbjct: 561 SPPHGGMSHGDYPPHRGPPHSGSPHGGPPHGGPPHGGPPHGGPPH 605 Score = 59.7 bits (143), Expect = 1e-07 Identities = 49/139 (35%), Positives = 51/139 (36%), Gaps = 42/139 (30%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQ-GYPPEG--YGKEGYPPPGYP-------------PP----- 165 PP S Q PP G PPPQ G PP G + G PPP + PP Sbjct: 426 PPASMNQQNVPPHGGPPPQHGGPPHGGPPPQHGGPPPPHSGIGQQHGGHSLDGPPHDRGG 485 Query: 166 ----GYPPQGYPPQGYPPP--------------GYPPQGYPPPPYSAQGY---PPQYAPQ 282 G P G PP G PPP G PP G PP Q Y PP P Sbjct: 486 PLYGGSPHDGVPPFGGPPPHDGGPPYRGSHHDGGGPPYGGPPHEGGGQPYGGPPPHDGPP 545 Query: 283 YAQPPPPHHHNNSNNSSSP 339 Y PPP HH SP Sbjct: 546 YGGPPP--HHGGPPPHGSP 562 Score = 56.2 bits (134), Expect = 1e-06 Identities = 48/129 (37%), Positives = 50/129 (38%), Gaps = 31/129 (24%) Frame = +1 Query: 28 HRGHPTT-PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGY------P 174 H G P PP PP G PP P G PP G G PP G PP G P Sbjct: 620 HGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGSPYGGPP 679 Query: 175 PQGYPPQGYPPPGYPPQ-GYPP------------PPYSAQGYPPQYAPQ-------YAQP 294 P G PP G PP G P Q G PP PP+ G PP P + Sbjct: 680 PHGGPPHGGPPLGGPMQHGGPPHGPPRELAAGMGPPHG--GMPPHAGPMGHGALPPHGGG 737 Query: 295 PPPHHHNNS 321 PPPH N S Sbjct: 738 PPPHDVNFS 746 Score = 53.9 bits (128), Expect = 5e-06 Identities = 36/73 (49%), Positives = 37/73 (50%) Frame = -1 Query: 296 GG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYPS 117 GG + G GG P GG P GG P GG P GG P GG P GG P GG P P Sbjct: 606 GGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPHGGPPH 665 Query: 116 GG*PCGGGVPTGG 78 GG P GG P GG Sbjct: 666 GG-PPHGGSPYGG 677 [214][TOP] >UniRef100_B1HT22 Putative uncharacterized protein n=1 Tax=Lysinibacillus sphaericus C3-41 RepID=B1HT22_LYSSC Length = 153 Score = 79.0 bits (193), Expect = 2e-13 Identities = 40/72 (55%), Positives = 42/72 (58%) Frame = +1 Query: 88 GTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPP 267 G PP YPP YPPP YP P YPPQ YPP+ YPP YPP+ YPP PY Q YPP Sbjct: 63 GAPPGNSYPPP------YPPP-YPTP-YPPQPYPPRPYPPQPYPPRPYPPRPYPPQPYPP 114 Query: 268 QYAPQYAQPPPP 303 Q P PP P Sbjct: 115 Q--PPRPYPPFP 124 Score = 73.6 bits (179), Expect = 7e-12 Identities = 35/72 (48%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +1 Query: 67 NQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP-PP 243 N PP P P YPP+ Y YPP YPP YPP+ YPPQ YPP PP+ YPP P Sbjct: 68 NSYPPPYPPPYPTPYPPQPYPPRPYPPQPYPPRPYPPRPYPPQPYPP--QPPRPYPPFPG 125 Query: 244 YSAQGYPPQYAP 279 G+PP P Sbjct: 126 GQFPGFPPPLLP 137 Score = 67.4 bits (163), Expect = 5e-10 Identities = 38/80 (47%), Positives = 40/80 (50%), Gaps = 10/80 (12%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG---Y 201 G P SY PP TP PPQ YPP Y + YPP YPP YPPQ YPPQ Y Sbjct: 61 GTGAPPGNSYPPPYPPPYPTPYPPQPYPPRPYPPQPYPPRPYPPRPYPPQPYPPQPPRPY 120 Query: 202 PP------PGYPPQGYPPPP 243 PP PG+PP P P Sbjct: 121 PPFPGGQFPGFPPPLLPGLP 140 [215][TOP] >UniRef100_Q7XN09 Os04g0615200 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XN09_ORYSJ Length = 75 Score = 79.0 bits (193), Expect = 2e-13 Identities = 43/81 (53%), Positives = 45/81 (55%), Gaps = 7/81 (8%) Frame = +1 Query: 178 QGYPP--QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYA-----QPPPPHHHNNSNNSSS 336 QG PP YPPPG GYPPP Y A PP A Y QPPPP + S Sbjct: 4 QGPPPGTAAYPPPG---TGYPPPAYGA---PPPVAADYGGYQQQQPPPPPQDSQSRGD-- 55 Query: 337 PGCLEGCCAALCCCCLLDACF 399 G L+GCCAALCCCCLLD CF Sbjct: 56 -GFLKGCCAALCCCCLLDMCF 75 [216][TOP] >UniRef100_UPI00015BB2CD proline rich protein HaeIII subfamily 1 precursor n=1 Tax=Mus musculus RepID=UPI00015BB2CD Length = 261 Score = 78.6 bits (192), Expect = 2e-13 Identities = 49/97 (50%), Positives = 52/97 (53%), Gaps = 7/97 (7%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 G PP++ Q PP G P PPQG PP G G + PP G PPPG P Q PPQG P Sbjct: 38 GFQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPGVP-QPRPPQGPP 95 Query: 205 PPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PPG PPQG PPPP Q PPQ PPPP Sbjct: 96 PPGGPQQRPPQG-PPPPGGPQHRPPQ------GPPPP 125 Score = 78.6 bits (192), Expect = 2e-13 Identities = 49/99 (49%), Positives = 51/99 (51%), Gaps = 12/99 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG P Q PPQ Sbjct: 77 PQGPPPPGVPQPRPPQGPPPPGGPQQRPPQGPPPPG-GPQHRPPQGPPPPGGPQQR-PPQ 134 Query: 196 GYPPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 G PPPG PPQG PPPP Q PPQ P A P P Sbjct: 135 GPPPPGGPQLRPPQG-PPPPAGPQPRPPQGPPPPAGPQP 172 Score = 75.5 bits (184), Expect = 2e-12 Identities = 48/100 (48%), Positives = 50/100 (50%), Gaps = 12/100 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP QQ+PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 91 PQGPPPPGGPQQRPPQGPPPPGGPQHRPPQGPPPPG-GPQQRPPQGPPPPG-GPQLRPPQ 148 Query: 196 GYPPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 G PPP PPQG PPPP Q PPQ P P P Sbjct: 149 GPPPPAGPQPRPPQG-PPPPAGPQPRPPQGPPTTGPQPRP 187 Score = 69.3 bits (168), Expect = 1e-10 Identities = 52/122 (42%), Positives = 56/122 (45%), Gaps = 29/122 (23%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQG---YPPEG----YGKEGYPPPGYPPPGYP--- 174 QHR P PP QQ+PP G PPP G PP+G G + PP G PPP P Sbjct: 115 QHRP-PQGPPPPGGPQQRPPQGPPPPGGPQLRPPQGPPPPAGPQPRPPQGPPPPAGPQPR 173 Query: 175 ---------PQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYA--QPP 297 PQ P QG PP G PPQG PPP P QG PP PQ + Q P Sbjct: 174 PPQGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPGGPQPSPTQGP 233 Query: 298 PP 303 PP Sbjct: 234 PP 235 Score = 66.2 bits (160), Expect = 1e-09 Identities = 42/103 (40%), Positives = 45/103 (43%), Gaps = 11/103 (10%) Frame = +1 Query: 67 NQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYP--------PQGYPPQGYPPPG 213 NQ Q P PPP G+ PP ++G PPPG P P P PQ PPQG PPPG Sbjct: 25 NQIQIPNQRPPPSGFQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPGGPQPRPPQGPPPPG 84 Query: 214 YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPG 342 PQ PP G P Q PQ PP H PG Sbjct: 85 V-PQPRPPQGPPPPGGPQQRPPQGPPPPGGPQHRPPQGPPPPG 126 Score = 66.2 bits (160), Expect = 1e-09 Identities = 46/112 (41%), Positives = 49/112 (43%), Gaps = 27/112 (24%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEG----YGKEGYPPPG------------YPP 162 P PP Q +PP G PPP G PP+G G + PP G PP Sbjct: 133 PQGPPPPGGPQLRPPQGPPPPAGPQPRPPQGPPPPAGPQPRPPQGPPTTGPQPRPTQGPP 192 Query: 163 PGYPPQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP 294 P PQ PPQG PPPG PPQG PPP P QG PP PQ P Sbjct: 193 PTGGPQQRPPQGPPPPGGPQPRPPQGPPPPGGPQPSPTQGPPPTGGPQQTPP 244 Score = 61.6 bits (148), Expect = 3e-08 Identities = 42/91 (46%), Positives = 45/91 (49%), Gaps = 7/91 (7%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPG----YPPQGYP 189 +G PTT P Q PP G P PPQG PP G G + PP G PPPG P QG P Sbjct: 176 QGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPPPG-GPQPRPPQGPPPPGGPQPSPTQGPP 234 Query: 190 PQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQ 282 P G PQ PP + QG PPQ PQ Sbjct: 235 PTG------GPQQTPPLAGNTQG-PPQGRPQ 258 [217][TOP] >UniRef100_UPI0001552FA1 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001552FA1 Length = 261 Score = 78.6 bits (192), Expect = 2e-13 Identities = 52/116 (44%), Positives = 55/116 (47%), Gaps = 26/116 (22%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPGYP---------- 174 G PP++ Q PP G P PPQG PP G G + PP G PPPG P Sbjct: 38 GFQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPGGPQPRPPQGPPP 96 Query: 175 ---PQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 PQ PPQG PPPG PPQG PPP P QG PP PQ P PPP Sbjct: 97 PGGPQQRPPQGPPPPGGPQLRPPQGPPPPGGPQPRPPQGPPPPGGPQLRPPQGPPP 152 Score = 77.0 bits (188), Expect = 6e-13 Identities = 49/99 (49%), Positives = 51/99 (51%), Gaps = 12/99 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 77 PQGPPPPGGPQPRPPQGPPPPGGPQQRPPQGPPPPG-GPQLRPPQGPPPPG-GPQPRPPQ 134 Query: 196 GYPPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 G PPPG PPQG PPPP Q PPQ P A P P Sbjct: 135 GPPPPGGPQLRPPQG-PPPPAGPQPRPPQGPPPPAGPQP 172 Score = 73.6 bits (179), Expect = 7e-12 Identities = 51/118 (43%), Positives = 53/118 (44%), Gaps = 30/118 (25%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYP------- 174 P PP QQ+PP G PPP QG PP G G + PP G PPPG P Sbjct: 91 PQGPPPPGGPQQRPPQGPPPPGGPQLRPPQGPPPPG-GPQPRPPQGPPPPGGPQLRPPQG 149 Query: 175 ------PQGYPPQGYPPPG----YPPQGYP---PPPYSAQGYPPQYAPQYAQP--PPP 303 PQ PPQG PPP PPQG P P P QG PP PQ P PPP Sbjct: 150 PPPPAGPQPRPPQGPPPPAGPQPRPPQGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPP 207 Score = 66.2 bits (160), Expect = 1e-09 Identities = 41/82 (50%), Positives = 44/82 (53%), Gaps = 3/82 (3%) Frame = +1 Query: 67 NQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP 237 NQ Q P PPP G+ PP ++G PPPG P P PPQG PP G P P PPQG PP Sbjct: 25 NQIQIPNQRPPPSGFQPRPPVNGSQQGPPPPGGPQPR-PPQGPPPPGGPQPR-PPQG-PP 81 Query: 238 PPYSAQGYPPQYAPQYAQPPPP 303 PP Q PP Q PPP Sbjct: 82 PPGGPQPRPP-------QGPPP 96 Score = 65.9 bits (159), Expect = 1e-09 Identities = 44/100 (44%), Positives = 46/100 (46%), Gaps = 15/100 (15%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPGYPPPGYPPQG----YPPQG 198 P PP Q +PP G PPP G PP+G G P P G PP G PPQG Sbjct: 147 PQGPPPPAGPQPRPPQGPPPPAGPQPRPPQGPPTTG--PQPRPTQGPPPTGGPQQRPPQG 204 Query: 199 YPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP 294 PPPG PPQG PPP P QG PP PQ P Sbjct: 205 PPPPGGPQPRPPQGPPPPGGPQPRPTQGPPPTGGPQQTPP 244 Score = 64.3 bits (155), Expect = 4e-09 Identities = 45/110 (40%), Positives = 48/110 (43%), Gaps = 23/110 (20%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEG----YGKEGYPPPGYPPPGYP-------- 174 P PP Q +PP G PPP G PP+G G + PP G PPP P Sbjct: 119 PQGPPPPGGPQPRPPQGPPPPGGPQLRPPQGPPPPAGPQPRPPQGPPPPAGPQPRPPQGP 178 Query: 175 ----PQGYPPQGYPPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 PQ P QG PP G PPQG PPPP Q PPQ P P P Sbjct: 179 PTTGPQPRPTQGPPPTGGPQQRPPQG-PPPPGGPQPRPPQGPPPPGGPQP 227 Score = 61.6 bits (148), Expect = 3e-08 Identities = 42/91 (46%), Positives = 45/91 (49%), Gaps = 7/91 (7%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPG----YPPQGYP 189 +G PTT P Q PP G P PPQG PP G G + PP G PPPG P QG P Sbjct: 176 QGPPTTGPQPRPTQGPPPTGGPQQRPPQGPPPPG-GPQPRPPQGPPPPGGPQPRPTQGPP 234 Query: 190 PQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQ 282 P G PQ PP + QG PPQ PQ Sbjct: 235 PTG------GPQQTPPLAGNTQG-PPQGRPQ 258 [218][TOP] >UniRef100_UPI0000250733 proline-rich proteoglycan 2 n=1 Tax=Rattus norvegicus RepID=UPI0000250733 Length = 295 Score = 78.6 bits (192), Expect = 2e-13 Identities = 55/134 (41%), Positives = 59/134 (44%), Gaps = 27/134 (20%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPG----YPPPGYPPQGYP- 189 G P PP QQ+PP G PPPQG PP+ +G PPPG PP G PPQG P Sbjct: 113 GSPQGPPPPGGPQQRPPQG-PPPQGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQ 171 Query: 190 -------PQGYPPPGYP----PQG--------YPPPPYSAQGYPPQYAPQYAQPPPPHHH 312 PQG PPPG P PQG PP P S QG PP PQ P P Sbjct: 172 RPPQPGSPQGPPPPGGPQQRAPQGPPPQGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQ 231 Query: 313 NNSNNSSSPGCLEG 354 PG +G Sbjct: 232 GGPQRPPQPGSPQG 245 Score = 77.8 bits (190), Expect = 4e-13 Identities = 55/134 (41%), Positives = 59/134 (44%), Gaps = 27/134 (20%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPGYP----PPGYPPQGYP- 189 G P PP QQ+PP G PPPQG PP+ +G PPPG P P G PPQG P Sbjct: 145 GSPQGPPPPGGPQQRPPQG-PPPQGGPQRPPQPGSPQGPPPPGGPQQRAPQGPPPQGGPQ 203 Query: 190 -------PQGYPPPG----YPPQG--------YPPPPYSAQGYPPQYAPQYAQPPPPHHH 312 PQG PPPG PPQG PP P S QG PP PQ P P Sbjct: 204 RPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQ 263 Query: 313 NNSNNSSSPGCLEG 354 PG +G Sbjct: 264 GGPQRPPQPGNPQG 277 Score = 72.8 bits (177), Expect = 1e-11 Identities = 52/128 (40%), Positives = 57/128 (44%), Gaps = 18/128 (14%) Frame = +1 Query: 25 QHRG---HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG---YPPQGY 186 QH G HP PP + Q+ P G+P QG PP G G + PP G PP G PPQ Sbjct: 89 QHGGNHHHPHHPPPAAGPQRPPQPGSP--QGPPPPG-GPQQRPPQGPPPQGGPQRPPQPG 145 Query: 187 PPQGYPPPG----YPPQG--------YPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNS 330 PQG PPPG PPQG PP P S QG PP PQ P P Sbjct: 146 SPQGPPPPGGPQQRPPQGPPPQGGPQRPPQPGSPQGPPPPGGPQQRAPQGPPPQGGPQRP 205 Query: 331 SSPGCLEG 354 PG +G Sbjct: 206 PQPGSPQG 213 Score = 68.9 bits (167), Expect = 2e-10 Identities = 48/106 (45%), Positives = 51/106 (48%), Gaps = 17/106 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPG----YPPPGYPPQGYP- 189 G P PP QQ+ P G PPPQG PP+ +G PPPG PP G PPQG P Sbjct: 177 GSPQGPPPPGGPQQRAPQG-PPPQGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQ 235 Query: 190 -------PQGYPPPGYPPQGYP--PPPYSAQGYPPQYAPQYAQPPP 300 PQG PPPG P Q P PPP PPQ P Q PP Sbjct: 236 RPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQRPPQ--PGNPQGPP 279 Score = 64.3 bits (155), Expect = 4e-09 Identities = 42/90 (46%), Positives = 47/90 (52%), Gaps = 6/90 (6%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGY---PPPGYPPQGYPP 192 +G P PP Q PP G P PPQG PP+G G + P PG PPP PQ PP Sbjct: 199 QGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQG-GPQRPPQPGSPQGPPPPGGPQQRPP 257 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQ 282 QG PP G P + PP P + QG PPQ Q Sbjct: 258 QGPPPQGGPQR--PPQPGNPQG-PPQQGGQ 284 Score = 55.1 bits (131), Expect = 2e-06 Identities = 36/95 (37%), Positives = 39/95 (41%), Gaps = 14/95 (14%) Frame = +1 Query: 112 PPEGYGKEGYP--PPGYPPPGYPPQGYPPQGYPPPG----YPPQG--------YPPPPYS 249 PP+ G +P PP P PPQ PQG PPPG PPQG PP P S Sbjct: 87 PPQHGGNHHHPHHPPPAAGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQRPPQPGS 146 Query: 250 AQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEG 354 QG PP PQ P P PG +G Sbjct: 147 PQGPPPPGGPQQRPPQGPPPQGGPQRPPQPGSPQG 181 [219][TOP] >UniRef100_UPI0000EE5993 proline-rich protein BstNI subfamily 2 n=1 Tax=Homo sapiens RepID=UPI0000EE5993 Length = 416 Score = 78.6 bits (192), Expect = 2e-13 Identities = 53/122 (43%), Positives = 55/122 (45%), Gaps = 20/122 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGKEGYPPPGYPPPGYPPQG--------- 183 G P PP NQ Q P P PQG PP+G K PPP P G PPQG Sbjct: 55 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSP 114 Query: 184 -YPPQGYPPP-GYPPQGYPPPPYSAQGYPPQYA--------PQYAQPPPPHHHNNSNNSS 333 PQG PP G PQG PPPP QG PPQ P Q PPP N S +S Sbjct: 115 PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSRSSR 174 Query: 334 SP 339 SP Sbjct: 175 SP 176 Score = 72.4 bits (176), Expect = 1e-11 Identities = 47/103 (45%), Positives = 51/103 (49%), Gaps = 13/103 (12%) Frame = +1 Query: 34 GHPT-TPPMSYYNQQQPPVGTPPPQGYPPEGYGK-EGYPPPGYPPPGYPPQG-YPPQGYP 204 G+P PP Q PP PQG PP+G + +G PPP P G PPQG PQG P Sbjct: 34 GNPQGAPPQGGNKPQGPPSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 93 Query: 205 PPGYPPQGYPP----------PPYSAQGYPPQYAPQYAQPPPP 303 PPG PQG PP PP QG PPQ Q PPPP Sbjct: 94 PPG-KPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPP 135 Score = 70.9 bits (172), Expect = 4e-11 Identities = 47/104 (45%), Positives = 51/104 (49%), Gaps = 14/104 (13%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGK-EGYPPPGYPPPGYPPQG-YPPQGYP 204 G P PP N+ Q P PQG PP+G + +G PPP P G PPQG PQG P Sbjct: 219 GKPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 278 Query: 205 PPGYPPQGYPP-----------PPYSAQGYPPQYAPQYAQPPPP 303 PPG PQG PP PP QG PPQ Q PPPP Sbjct: 279 PPG-KPQGPPPQGGSKSRSSRSPPGKPQGPPPQGGNQPQGPPPP 321 Score = 70.1 bits (170), Expect = 7e-11 Identities = 45/103 (43%), Positives = 49/103 (47%), Gaps = 13/103 (12%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGK-EGYPPPGYPPPGYPPQ-GYPPQGYPP 207 G P PP + P PQG PP+G + +G PPP P G PPQ G PQG PP Sbjct: 96 GKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPP 155 Query: 208 PGYPPQGYPP-----------PPYSAQGYPPQYAPQYAQPPPP 303 PG PQG PP PP QG PPQ Q PPPP Sbjct: 156 PG-KPQGPPPQGDNKSRSSRSPPGKPQGPPPQGGNQPQGPPPP 197 Score = 70.1 bits (170), Expect = 7e-11 Identities = 52/126 (41%), Positives = 56/126 (44%), Gaps = 24/126 (19%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGK-EGYPPPGYP---------------- 159 G P PP NQ Q P P PQG PP+G K +G PPPG P Sbjct: 116 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSRSSRS 175 Query: 160 ----PPGYPPQG-YPPQGYPPPGYPPQGYPPP-PYSAQGYPPQYAPQYAQPPPPHHHNNS 321 P G PPQG PQG PPP PQG PP QG PP P Q PPP N S Sbjct: 176 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPP---PGKPQGPPPQGDNKS 232 Query: 322 NNSSSP 339 ++ SP Sbjct: 233 QSARSP 238 Score = 69.3 bits (168), Expect = 1e-10 Identities = 49/111 (44%), Positives = 53/111 (47%), Gaps = 23/111 (20%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVG--------TPP--PQGYPPEGYGK-EGYPPPGYPPPGYPPQG- 183 P PP Q PP G +PP PQG PP+G + +G PPP P G PPQG Sbjct: 150 PQGPPPPGKPQGPPPQGDNKSRSSRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGG 209 Query: 184 YPPQGYPPPGYPPQGYPP-----------PPYSAQGYPPQYAPQYAQPPPP 303 PQG PPPG PQG PP PP QG PPQ Q PPPP Sbjct: 210 NKPQGPPPPG-KPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQPQGPPPP 259 Score = 68.9 bits (167), Expect = 2e-10 Identities = 52/126 (41%), Positives = 56/126 (44%), Gaps = 24/126 (19%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGK-EGYPPPGYP---------------- 159 G P PP NQ Q P P PQG PP+G K +G PPPG P Sbjct: 178 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSQSARS 237 Query: 160 ----PPGYPPQG-YPPQGYPPPGYPPQGYPPP-PYSAQGYPPQYAPQYAQPPPPHHHNNS 321 P G PPQG PQG PPP PQG PP QG PP P Q PPP + S Sbjct: 238 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPP---PGKPQGPPPQGGSKS 294 Query: 322 NNSSSP 339 +S SP Sbjct: 295 RSSRSP 300 Score = 67.8 bits (164), Expect = 4e-10 Identities = 51/126 (40%), Positives = 56/126 (44%), Gaps = 24/126 (19%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGK-EGYPPPGYP---------------- 159 G P PP NQ Q P P PQG PP+G K +G PPPG P Sbjct: 240 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGGSKSRSSRS 299 Query: 160 ----PPGYPPQ-GYPPQGYPPPGYPPQGYPPP-PYSAQGYPPQYAPQYAQPPPPHHHNNS 321 P G PPQ G PQG PPP PQG PP QG PP P Q PPP + S Sbjct: 300 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPP---PGKPQGPPPQGGSKS 356 Query: 322 NNSSSP 339 ++ SP Sbjct: 357 RSARSP 362 Score = 65.1 bits (157), Expect = 2e-09 Identities = 36/78 (46%), Positives = 41/78 (52%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 ++ P + PQG PP+G G P G P P PQG PPQG G PQG PPPP Sbjct: 26 EESPSLIAGNPQGAPPQG----GNKPQGPPSPPGKPQGPPPQG----GNQPQGPPPPPGK 77 Query: 250 AQGYPPQYAPQYAQPPPP 303 QG PPQ + PPPP Sbjct: 78 PQGPPPQGGNKPQGPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 49/120 (40%), Positives = 50/120 (41%), Gaps = 18/120 (15%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG---- 198 G P PP NQ Q P P PQG PP+G G P G PPPG PQG PPQG Sbjct: 302 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQG----GNKPQGPPPPG-KPQGPPPQGGSKS 356 Query: 199 ---YPPPGYP----------PQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSP 339 PPG P PQG PPPP PQ AP QP P S P Sbjct: 357 RSARSPPGKPQGPPQQEGNNPQG-PPPPAGGNPQQPQ-APPAGQPQGPPRPPQGGRPSRP 414 [220][TOP] >UniRef100_Q9LF59 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9LF59_ARATH Length = 173 Score = 78.6 bits (192), Expect = 2e-13 Identities = 37/74 (50%), Positives = 38/74 (51%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 H GH Y P PPP GYPP Y G GYPP GYPP GYPP GYP Sbjct: 34 HHGHG-------YGSSYPYPPPPPPHGYPPVAYPPHG----GYPPAGYPPAGYPPAGYPA 82 Query: 208 PGYPPQGYPPPPYS 249 GYP GYP P +S Sbjct: 83 HGYPSHGYPRPSHS 96 Score = 77.4 bits (189), Expect = 5e-13 Identities = 42/84 (50%), Positives = 45/84 (53%), Gaps = 9/84 (10%) Frame = +1 Query: 88 GTPPPQGYPPEGYGKEG--------YPPPGYPPPGYPPQGYPPQG-YPPPGYPPQGYPPP 240 G PP G+ GYG G YPPP PP GYPP YPP G YPP GYPP GYPP Sbjct: 23 GQYPPHGH---GYGHHGHGYGSSYPYPPPP-PPHGYPPVAYPPHGGYPPAGYPPAGYPPA 78 Query: 241 PYSAQGYPPQYAPQYAQPPPPHHH 312 Y A GYP P+ + HHH Sbjct: 79 GYPAHGYPSHGYPRPSH--SGHHH 100 [221][TOP] >UniRef100_Q0WWS8 Glycine/proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q0WWS8_ARATH Length = 173 Score = 78.6 bits (192), Expect = 2e-13 Identities = 37/74 (50%), Positives = 38/74 (51%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 H GH Y P PPP GYPP Y G GYPP GYPP GYPP GYP Sbjct: 34 HHGHG-------YGSSYPYPPPPPPHGYPPVAYPPHG----GYPPAGYPPAGYPPAGYPA 82 Query: 208 PGYPPQGYPPPPYS 249 GYP GYP P +S Sbjct: 83 HGYPSHGYPRPSHS 96 Score = 77.4 bits (189), Expect = 5e-13 Identities = 42/84 (50%), Positives = 45/84 (53%), Gaps = 9/84 (10%) Frame = +1 Query: 88 GTPPPQGYPPEGYGKEG--------YPPPGYPPPGYPPQGYPPQG-YPPPGYPPQGYPPP 240 G PP G+ GYG G YPPP PP GYPP YPP G YPP GYPP GYPP Sbjct: 23 GQYPPHGH---GYGHHGHGYGSSYPYPPPP-PPHGYPPVAYPPHGGYPPAGYPPAGYPPA 78 Query: 241 PYSAQGYPPQYAPQYAQPPPPHHH 312 Y A GYP P+ + HHH Sbjct: 79 GYPAHGYPSHGYPRPSH--SGHHH 100 [222][TOP] >UniRef100_A9NWS9 Putative uncharacterized protein n=1 Tax=Picea sitchensis RepID=A9NWS9_PICSI Length = 88 Score = 78.6 bits (192), Expect = 2e-13 Identities = 48/92 (52%), Positives = 48/92 (52%), Gaps = 3/92 (3%) Frame = +1 Query: 130 KEGYPPPGYPPPGYPPQGYPPQGYP---PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 K YP YP PGYP QGYP QGYP P GYP QG Y Q P Q P Y Q PP Sbjct: 5 KYAYP---YPAPGYP-QGYP-QGYPQGYPQGYPQQGQG---YPQQAPPVQAPPAYGQGPP 56 Query: 301 PHHHNNSNNSSSPGCLEGCCAALCCCCLLDAC 396 G LEGC AALCCCCLLD C Sbjct: 57 RQQ----------GFLEGCLAALCCCCLLDEC 78 [223][TOP] >UniRef100_Q22CA6 Putative uncharacterized protein n=1 Tax=Tetrahymena thermophila SB210 RepID=Q22CA6_TETTH Length = 203 Score = 78.6 bits (192), Expect = 2e-13 Identities = 47/95 (49%), Positives = 50/95 (52%), Gaps = 17/95 (17%) Frame = +1 Query: 64 YNQQQPPVGTPP-------PQGYPPEGYGK------EGYPPP-GYPPPGYPPQGYPP--- 192 Y Q P VG PP PQ YPP + + YPPP YPPP PPQ YPP Sbjct: 7 YQQLPPDVGQPPLMYPPQPPQMYPPPPAEQNNPPNFQNYPPPQSYPPP--PPQNYPPPPQ 64 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 Q YPPP PPQ YPPPP Q YPP Y+QPP Sbjct: 65 QNYPPP--PPQNYPPPP---QDYPPPPPQNYSQPP 94 Score = 76.3 bits (186), Expect = 1e-12 Identities = 57/159 (35%), Positives = 62/159 (38%), Gaps = 38/159 (23%) Frame = +1 Query: 37 HPTTPPMSY----YNQQQPP--VGTPPPQGYPPEGYGKEGYPPP---GYPPPGYPPQGY- 186 +P PP Y Q PP PPPQ YPP + YPPP YPPP PPQ Y Sbjct: 21 YPPQPPQMYPPPPAEQNNPPNFQNYPPPQSYPPPP--PQNYPPPPQQNYPPP--PPQNYP 76 Query: 187 -PPQGYPPPGYPPQGYPPPPY----SAQGYPP-----------------------QYAPQ 282 PPQ YPPP PPQ Y PP QGY P Q P Sbjct: 77 PPPQDYPPP--PPQNYSQPPQMIQPQQQGYIPPSTTAFNQQQQQMQGIYPRSANNQIGPS 134 Query: 283 YAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDACF 399 Q P + + +S PG CCA L C CF Sbjct: 135 IIQCPQCNQVTTTVVNSQPGSGTYCCACLLFCTFTICCF 173 [224][TOP] >UniRef100_B2VUR2 Annexin A7 n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2VUR2_PYRTR Length = 467 Score = 78.6 bits (192), Expect = 2e-13 Identities = 55/112 (49%), Positives = 57/112 (50%), Gaps = 29/112 (25%) Frame = +1 Query: 55 MSYYNQ----QQP-PVGTPPPQGY--------PPEGYGKEGYPPPGYPPPGY---PPQGY 186 MSYYNQ QQP P PPPQGY P Y ++ P GYPP GY PP Y Sbjct: 1 MSYYNQPGGYQQPYPGQAPPPQGYGQQPQYQQQPPMYNQQYPPQGGYPPQGYGAPPPNQY 60 Query: 187 PPQGY----PPPGY-----PPQGYPPPPYSAQGYPP-QY-AP--QYAQPPPP 303 PPQG PP G PPQGY PP G PP QY AP QY PPPP Sbjct: 61 PPQGQYGAPPPQGQYGAPPPPQGYGAPPPQGHGPPPGQYGAPPGQYGGPPPP 112 Score = 67.4 bits (163), Expect = 5e-10 Identities = 47/103 (45%), Positives = 51/103 (49%), Gaps = 20/103 (19%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGY--------PPEGY-------GKEGYPPP--GYPPPGYPP 177 PPM YNQQ PP G PPQGY PP+G G+ G PPP GY P PP Sbjct: 34 PPM--YNQQYPPQGGYPPQGYGAPPPNQYPPQGQYGAPPPQGQYGAPPPPQGYGAP--PP 89 Query: 178 QGY-PPQGY--PPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 QG+ PP G PPG G PPPP G PP Q+ PP Sbjct: 90 QGHGPPPGQYGAPPG--QYGGPPPPQGQWGAPPPQQGQFGAPP 130 Score = 59.3 bits (142), Expect = 1e-07 Identities = 42/98 (42%), Positives = 47/98 (47%), Gaps = 8/98 (8%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPPPQGY-----PPEGYGKEGYPPPGY-PPPGYPPQGYPP 192 +G+ PP Y Q Q G PPPQG PP+GYG PP G+ PPPG G PP Sbjct: 50 QGYGAPPPNQYPPQGQ--YGAPPPQGQYGAPPPPQGYGAP--PPQGHGPPPG--QYGAPP 103 Query: 193 QGY--PPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 Y PPP G PPP G PP QY+ PP Sbjct: 104 GQYGGPPPPQGQWGAPPPQQGQFGAPP---GQYSVQPP 138 [225][TOP] >UniRef100_P10165 Proline-rich proteoglycan 2 n=1 Tax=Rattus norvegicus RepID=PRPG2_RAT Length = 295 Score = 78.6 bits (192), Expect = 2e-13 Identities = 55/134 (41%), Positives = 59/134 (44%), Gaps = 27/134 (20%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPG----YPPPGYPPQGYP- 189 G P PP QQ+PP G PPPQG PP+ +G PPPG PP G PPQG P Sbjct: 113 GSPQGPPPPGGPQQRPPQG-PPPQGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQ 171 Query: 190 -------PQGYPPPGYP----PQG--------YPPPPYSAQGYPPQYAPQYAQPPPPHHH 312 PQG PPPG P PQG PP P S QG PP PQ P P Sbjct: 172 RPPQPGSPQGPPPPGGPQQRAPQGPPPQGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQ 231 Query: 313 NNSNNSSSPGCLEG 354 PG +G Sbjct: 232 GGPQRPPQPGSPQG 245 Score = 77.8 bits (190), Expect = 4e-13 Identities = 55/134 (41%), Positives = 59/134 (44%), Gaps = 27/134 (20%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPGYP----PPGYPPQGYP- 189 G P PP QQ+PP G PPPQG PP+ +G PPPG P P G PPQG P Sbjct: 145 GSPQGPPPPGGPQQRPPQG-PPPQGGPQRPPQPGSPQGPPPPGGPQQRAPQGPPPQGGPQ 203 Query: 190 -------PQGYPPPG----YPPQG--------YPPPPYSAQGYPPQYAPQYAQPPPPHHH 312 PQG PPPG PPQG PP P S QG PP PQ P P Sbjct: 204 RPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQ 263 Query: 313 NNSNNSSSPGCLEG 354 PG +G Sbjct: 264 GGPQRPPQPGNPQG 277 Score = 72.8 bits (177), Expect = 1e-11 Identities = 52/128 (40%), Positives = 57/128 (44%), Gaps = 18/128 (14%) Frame = +1 Query: 25 QHRG---HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG---YPPQGY 186 QH G HP PP + Q+ P G+P QG PP G G + PP G PP G PPQ Sbjct: 89 QHGGNHHHPHHPPPAAGPQRPPQPGSP--QGPPPPG-GPQQRPPQGPPPQGGPQRPPQPG 145 Query: 187 PPQGYPPPG----YPPQG--------YPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNS 330 PQG PPPG PPQG PP P S QG PP PQ P P Sbjct: 146 SPQGPPPPGGPQQRPPQGPPPQGGPQRPPQPGSPQGPPPPGGPQQRAPQGPPPQGGPQRP 205 Query: 331 SSPGCLEG 354 PG +G Sbjct: 206 PQPGSPQG 213 Score = 68.9 bits (167), Expect = 2e-10 Identities = 48/106 (45%), Positives = 51/106 (48%), Gaps = 17/106 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPG----YPPPGYPPQGYP- 189 G P PP QQ+ P G PPPQG PP+ +G PPPG PP G PPQG P Sbjct: 177 GSPQGPPPPGGPQQRAPQG-PPPQGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQ 235 Query: 190 -------PQGYPPPGYPPQGYP--PPPYSAQGYPPQYAPQYAQPPP 300 PQG PPPG P Q P PPP PPQ P Q PP Sbjct: 236 RPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQRPPQ--PGNPQGPP 279 Score = 64.3 bits (155), Expect = 4e-09 Identities = 42/90 (46%), Positives = 47/90 (52%), Gaps = 6/90 (6%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGY---PPPGYPPQGYPP 192 +G P PP Q PP G P PPQG PP+G G + P PG PPP PQ PP Sbjct: 199 QGGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQG-GPQRPPQPGSPQGPPPPGGPQQRPP 257 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPPQYAPQ 282 QG PP G P + PP P + QG PPQ Q Sbjct: 258 QGPPPQGGPQR--PPQPGNPQG-PPQQGGQ 284 Score = 55.1 bits (131), Expect = 2e-06 Identities = 36/95 (37%), Positives = 39/95 (41%), Gaps = 14/95 (14%) Frame = +1 Query: 112 PPEGYGKEGYP--PPGYPPPGYPPQGYPPQGYPPPG----YPPQG--------YPPPPYS 249 PP+ G +P PP P PPQ PQG PPPG PPQG PP P S Sbjct: 87 PPQHGGNHHHPHHPPPAAGPQRPPQPGSPQGPPPPGGPQQRPPQGPPPQGGPQRPPQPGS 146 Query: 250 AQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEG 354 QG PP PQ P P PG +G Sbjct: 147 PQGPPPPGGPQQRPPQGPPPQGGPQRPPQPGSPQG 181 [226][TOP] >UniRef100_P05142 Proline-rich protein HaeIII subfamily 1 n=1 Tax=Mus musculus RepID=PRH1_MOUSE Length = 261 Score = 78.6 bits (192), Expect = 2e-13 Identities = 52/116 (44%), Positives = 55/116 (47%), Gaps = 26/116 (22%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPGYP---------- 174 G PP++ Q PP G P PPQG PP G G + PP G PPPG P Sbjct: 38 GFQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPG-GPQPRPPQGPPPPGGPQPRPPQGPPP 96 Query: 175 ---PQGYPPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP--PPP 303 PQ PPQG PPPG PPQG PPP P QG PP PQ P PPP Sbjct: 97 PGGPQQRPPQGPPPPGGPQQRPPQGPPPPGGPQPRPPQGPPPPGGPQLRPPQGPPP 152 Score = 77.8 bits (190), Expect = 4e-13 Identities = 49/99 (49%), Positives = 51/99 (51%), Gaps = 12/99 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 P PP Q +PP G PPP QG PP G G + PP G PPPG PQ PPQ Sbjct: 77 PQGPPPPGGPQPRPPQGPPPPGGPQQRPPQGPPPPG-GPQQRPPQGPPPPG-GPQPRPPQ 134 Query: 196 GYPPPG----YPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 G PPPG PPQG PPPP Q PPQ P A P P Sbjct: 135 GPPPPGGPQLRPPQG-PPPPAGPQPRPPQGPPPPAGPQP 172 Score = 68.9 bits (167), Expect = 2e-10 Identities = 51/118 (43%), Positives = 53/118 (44%), Gaps = 30/118 (25%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPP--------QGYPPEGYGKEGYPPPGYPPPG----YPPQG 183 P PP QQ+PP G PPP QG PP G G + PP G PPPG PPQG Sbjct: 91 PQGPPPPGGPQQRPPQGPPPPGGPQQRPPQGPPPPG-GPQPRPPQGPPPPGGPQLRPPQG 149 Query: 184 YPP----QGYPPPG---------YPPQGYP---PPPYSAQGYPPQYAPQYAQP--PPP 303 PP Q PP G PPQG P P P QG PP PQ P PPP Sbjct: 150 PPPPAGPQPRPPQGPPPPAGPQPRPPQGPPPTGPQPRPTQGPPPTGGPQQRPPQGPPP 207 Score = 67.4 bits (163), Expect = 5e-10 Identities = 50/117 (42%), Positives = 54/117 (46%), Gaps = 29/117 (24%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEG----YGKEGYPPPGYPPPG----YPPQGY 186 P PP Q +PP G PPP G PP+G G + PP G PPP PPQG Sbjct: 119 PQGPPPPGGPQPRPPQGPPPPGGPQLRPPQGPPPPAGPQPRPPQGPPPPAGPQPRPPQGP 178 Query: 187 PP--------QGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYA--QPPPP 303 PP QG PP G PPQG PPP P QG PP PQ + Q PPP Sbjct: 179 PPTGPQPRPTQGPPPTGGPQQRPPQGPPPPGGPQPRPPQGPPPPGGPQPSPTQGPPP 235 Score = 67.4 bits (163), Expect = 5e-10 Identities = 46/104 (44%), Positives = 48/104 (46%), Gaps = 19/104 (18%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYPPPGYPPP----GYPPQG----Y 186 P PP Q +PP G PPP G PP+G PPP P P G PP G Sbjct: 147 PQGPPPPAGPQPRPPQGPPPPAGPQPRPPQG------PPPTGPQPRPTQGPPPTGGPQQR 200 Query: 187 PPQGYPPPG----YPPQGYPPP----PYSAQGYPPQYAPQYAQP 294 PPQG PPPG PPQG PPP P QG PP PQ P Sbjct: 201 PPQGPPPPGGPQPRPPQGPPPPGGPQPSPTQGPPPTGGPQQTPP 244 Score = 66.2 bits (160), Expect = 1e-09 Identities = 41/82 (50%), Positives = 44/82 (53%), Gaps = 3/82 (3%) Frame = +1 Query: 67 NQQQPPVGTPPPQGY---PPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPP 237 NQ Q P PPP G+ PP ++G PPPG P P PPQG PP G P P PPQG PP Sbjct: 25 NQIQIPNQRPPPSGFQPRPPVNGSQQGPPPPGGPQPR-PPQGPPPPGGPQPR-PPQG-PP 81 Query: 238 PPYSAQGYPPQYAPQYAQPPPP 303 PP Q PP Q PPP Sbjct: 82 PPGGPQPRPP-------QGPPP 96 Score = 59.3 bits (142), Expect = 1e-07 Identities = 41/91 (45%), Positives = 44/91 (48%), Gaps = 7/91 (7%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTP---PPQGYPPEGYGKEGYPPPGYPPPG----YPPQGYP 189 +G P T P Q PP G P PPQG PP G G + PP G PPPG P QG P Sbjct: 176 QGPPPTGPQPRPTQGPPPTGGPQQRPPQGPPPPG-GPQPRPPQGPPPPGGPQPSPTQGPP 234 Query: 190 PQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQ 282 P G PQ PP + QG PPQ PQ Sbjct: 235 PTG------GPQQTPPLAGNTQG-PPQGRPQ 258 [227][TOP] >UniRef100_P02812 Basic proline-rich peptide IB-4 n=1 Tax=Homo sapiens RepID=PRB2_HUMAN Length = 416 Score = 78.6 bits (192), Expect = 2e-13 Identities = 53/122 (43%), Positives = 55/122 (45%), Gaps = 20/122 (16%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGKEGYPPPGYPPPGYPPQG--------- 183 G P PP NQ Q P P PQG PP+G K PPP P G PPQG Sbjct: 55 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSP 114 Query: 184 -YPPQGYPPP-GYPPQGYPPPPYSAQGYPPQYA--------PQYAQPPPPHHHNNSNNSS 333 PQG PP G PQG PPPP QG PPQ P Q PPP N S +S Sbjct: 115 PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSRSSR 174 Query: 334 SP 339 SP Sbjct: 175 SP 176 Score = 72.4 bits (176), Expect = 1e-11 Identities = 47/103 (45%), Positives = 51/103 (49%), Gaps = 13/103 (12%) Frame = +1 Query: 34 GHPT-TPPMSYYNQQQPPVGTPPPQGYPPEGYGK-EGYPPPGYPPPGYPPQG-YPPQGYP 204 G+P PP Q PP PQG PP+G + +G PPP P G PPQG PQG P Sbjct: 34 GNPQGAPPQGGNKPQGPPSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPP 93 Query: 205 PPGYPPQGYPP----------PPYSAQGYPPQYAPQYAQPPPP 303 PPG PQG PP PP QG PPQ Q PPPP Sbjct: 94 PPG-KPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPP 135 Score = 70.1 bits (170), Expect = 7e-11 Identities = 45/103 (43%), Positives = 49/103 (47%), Gaps = 13/103 (12%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGK-EGYPPPGYPPPGYPPQ-GYPPQGYPP 207 G P PP + P PQG PP+G + +G PPP P G PPQ G PQG PP Sbjct: 96 GKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPP 155 Query: 208 PGYPPQGYPP-----------PPYSAQGYPPQYAPQYAQPPPP 303 PG PQG PP PP QG PPQ Q PPPP Sbjct: 156 PG-KPQGPPPQGDNKSRSSRSPPGKPQGPPPQGGNQPQGPPPP 197 Score = 70.1 bits (170), Expect = 7e-11 Identities = 52/126 (41%), Positives = 56/126 (44%), Gaps = 24/126 (19%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGK-EGYPPPGYP---------------- 159 G P PP NQ Q P P PQG PP+G K +G PPPG P Sbjct: 116 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSRSSRS 175 Query: 160 ----PPGYPPQG-YPPQGYPPPGYPPQGYPPP-PYSAQGYPPQYAPQYAQPPPPHHHNNS 321 P G PPQG PQG PPP PQG PP QG PP P Q PPP N S Sbjct: 176 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPP---PGKPQGPPPQGDNKS 232 Query: 322 NNSSSP 339 ++ SP Sbjct: 233 QSARSP 238 Score = 69.7 bits (169), Expect = 1e-10 Identities = 52/126 (41%), Positives = 57/126 (45%), Gaps = 24/126 (19%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGK-EGYPPPGYP---------------- 159 G P PP NQ Q P P PQG PP+G K +G PPPG P Sbjct: 178 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSQSARS 237 Query: 160 ----PPGYPPQG-YPPQGYPPPGYPPQGYPPP-PYSAQGYPPQYAPQYAQPPPPHHHNNS 321 P G PPQG PQG PPP PQG PP +QG PP P Q PPP + S Sbjct: 238 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKSQGPPP---PGKPQGPPPQGGSKS 294 Query: 322 NNSSSP 339 +S SP Sbjct: 295 RSSRSP 300 Score = 68.9 bits (167), Expect = 2e-10 Identities = 54/137 (39%), Positives = 59/137 (43%), Gaps = 32/137 (23%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVG--------TPP--PQGYPPEGYGK-EGYPPPGYPPPGYPPQG- 183 P PP Q PP G +PP PQG PP+G + +G PPP P G PPQG Sbjct: 150 PQGPPPPGKPQGPPPQGDNKSRSSRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGG 209 Query: 184 YPPQGYPPPGYPPQGYPP-----------PPYSAQGYPPQYA---------PQYAQPPPP 303 PQG PPPG PQG PP PP QG PPQ P Q PPP Sbjct: 210 NKPQGPPPPG-KPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPP 268 Query: 304 HHHNNSNNSSSPGCLEG 354 N S PG +G Sbjct: 269 QGGNKSQGPPPPGKPQG 285 Score = 68.6 bits (166), Expect = 2e-10 Identities = 46/107 (42%), Positives = 48/107 (44%), Gaps = 17/107 (15%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG---- 198 G P PP N+ Q P PQG PP+G G P G PPP PQG PPQG Sbjct: 219 GKPQGPPPQGDNKSQSARSPPGKPQGPPPQG----GNQPQGPPPPPGKPQGPPPQGGNKS 274 Query: 199 -YPPPGYPPQGYPP-----------PPYSAQGYPPQYAPQYAQPPPP 303 PPP PQG PP PP QG PPQ Q PPPP Sbjct: 275 QGPPPPGKPQGPPPQGGSKSRSSRSPPGKPQGPPPQGGNQPQGPPPP 321 Score = 67.8 bits (164), Expect = 4e-10 Identities = 51/126 (40%), Positives = 56/126 (44%), Gaps = 24/126 (19%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGK-EGYPPPGYP---------------- 159 G P PP NQ Q P P PQG PP+G K +G PPPG P Sbjct: 240 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKSQGPPPPGKPQGPPPQGGSKSRSSRS 299 Query: 160 ----PPGYPPQ-GYPPQGYPPPGYPPQGYPPP-PYSAQGYPPQYAPQYAQPPPPHHHNNS 321 P G PPQ G PQG PPP PQG PP QG PP P Q PPP + S Sbjct: 300 PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPP---PGKPQGPPPQGGSKS 356 Query: 322 NNSSSP 339 ++ SP Sbjct: 357 RSARSP 362 Score = 65.1 bits (157), Expect = 2e-09 Identities = 36/78 (46%), Positives = 41/78 (52%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYS 249 ++ P + PQG PP+G G P G P P PQG PPQG G PQG PPPP Sbjct: 26 EESPSLIAGNPQGAPPQG----GNKPQGPPSPPGKPQGPPPQG----GNQPQGPPPPPGK 77 Query: 250 AQGYPPQYAPQYAQPPPP 303 QG PPQ + PPPP Sbjct: 78 PQGPPPQGGNKPQGPPPP 95 Score = 62.4 bits (150), Expect = 2e-08 Identities = 49/120 (40%), Positives = 50/120 (41%), Gaps = 18/120 (15%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG---- 198 G P PP NQ Q P P PQG PP+G G P G PPPG PQG PPQG Sbjct: 302 GKPQGPPPQGGNQPQGPPPPPGKPQGPPPQG----GNKPQGPPPPG-KPQGPPPQGGSKS 356 Query: 199 ---YPPPGYP----------PQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSP 339 PPG P PQG PPPP PQ AP QP P S P Sbjct: 357 RSARSPPGKPQGPPQQEGNNPQG-PPPPAGGNPQQPQ-APPAGQPQGPPRPPQGGRPSRP 414 [228][TOP] >UniRef100_A0PVC4 Conserved membrane protein n=1 Tax=Mycobacterium ulcerans Agy99 RepID=A0PVC4_MYCUA Length = 419 Score = 78.2 bits (191), Expect = 3e-13 Identities = 46/86 (53%), Positives = 47/86 (54%), Gaps = 13/86 (15%) Frame = +1 Query: 85 VGTPPPQGYPPE------GYGKEGYPPPGY--PPPGY-PPQGY-PPQGY--PPPGY-PPQ 225 + T PP GYP E GY GYPP GY PPP Y PP Y PP GY PPPGY PP Sbjct: 1 MSTLPPPGYPVEPNSGAPGYEAAGYPPSGYADPPPAYGPPPAYGPPPGYGAPPPGYGPPP 60 Query: 226 GYPPPPYSAQGYPPQYAPQYAQPPPP 303 GY PPP G PP Y P PPP Sbjct: 61 GYAPPP-PGYGPPPGYGPPPGYGPPP 85 Score = 76.3 bits (186), Expect = 1e-12 Identities = 45/85 (52%), Positives = 47/85 (55%), Gaps = 3/85 (3%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY-PPPGYPPQGYPPQGY-PPPGY-P 219 PP Y + PP PPP PP GYG PPPGY PPPGY P PP GY PPPGY P Sbjct: 26 PPSGYADP--PPAYGPPPAYGPPPGYGA---PPPGYGPPPGYAP---PPPGYGPPPGYGP 77 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQP 294 P GY PPP GY P P +P Sbjct: 78 PPGYGPPP---PGYGPPLVPGAVKP 99 [229][TOP] >UniRef100_B9Q1I7 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9Q1I7_TOXGO Length = 314 Score = 78.2 bits (191), Expect = 3e-13 Identities = 49/99 (49%), Positives = 51/99 (51%), Gaps = 10/99 (10%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEG--YGKEGYPPPGYPPPG--YPPQG--YPPQG- 198 PTTPP + P G PP PP G Y G PP YPPPG YPP G YPP G Sbjct: 177 PTTPPAA----AAVPTGIPPAYQTPPPGPYYPSPGQPPQYYPPPGGSYPPPGAPYPPPGA 232 Query: 199 -YPPPG--YPPQGYPPPPYSAQGYPPQYAPQYAQPPPPH 306 YPPPG YPP G P PP A G P +P PP PH Sbjct: 233 PYPPPGAPYPPPGAPYPP--AYGGPLPQSPPGQAPPNPH 269 Score = 69.3 bits (168), Expect = 1e-10 Identities = 46/96 (47%), Positives = 48/96 (50%), Gaps = 8/96 (8%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPG--YPPPG--YPPQGYPPQGYP 204 + T PP YY P PPQ YPP G YPPPG YPPPG YPP G P YP Sbjct: 194 YQTPPPGPYY-----PSPGQPPQYYPPPG---GSYPPPGAPYPPPGAPYPPPGAP---YP 242 Query: 205 PPG--YPPQGYPPPPYSAQGYPP--QYAPQYAQPPP 300 PPG YPP P P S G P +AP Y P P Sbjct: 243 PPGAPYPPAYGGPLPQSPPGQAPPNPHAPGYIPPGP 278 Score = 65.9 bits (159), Expect = 1e-09 Identities = 47/102 (46%), Positives = 47/102 (46%), Gaps = 15/102 (14%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY--PPPG--YPPQGYPPQGYPP 207 P P Y Q P TPP P G PP Y PPPG YP G PPQ YPP Sbjct: 164 PNDPSTIYVTQPVPT--TPPAAAAVPTGI------PPAYQTPPPGPYYPSPGQPPQYYPP 215 Query: 208 PG--YPPQG--YPPP--PYSAQG--YPP---QYAPQYAQPPP 300 PG YPP G YPPP PY G YPP Y P Y P P Sbjct: 216 PGGSYPPPGAPYPPPGAPYPPPGAPYPPPGAPYPPAYGGPLP 257 Score = 54.7 bits (130), Expect = 3e-06 Identities = 38/93 (40%), Positives = 40/93 (43%), Gaps = 11/93 (11%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTP-PPQG--YPPEGYGKEGYPPPGYPP-----PGYPPQG-- 183 G P PP + Y PP G P PP G YPP G PPG P PGY P G Sbjct: 224 GAPYPPPGAPY----PPPGAPYPPPGAPYPPAYGGPLPQSPPGQAPPNPHAPGYIPPGPY 279 Query: 184 -YPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAP 279 +PP PPG PP G P S G P P Sbjct: 280 PFPPPRAYPPGGPPSGVPDAQVSPPGQPTSQPP 312 [230][TOP] >UniRef100_C5JSF5 Annexin n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JSF5_AJEDS Length = 464 Score = 78.2 bits (191), Expect = 3e-13 Identities = 52/114 (45%), Positives = 55/114 (48%), Gaps = 26/114 (22%) Frame = +1 Query: 79 PPVGTPPPQG---YPPEGYGKEGYPPPGYPP-PG-YPPQGYPPQG---------YPPPG- 213 P G PPP YPP+ YG PP G+PP PG YPP GYPPQ YPPPG Sbjct: 8 PGSGHPPPAQPGQYPPQQYGAP--PPQGFPPQPGQYPPYGYPPQSPYAPQQGQQYPPPGQ 65 Query: 214 YPPQG--------YPPPPYSAQGYPPQYAPQYAQPP---PPHHHNNSNNSSSPG 342 YPP G YPP PY Q PQ QY QPP PP N+ PG Sbjct: 66 YPPPGQYPPQYGQYPPQPYPQQYQQPQGHYQYQQPPYGYPPQAPPAGYNAPQPG 119 Score = 77.0 bits (188), Expect = 6e-13 Identities = 53/118 (44%), Positives = 56/118 (47%), Gaps = 29/118 (24%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQ----PPVGTPPPQG-YPPEGYGKEG---------YPPPG-YPPPG 168 GHP Y QQ PP G PP G YPP GY + YPPPG YPPPG Sbjct: 11 GHPPPAQPGQYPPQQYGAPPPQGFPPQPGQYPPYGYPPQSPYAPQQGQQYPPPGQYPPPG 70 Query: 169 -YPPQ--GYPPQGYP-----PPGY-----PPQGYPP-PPYSAQGYPPQYAPQYAQPPP 300 YPPQ YPPQ YP P G+ PP GYPP P + P AP Y PPP Sbjct: 71 QYPPQYGQYPPQPYPQQYQQPQGHYQYQQPPYGYPPQAPPAGYNAPQPGAPGYGAPPP 128 Score = 62.4 bits (150), Expect = 2e-08 Identities = 42/103 (40%), Positives = 48/103 (46%), Gaps = 19/103 (18%) Frame = +1 Query: 49 PPMSYY----NQQQPPVGTPPPQG--------YPPEGYGKEGYPPPGY-----PPPGYPP 177 PP S Y QQ PP G PP G YPP+ Y ++ P G+ PP GYPP Sbjct: 47 PPQSPYAPQQGQQYPPPGQYPPPGQYPPQYGQYPPQPYPQQYQQPQGHYQYQQPPYGYPP 106 Query: 178 QGYPPQGY--PPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 Q PP GY P PG P G PPP + P +AP A P Sbjct: 107 QA-PPAGYNAPQPGAPGYGAPPPVQNPP-MQPNFAPGIAMERP 147 [231][TOP] >UniRef100_B8N6V9 UV-induced protein uvi15, putative n=2 Tax=Aspergillus RepID=B8N6V9_ASPFN Length = 109 Score = 78.2 bits (191), Expect = 3e-13 Identities = 47/109 (43%), Positives = 52/109 (47%), Gaps = 17/109 (15%) Frame = +1 Query: 124 YGKEGYPPPGYPPPGYPPQGYPPQG-----YPPPGYPPQGYPPPPYSAQGY----PPQ-- 270 Y K PPP YP P + YPPQG Y GYPPQ Y PPP QGY PPQ Sbjct: 3 YNKPDGPPPSYPAPVHDAGPYPPQGAQGDYYNQGGYPPQNYGPPP--QQGYYGSPPPQGQ 60 Query: 271 ----YAPQYAQPPPPHHHNN--SNNSSSPGCLEGCCAALCCCCLLDACF 399 Y PQ P P ++ ++ SS G G AAL CCC LD F Sbjct: 61 QPMYYPPQQGYPQPGYYADDRGGGGSSGGGICAGIMAALACCCCLDILF 109 [232][TOP] >UniRef100_UPI0001926154 PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926154 Length = 144 Score = 77.8 bits (190), Expect = 4e-13 Identities = 52/136 (38%), Positives = 61/136 (44%), Gaps = 18/136 (13%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGY--PPPGY--PPPGYP--PQGYP--P 192 +P Y PP P YP GY G+ PPPG+ PPGYP GYP Sbjct: 12 YPPPQKEPYQGLSNPPPYNQQPPAYPVSGYPAPGFQGPPPGFQGAPPGYPVSQPGYPVAQ 71 Query: 193 QGYPP--PGYPPQGYP----PPPYSAQGYPPQYAPQYAQPPPP--HHHNNSNNSSSPGCL 348 GYPP PGYPP GYP PY AQ P Q PP + H ++++ C Sbjct: 72 PGYPPQQPGYPPSGYPGYQQTGPYPAQ---PTNTTLIMQQPPQQVYVHQKKADTTAEDCA 128 Query: 349 EG--CCAALCCCCLLD 390 G C A LCCC + D Sbjct: 129 LGALCMACLCCCLMSD 144 [233][TOP] >UniRef100_Q0RKM5 Putative uncharacterized protein n=1 Tax=Frankia alni ACN14a RepID=Q0RKM5_FRAAA Length = 525 Score = 77.8 bits (190), Expect = 4e-13 Identities = 43/74 (58%), Positives = 43/74 (58%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 307 GGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTP 366 Query: 119 SGG*PCGGGVPTGG 78 GG P GGGVP GG Sbjct: 367 GGGVP-GGGVPGGG 379 Score = 77.8 bits (190), Expect = 4e-13 Identities = 43/74 (58%), Positives = 43/74 (58%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 317 GGGVPGGGTPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVP 376 Query: 119 SGG*PCGGGVPTGG 78 GG P GGGVP GG Sbjct: 377 GGGTP-GGGVPGGG 389 Score = 76.6 bits (187), Expect = 8e-13 Identities = 42/74 (56%), Positives = 42/74 (56%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 322 GGGTPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTP 381 Query: 119 SGG*PCGGGVPTGG 78 GG P GGG P GG Sbjct: 382 GGGVP-GGGTPGGG 394 Score = 76.6 bits (187), Expect = 8e-13 Identities = 42/74 (56%), Positives = 42/74 (56%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 337 GGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGGGVP 396 Query: 119 SGG*PCGGGVPTGG 78 GG P GGG P GG Sbjct: 397 GGGTP-GGGTPGGG 409 Score = 76.3 bits (186), Expect = 1e-12 Identities = 43/75 (57%), Positives = 43/75 (57%) Frame = -1 Query: 302 GGGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPY 123 G GG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P Sbjct: 291 GVGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGGGVPGGGVPGGGT 350 Query: 122 PSGG*PCGGGVPTGG 78 P GG P GGGVP GG Sbjct: 351 PGGGVP-GGGVPGGG 364 Score = 76.3 bits (186), Expect = 1e-12 Identities = 42/74 (56%), Positives = 42/74 (56%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 297 GGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVP 356 Query: 119 SGG*PCGGGVPTGG 78 GG P GGG P GG Sbjct: 357 GGGVP-GGGTPGGG 369 Score = 75.9 bits (185), Expect = 1e-12 Identities = 42/74 (56%), Positives = 42/74 (56%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 332 GGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTP 391 Query: 119 SGG*PCGGGVPTGG 78 GG P GGG P GG Sbjct: 392 GGGVP-GGGTPGGG 404 Score = 75.5 bits (184), Expect = 2e-12 Identities = 42/74 (56%), Positives = 42/74 (56%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 347 GGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGGGTP 406 Query: 119 SGG*PCGGGVPTGG 78 GG P GGG P GG Sbjct: 407 GGGTP-GGGTPGGG 419 Score = 73.6 bits (179), Expect = 7e-12 Identities = 41/74 (55%), Positives = 41/74 (55%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 352 GGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGGGTPGGGTP 411 Query: 119 SGG*PCGGGVPTGG 78 GG P GGG P G Sbjct: 412 GGGTP-GGGTPGSG 424 Score = 70.1 bits (170), Expect = 7e-11 Identities = 39/72 (54%), Positives = 39/72 (54%) Frame = -1 Query: 299 GGG*AY*GAY*GG*PCAEYGGGGYPCGG*PGGGYPCGGYPCGGYPGGGYPGGGYPSFPYP 120 GGG G GG P GGG P GG PGGG P GG P GG PGGG PGGG P P Sbjct: 357 GGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGGGTPGGGTPGGGTP 416 Query: 119 SGG*PCGGGVPT 84 GG P GG T Sbjct: 417 GGGTPGSGGSHT 428 [234][TOP] >UniRef100_A9SRR1 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SRR1_PHYPA Length = 215 Score = 77.8 bits (190), Expect = 4e-13 Identities = 39/75 (52%), Positives = 43/75 (57%) Frame = +1 Query: 118 EGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 +G G+ GYPP GYPP GYPPQGYPPQGYPP G GY GYPP P Y P Sbjct: 60 QGQGQHGYPPQGYPPQGYPPQGYPPQGYPPQG----GY--------GYPPAAPPGY---P 104 Query: 298 PPHHHNNSNNSSSPG 342 H + S+ S S G Sbjct: 105 QTHGSHGSSQSGSHG 119 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 3/41 (7%) Frame = +1 Query: 106 GYPPEGYGKEGYPPPGYPPPGYPPQ---GYPPQGYPPPGYP 219 GYPP+GY +GYPP GYPP GYPPQ GYPP PPGYP Sbjct: 66 GYPPQGYPPQGYPPQGYPPQGYPPQGGYGYPPAA--PPGYP 104 [235][TOP] >UniRef100_Q581B0 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei RepID=Q581B0_9TRYP Length = 370 Score = 77.8 bits (190), Expect = 4e-13 Identities = 63/156 (40%), Positives = 68/156 (43%), Gaps = 39/156 (25%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVG---TPPPQGY----PPEGYGKEGYPPPGY----PPPGY--- 171 G+ PP + Y Q PP G PPP GY PP GYG+ PP GY PP GY Sbjct: 92 GYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPP-PPAGYGQPPPPAGYGQP 150 Query: 172 -PPQGY----PPQGY----PPPGY----PPQGY-PPPPYSAQGYPP--QYAP--QYAQPP 297 PP GY PP GY PP GY PP GY PPP + G PP Y P YA+ Sbjct: 151 PPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPCGVYKPPDDYAEVQ 210 Query: 298 PPHHHNNSNNS------SSP-GCLEGCCAALCCCCL 384 N S S P CL CC CC L Sbjct: 211 KWEGENEWETSMLGAPCSEPLFCLGACCCPWCCAFL 246 Score = 70.5 bits (171), Expect = 6e-11 Identities = 47/97 (48%), Positives = 49/97 (50%), Gaps = 12/97 (12%) Frame = +1 Query: 49 PPMSYYNQQQPPVG---TPPPQGY----PPEGYGKEGYPPPGYPPPGYPPQGY----PPQ 195 PP Q PP G PPP GY PP GYG+ PP GY P PP GY PP Sbjct: 79 PPTDNGKQPPPPAGYGQPPPPAGYGQPPPPAGYGQPP-PPAGYGQPP-PPAGYGQPPPPA 136 Query: 196 GYPPPGYPPQGY-PPPPYSAQGYPPQYAPQYAQPPPP 303 GY P PP GY PPP + G PP A Y QPPPP Sbjct: 137 GYGQPP-PPAGYGQPPPPAGYGQPPPPA-GYGQPPPP 171 [236][TOP] >UniRef100_C5M0W7 Protein transport protein Sec24A, putative n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5M0W7_9ALVE Length = 787 Score = 77.8 bits (190), Expect = 4e-13 Identities = 41/95 (43%), Positives = 44/95 (46%), Gaps = 7/95 (7%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYP-----PEGYGKEGYPPPGYPPPGYPPQGYPPQGYP 204 PT PPM P +G P G P P G G PP G PP G PP G PP G P Sbjct: 688 PTMPPMGQMPLAPPSIGNHVPNGPPRMTQSPMGQPPMGQPPMGQPPMGQPPMGQPPTGQP 747 Query: 205 PPGYPPQGYPPPPYSAQGYPPQYAPQYAQPP--PP 303 P G PP G P S+ G P + P QPP PP Sbjct: 748 PMGQPPMGQPSMGQSSMGQPSRGQPPMGQPPMGPP 782 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/66 (45%), Positives = 32/66 (48%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQG 228 PPM QPP+G PP G PP G G PP G P G G P +G PP G PP G Sbjct: 722 PPMGQPPMGQPPMGQPP-MGQPPTGQPPMGQPPMGQPSMGQSSMGQPSRGQPPMGQPPMG 780 Query: 229 YPPPPY 246 P Y Sbjct: 781 PPRSTY 786 [237][TOP] >UniRef100_Q28H62 UPF0467 protein C5orf32 homolog n=1 Tax=Xenopus (Silurana) tropicalis RepID=CE032_XENTR Length = 110 Score = 77.8 bits (190), Expect = 4e-13 Identities = 48/114 (42%), Positives = 52/114 (45%), Gaps = 6/114 (5%) Frame = +1 Query: 67 NQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP--PGYPPQGYPPP 240 N + PP PP YPP G + YP P P G PP P GY P PGY QGYP Sbjct: 2 NYENPPPYASPPAPYPPYGQQQPSYPVPNQYP-GNPPG---PVGYQPAQPGY--QGYPQ- 54 Query: 241 PYSAQGYPPQYAPQYAQPPPPH----HHNNSNNSSSPGCLEGCCAALCCCCLLD 390 Y QG PP AP Y P ++ S CL C ALCCCCL D Sbjct: 55 -YGWQGAPPANAPVYMDAPKNTVYVVEERRNDTSGESACLTACWTALCCCCLWD 107 [238][TOP] >UniRef100_UPI0001A7B248 proline-rich family protein n=1 Tax=Arabidopsis thaliana RepID=UPI0001A7B248 Length = 162 Score = 77.4 bits (189), Expect = 5e-13 Identities = 57/170 (33%), Positives = 67/170 (39%), Gaps = 56/170 (32%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPP---QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQ----GYPPPG 213 MSY + PP PPP YPP GY PPPGYP P +GYPP GYPPP Sbjct: 1 MSY--DRVPPESYPPPGYQSHYPPPGY-PSAPPPPGYPSPPSHHEGYPPPQPYGGYPPPS 57 Query: 214 YPP-----QGYPPPPYSAQGYPPQYAPQYAQPPPP-----------HHHNNSNNSSSPGC 345 P QGY ++ GYP Q+ + PPPP HHH ++S Sbjct: 58 SRPYEGGYQGY----FAGGGYPHQH---HGPPPPPPPQNYDHCHHDHHHYQDSDSGCFSF 110 Query: 346 LEGC---------------------------------CAALCCCCLLDAC 396 + GC AALCCCCLL+ C Sbjct: 111 IRGCHNVKLKSSVVNPDLTSLSFCLVANYRNFRARDSLAALCCCCLLEEC 160 [239][TOP] >UniRef100_UPI0000E47472 PREDICTED: similar to Splicing factor 3b, subunit 4 n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E47472 Length = 425 Score = 77.4 bits (189), Expect = 5e-13 Identities = 37/75 (49%), Positives = 39/75 (52%) Frame = +1 Query: 82 PVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYPPPPYSAQGY 261 P+ PPP PP G PPPG PPPG PP G PP PPPG PP PPPP G Sbjct: 249 PLPMPPPFPMPP------GMPPPGMPPPGMPPMGMPPP-IPPPGMPPPPMPPPPVPPPGG 301 Query: 262 PPQYAPQYAQPPPPH 306 P P PPPP+ Sbjct: 302 MPHMGPGGMPPPPPN 316 Score = 67.0 bits (162), Expect = 6e-10 Identities = 42/104 (40%), Positives = 44/104 (42%), Gaps = 13/104 (12%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 PT+ P+ PP PP G PP G G PP G PPP PP G PP PPP P Sbjct: 245 PTSNPLP----MPPPFPMPP--GMPPPGMPPPGMPPMGMPPP-IPPPGMPPPPMPPPPVP 297 Query: 220 PQG----------YPPPPYSAQGYPPQYAPQYAQPPPPH---HH 312 P G PPPP G PP P PPH HH Sbjct: 298 PPGGMPHMGPGGMPPPPPNMMGGLPPPPVPPPDMRGPPHRGMHH 341 Score = 60.8 bits (146), Expect = 4e-08 Identities = 37/99 (37%), Positives = 40/99 (40%), Gaps = 10/99 (10%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQ----GYPPQ---- 195 P PP PP+G PPP PP G PPP PPPG P G PP Sbjct: 260 PGMPPPGMPPPGMPPMGMPPP--IPPPGMPPPPMPPPPVPPPGGMPHMGPGGMPPPPPNM 317 Query: 196 --GYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPH 306 G PPP PP PP+ + P PPPPH Sbjct: 318 MGGLPPPPVPPPDMRGPPHRGM----HHGPHGPFPPPPH 352 Score = 57.8 bits (138), Expect = 4e-07 Identities = 38/100 (38%), Positives = 41/100 (41%), Gaps = 7/100 (7%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 H+ PP + N +G PP PP G P P P PP PP G PP Sbjct: 208 HQLFADAPPTAQANGVVSSLGQAPPP--PPSGGTATSNVPTSNPLPMPPPFPMPP-GMPP 264 Query: 208 PGYPPQGYP----PPPYSAQGYPPQYAPQYAQPPP---PH 306 PG PP G P PPP G PP P PPP PH Sbjct: 265 PGMPPPGMPPMGMPPPIPPPGMPPPPMPPPPVPPPGGMPH 304 [240][TOP] >UniRef100_UPI0000DA2626 PREDICTED: similar to Acidic proline-rich protein PRP25 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA2626 Length = 270 Score = 77.4 bits (189), Expect = 5e-13 Identities = 53/129 (41%), Positives = 58/129 (44%), Gaps = 26/129 (20%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQPPVGTPP--------PQGYPPEGYGKEGYPPPGYPPPG----YP 174 +G P PP QQ+ P G PP PQG PP+G G + PP G PPPG P Sbjct: 134 QGPPQGPPPQGGPQQRAPQGPPPQGGPEQRAPQGPPPQG-GPQQKPPQGPPPPGGPQQKP 192 Query: 175 PQGYPPQG----YPPPGYPPQG--------YPPPPYSAQGYPPQYAPQYAQPP--PPHHH 312 PQG PPQG PP G PPQG PPPP Q PPQ P P PP Sbjct: 193 PQGPPPQGGPQQKPPQGPPPQGGPQQKPPQGPPPPGGPQQRPPQGPPPQGGPQQRPPQPG 252 Query: 313 NNSNNSSSP 339 N+ P Sbjct: 253 NSQGPQQGP 261 Score = 76.6 bits (187), Expect = 8e-13 Identities = 46/105 (43%), Positives = 51/105 (48%), Gaps = 17/105 (16%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQG---YPPEGYGKEGYP---PPGYPPPGYPPQGYPPQGY 201 P PP QQ+PP G PPP G PP+G +G P PP PPP PQ PPQG Sbjct: 165 PQGPPPQGGPQQKPPQGPPPPGGPQQKPPQGPPPQGGPQQKPPQGPPPQGGPQQKPPQGP 224 Query: 202 PPPG----YPPQGYPP-------PPYSAQGYPPQYAPQYAQPPPP 303 PPPG PPQG PP PP PQ PQ+ +P P Sbjct: 225 PPPGGPQQRPPQGPPPQGGPQQRPPQPGNSQGPQQGPQFGRPQGP 269 Score = 73.6 bits (179), Expect = 7e-12 Identities = 48/106 (45%), Positives = 52/106 (49%), Gaps = 16/106 (15%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQG------YPPEGYGKEGYPPPGYPPPGYPPQGYPPQ 195 G+ PP QQ+PP G PPP G PP G + PP G PP G P QG PPQ Sbjct: 80 GNQQGPPPQGGPQQRPPQGPPPPGGPQQRPQGPPPPAGPQQRPPQGPPPQGGPQQG-PPQ 138 Query: 196 GYPPPGYPPQGYP--PPPY------SAQGYPPQYAPQYAQP--PPP 303 G PP G P Q P PPP + QG PPQ PQ P PPP Sbjct: 139 GPPPQGGPQQRAPQGPPPQGGPEQRAPQGPPPQGGPQQKPPQGPPP 184 Score = 59.3 bits (142), Expect = 1e-07 Identities = 44/108 (40%), Positives = 46/108 (42%), Gaps = 23/108 (21%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPE--GYGKEGYPPPGYPPPGYPPQGYP--------PQG 198 P N Q P PPP G+ P G + PPP P PPQG P PQG Sbjct: 52 PGEELQNLNQIPNQRPPPSGFRPRPPANGNQQGPPPQGGPQQRPPQGPPPPGGPQQRPQG 111 Query: 199 YPPPG----YPPQGYPP-------PPYSAQGYPPQYAPQYAQP--PPP 303 PPP PPQG PP PP QG PPQ PQ P PPP Sbjct: 112 PPPPAGPQQRPPQGPPPQGGPQQGPP---QGPPPQGGPQQRAPQGPPP 156 [241][TOP] >UniRef100_UPI00001241B1 Hypothetical protein CBG12912 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI00001241B1 Length = 788 Score = 77.4 bits (189), Expect = 5e-13 Identities = 56/121 (46%), Positives = 57/121 (47%), Gaps = 31/121 (25%) Frame = +1 Query: 40 PTTPPMSYYN-QQQPPVGT--PPPQ-----GYPPEGYGKEGYPPPGYPPPGYPPQG---Y 186 P PP Y QQQPP G PPPQ G PP G GYPPP PG P G Y Sbjct: 633 PQQPPQGYPGGQQQPPQGQGYPPPQSRYQQGPPPPQQGYPGYPPPQGHYPGQPGPGQPYY 692 Query: 187 PPQGYP----PPGYPP--------QGYPPPPY--SAQGYPPQ-----YAP-QYAQPPPPH 306 P QG P P GYPP Q YP PP + GYPPQ Y P QY Q PPP Sbjct: 693 PQQGQPQYPHPGGYPPQQRGPYQQQPYPGPPQGRAPYGYPPQQGHPGYPPQQYGQMPPPP 752 Query: 307 H 309 H Sbjct: 753 H 753 Score = 71.2 bits (173), Expect = 3e-11 Identities = 55/140 (39%), Positives = 61/140 (43%), Gaps = 34/140 (24%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPV-----GTPPPQGYPP--EGYGKEGYP---------PPGY 156 Q +G+P PP S Y Q PP G PPPQG+ P G G+ YP P GY Sbjct: 649 QGQGYP--PPQSRYQQGPPPPQQGYPGYPPPQGHYPGQPGPGQPYYPQQGQPQYPHPGGY 706 Query: 157 PP-----------PGYP----PQGYPPQGYPPPGYPPQGY---PPPPYSAQGYPPQYAPQ 282 PP PG P P GYPPQ PGYPPQ Y PPPP+ YPP Q Sbjct: 707 PPQQRGPYQQQPYPGPPQGRAPYGYPPQ-QGHPGYPPQQYGQMPPPPHGQ--YPPPPQQQ 763 Query: 283 YAQPPPPHHHNNSNNSSSPG 342 P P H S+ G Sbjct: 764 QGGPMGPPHQPPSHEEGGQG 783 Score = 66.6 bits (161), Expect = 8e-10 Identities = 46/100 (46%), Positives = 47/100 (47%), Gaps = 14/100 (14%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPP---QGYPP------QGY 201 PP QQ PP PPQ PP+ PP GYP P QGYPP QG Sbjct: 605 PPQQQPPQQIPPQQQMPPQAPPPQQQIPPQQPPQGYPGGQQQPPQGQGYPPPQSRYQQGP 664 Query: 202 PPP--GYPPQGYPPPP--YSAQGYPPQ-YAPQYAQPPPPH 306 PPP GYP GYPPP Y Q P Q Y PQ QP PH Sbjct: 665 PPPQQGYP--GYPPPQGHYPGQPGPGQPYYPQQGQPQYPH 702 Score = 58.2 bits (139), Expect = 3e-07 Identities = 36/81 (44%), Positives = 38/81 (46%), Gaps = 3/81 (3%) Frame = +1 Query: 70 QQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYPPQGYP---PP 240 QQQ P PPPQ PP+ PP PP P PPQ PP PPQGYP Sbjct: 599 QQQMP---PPPQQQPPQQI-----PPQQQMPPQAP----PPQQQIPPQQPPQGYPGGQQQ 646 Query: 241 PYSAQGYPPQYAPQYAQPPPP 303 P QGYPP + PPPP Sbjct: 647 PPQGQGYPPPQSRYQQGPPPP 667 [242][TOP] >UniRef100_Q0J0G9 Os09g0510000 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q0J0G9_ORYSJ Length = 121 Score = 77.4 bits (189), Expect = 5e-13 Identities = 50/125 (40%), Positives = 57/125 (45%), Gaps = 24/125 (19%) Frame = +1 Query: 94 PPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQG--YPPPGY-PPQGYPPPPYSAQGYP 264 PPPQ +GYPPPGY P YPP PP G YPP Y PP PPP Y QGY Sbjct: 7 PPPQ---------DGYPPPGYSQP-YPP---PPSGGQYPPTQYYPPPNQPPPGY--QGYF 51 Query: 265 PQ-YAPQYAQPPP--------------------PHHHNNSNNSSSPGCLEGCCAALCCCC 381 + P Y PPP HHH + ++ G L G A LCCCC Sbjct: 52 SEGQQPPYYYPPPHDPHHHHGHHHHHEDHHHHGHHHHGHHDDDCCLGFLRGWLAILCCCC 111 Query: 382 LLDAC 396 +L+ C Sbjct: 112 VLEEC 116 [243][TOP] >UniRef100_C4LZ89 RNA recognition motif domain containing protein n=1 Tax=Entamoeba histolytica HM-1:IMSS RepID=C4LZ89_ENTHI Length = 495 Score = 77.4 bits (189), Expect = 5e-13 Identities = 39/99 (39%), Positives = 44/99 (44%), Gaps = 7/99 (7%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 329 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSL 388 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPP---PPHHHNNSN 324 PPQ PP Q PPQ P + PP PP + + N Sbjct: 389 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQNIPSQN 427 Score = 76.3 bits (186), Expect = 1e-12 Identities = 36/87 (41%), Positives = 39/87 (44%), Gaps = 4/87 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 309 PPQSLPPQNLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSL 368 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PPQ PP Q PPQ P + PP Sbjct: 369 PPQSLPPQSLPPQSLPPQSLPPQSLPP 395 Score = 76.3 bits (186), Expect = 1e-12 Identities = 36/87 (41%), Positives = 39/87 (44%), Gaps = 4/87 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 319 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSL 378 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PPQ PP Q PPQ P + PP Sbjct: 379 PPQSLPPQSLPPQSLPPQSLPPQSLPP 405 Score = 76.3 bits (186), Expect = 1e-12 Identities = 36/87 (41%), Positives = 39/87 (44%), Gaps = 4/87 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 324 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSL 383 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PPQ PP Q PPQ P + PP Sbjct: 384 PPQSLPPQSLPPQSLPPQSLPPQSLPP 410 Score = 75.1 bits (183), Expect = 2e-12 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 4/87 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP + Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 314 PPQNLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSL 373 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PPQ PP Q PPQ P + PP Sbjct: 374 PPQSLPPQSLPPQSLPPQSLPPQSLPP 400 Score = 74.3 bits (181), Expect = 4e-12 Identities = 35/90 (38%), Positives = 40/90 (44%), Gaps = 4/90 (4%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPP 207 P P + +Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 296 PMLLPQTIPSQNLPPQSLPPQNLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPP 355 Query: 208 PGYPPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PPQ PP Q PPQ P + PP Sbjct: 356 QSLPPQSLPPQSLPPQSLPPQSLPPQSLPP 385 Score = 72.4 bits (176), Expect = 1e-11 Identities = 34/86 (39%), Positives = 37/86 (43%) Frame = +1 Query: 40 PTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGYP 219 P TP Q P PPQ PP+ + PP PP PPQ PPQ PP P Sbjct: 290 PITPFQPMLLPQTIPSQNLPPQSLPPQNLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLP 349 Query: 220 PQGYPPPPYSAQGYPPQYAPQYAQPP 297 PQ PP Q PPQ P + PP Sbjct: 350 PQSLPPQSLPPQSLPPQSLPPQSLPP 375 Score = 72.4 bits (176), Expect = 1e-11 Identities = 35/86 (40%), Positives = 37/86 (43%), Gaps = 4/86 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 344 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSL 403 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQP 294 PPQ PP Q PPQ P P Sbjct: 404 PPQSLPPQSLPPQSLPPQNIPSQNIP 429 Score = 68.6 bits (166), Expect = 2e-10 Identities = 33/86 (38%), Positives = 37/86 (43%), Gaps = 4/86 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 354 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSL 413 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQP 294 PPQ PP +Q P Q + P Sbjct: 414 PPQSLPPQNIPSQNIPSQSVSSQSLP 439 Score = 67.8 bits (164), Expect = 4e-10 Identities = 33/87 (37%), Positives = 37/87 (42%), Gaps = 4/87 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 359 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSL 418 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPP 297 PPQ P +Q Q P + PP Sbjct: 419 PPQNIPSQNIPSQSVSSQSLPSQSLPP 445 Score = 65.9 bits (159), Expect = 1e-09 Identities = 33/86 (38%), Positives = 36/86 (41%), Gaps = 4/86 (4%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ PP Sbjct: 364 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQNI 423 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQP 294 P Q P S+Q P Q P P Sbjct: 424 PSQNIPSQSVSSQSLPSQSLPPQNLP 449 Score = 62.4 bits (150), Expect = 2e-08 Identities = 36/104 (34%), Positives = 44/104 (42%), Gaps = 7/104 (6%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPP----PQGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGYPPPGY 216 PP S Q PP PP PQ PP+ + PP PP PPQ PPQ P Sbjct: 369 PPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQSLPPQNIPSQNI 428 Query: 217 PPQGYPPPPYSAQGYPPQYAP-QYAQPPPPH--HHNNSNNSSSP 339 P Q +Q PPQ P Q +Q P+ + S N++ P Sbjct: 429 PSQSVSSQSLPSQSLPPQNLPFQQSQLTNPYSSYKLESQNNNQP 472 [244][TOP] >UniRef100_A2G332 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2G332_TRIVA Length = 297 Score = 77.4 bits (189), Expect = 5e-13 Identities = 50/115 (43%), Positives = 55/115 (47%), Gaps = 11/115 (9%) Frame = +1 Query: 25 QHRGHPTTP-----PMSYYNQQQPP-----VGTPPPQGYPPEGYGKEGYPPPGYPPPGYP 174 Q+ G+P P P Y QQ PP G PP YPP YG+ PPPG P G P Sbjct: 174 QYPGYPQPPYGQQPPPPAYGQQNPPPPQNHYGAPPT--YPPP-YGQAPPPPPGQPY-GQP 229 Query: 175 PQGY-PPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSS 336 P GY PP P P PP GY PPP PPQ P PPPP + NN +S Sbjct: 230 PPGYMPPPPAPVPNQPPPGYKPPPPPMAPIPPQNPP---PPPPPQPQSAINNQNS 281 Score = 70.9 bits (172), Expect = 4e-11 Identities = 45/110 (40%), Positives = 51/110 (46%), Gaps = 17/110 (15%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGY-----PPP----GYPP 177 Q++ +P P + Q PP G P GYP YG++ PPP Y PPP G PP Sbjct: 150 QYQQYPPQYPPNVPYYQPPPYGYPQYPGYPQPPYGQQP-PPPAYGQQNPPPPQNHYGAPP 208 Query: 178 QGYPPQGYPPP-------GYPPQGY-PPPPYSAQGYPPQYAPQYAQPPPP 303 PP G PP G PP GY PPPP PP P Y PPPP Sbjct: 209 TYPPPYGQAPPPPPGQPYGQPPPGYMPPPPAPVPNQPP---PGYKPPPPP 255 Score = 65.5 bits (158), Expect = 2e-09 Identities = 44/105 (41%), Positives = 46/105 (43%), Gaps = 5/105 (4%) Frame = +1 Query: 4 RGKASN*QHRGHPTTPPMSYYNQQQPPVGTP---PPQGYPPEG--YGKEGYPPPGYPPPG 168 RG H PP +QQQP G PPQ YPP Y Y P YP Sbjct: 125 RGNGRRNDHNNRYNQPP----SQQQPQYGQYQQYPPQ-YPPNVPYYQPPPYGYPQYPGYP 179 Query: 169 YPPQGYPPQGYPPPGYPPQGYPPPPYSAQGYPPQYAPQYAQPPPP 303 PP G P PPP Y Q PPPP + G PP Y P Y Q PPP Sbjct: 180 QPPYGQQP---PPPAYGQQN-PPPPQNHYGAPPTYPPPYGQAPPP 220 [245][TOP] >UniRef100_A2ED38 Putative uncharacterized protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2ED38_TRIVA Length = 415 Score = 77.4 bits (189), Expect = 5e-13 Identities = 51/122 (41%), Positives = 55/122 (45%), Gaps = 27/122 (22%) Frame = +1 Query: 19 N*QHRGHPTTPPM-----SYYNQQQPPVGTPPPQGYPP------EGYGKEGYPPPGYPPP 165 N H P PP Y PP PPP GYPP + YG++ PPP PP Sbjct: 261 NNNHYNQPPPPPQYGQYPQYPYPYMPPYNQPPPYGYPPYPYPRPQAYGQQ--PPP--PPQ 316 Query: 166 GY---PPQGY--PPQGYPPPGY------PPQGY---PPPPYSA--QGYPPQYAPQYAQPP 297 GY PPQ + P YPPP Y PPQGY PPP Y Q PP PQ PP Sbjct: 317 GYGQQPPQNHYGAPPAYPPPAYGQPPPPPPQGYGQQPPPSYMPPPQAVPPAPQPQQQTPP 376 Query: 298 PP 303 PP Sbjct: 377 PP 378 Score = 72.4 bits (176), Expect = 1e-11 Identities = 49/112 (43%), Positives = 53/112 (47%), Gaps = 24/112 (21%) Frame = +1 Query: 37 HPTTPPMSYYNQQQPPVGTPP-----PQGY------PPEGYGKE----------GYPPPG 153 +P PP YNQ PP G PP PQ Y PP+GYG++ YPPP Sbjct: 282 YPYMPP---YNQP-PPYGYPPYPYPRPQAYGQQPPPPPQGYGQQPPQNHYGAPPAYPPPA 337 Query: 154 Y-PPPGYPPQGYPPQGYPPPGY--PPQGYPPPPYSAQGYPPQYAPQYAQPPP 300 Y PP PPQGY Q PPP Y PPQ PP P Q PP P A PP Sbjct: 338 YGQPPPPPPQGYGQQ--PPPSYMPPPQAVPPAPQPQQQTPPPPPPPPAPAPP 387 Score = 68.9 bits (167), Expect = 2e-10 Identities = 46/99 (46%), Positives = 51/99 (51%), Gaps = 7/99 (7%) Frame = +1 Query: 28 HRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPP-GYPPQGYP-PQGY 201 +RG ++YNQ PP P G P+ Y PP PPP GYPP YP PQ Y Sbjct: 253 NRGRRNDHNNNHYNQPPPP----PQYGQYPQ-YPYPYMPPYNQPPPYGYPPYPYPRPQAY 307 Query: 202 ---PPPGYPPQGY-PPPPYSAQGYPPQYAPQ-YAQPPPP 303 PPP PPQGY PP + G PP Y P Y QPPPP Sbjct: 308 GQQPPP--PPQGYGQQPPQNHYGAPPAYPPPAYGQPPPP 344 Score = 60.8 bits (146), Expect = 4e-08 Identities = 35/85 (41%), Positives = 42/85 (49%), Gaps = 6/85 (7%) Frame = +1 Query: 31 RGHPTTPPMSYYNQQQ----PPVGTPPPQGYPPEGYGKEGYPPPGY--PPPGYPPQGYPP 192 +G+ PP ++Y P G PPP PP+GYG++ PPP Y PP PP P Sbjct: 316 QGYGQQPPQNHYGAPPAYPPPAYGQPPPP--PPQGYGQQ--PPPSYMPPPQAVPPAPQPQ 371 Query: 193 QGYPPPGYPPQGYPPPPYSAQGYPP 267 Q PPP PP P PP A PP Sbjct: 372 QQTPPPPPPPPA-PAPPQPAAPQPP 395 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPPPG-YPPQGYPPQGYPPP 210 G P PP Y QQ PP PPPQ PP ++ PPP PPP PPQ PQ PP Sbjct: 339 GQPPPPPPQGYGQQPPPSYMPPPQAVPPAPQPQQQTPPPPPPPPAPAPPQPAAPQ---PP 395 Query: 211 GYP 219 P Sbjct: 396 SEP 398 Score = 53.5 bits (127), Expect = 7e-06 Identities = 38/92 (41%), Positives = 39/92 (42%), Gaps = 17/92 (18%) Frame = +1 Query: 25 QHRGHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPP-GY---PPPGY--PPQGY 186 Q G PP Y QQ P P YPP YG+ PPP GY PPP Y PPQ Sbjct: 305 QAYGQQPPPPPQGYGQQPPQNHYGAPPAYPPPAYGQPPPPPPQGYGQQPPPSYMPPPQAV 364 Query: 187 PP------QGYPPPGYPPQGYP-----PPPYS 249 PP Q PPP PP P P P S Sbjct: 365 PPAPQPQQQTPPPPPPPPAPAPPQPAAPQPPS 396 [246][TOP] >UniRef100_A1D201 Putative uncharacterized protein n=1 Tax=Neosartorya fischeri NRRL 181 RepID=A1D201_NEOFI Length = 117 Score = 77.4 bits (189), Expect = 5e-13 Identities = 51/121 (42%), Positives = 55/121 (45%), Gaps = 6/121 (4%) Frame = +1 Query: 55 MSYYNQQQPPVGTPPPQGYPPEGYGKEGY-PPPGYPPPGYPPQG--YPPQGYPPP---GY 216 MSY PP P P + YG G PPPG Y QG YPPQ Y PP GY Sbjct: 1 MSYNKPDGPPPSYPAPV-HDAGPYGHPGSPPPPGGANQDYYNQGGYYPPQNYGPPPQQGY 59 Query: 217 PPQGYPPPPYSAQGYPPQYAPQYAQPPPPHHHNNSNNSSSPGCLEGCCAALCCCCLLDAC 396 G PPPP YPPQ PQ Q ++ + SS G G AAL CCC LD Sbjct: 60 GGYGSPPPPGQPMYYPPQGYPQQQQ---GYYPEDRGGSSGGGICAGIMAALACCCCLDIL 116 Query: 397 F 399 F Sbjct: 117 F 117 [247][TOP] >UniRef100_A4T8V9 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4T8V9_MYCGI Length = 235 Score = 77.0 bits (188), Expect = 6e-13 Identities = 41/85 (48%), Positives = 44/85 (51%), Gaps = 6/85 (7%) Frame = +1 Query: 37 HPTTPPMSYY---NQQQPPVGTPPPQGYPPEG-YGKEGYPPP--GYPPPGYPPQGYPPQG 198 H TPP +Y + P GTPP GYP G + YPPP GY YPP GY QG Sbjct: 50 HGYTPPPAYNPPPSSTPPMYGTPPNTGYPAPGDFTSPPYPPPPAGYGAQNYPPPGYGAQG 109 Query: 199 YPPPGYPPQGYPPPPYSAQGYPPQY 273 Y GY PQGY Y AQGYP Y Sbjct: 110 YGAQGYGPQGYGAQSYGAQGYPSPY 134 Score = 63.2 bits (152), Expect = 9e-09 Identities = 38/84 (45%), Positives = 41/84 (48%), Gaps = 9/84 (10%) Frame = +1 Query: 46 TPPMSYY----NQQQPPVGTPPP----QGYPPEGYGKEGYPPPGYPPPGYPPQGYPPQGY 201 TPP + Y + PP PP Q YPP GYG +GY GY P GY Q Y QGY Sbjct: 71 TPPNTGYPAPGDFTSPPYPPPPAGYGAQNYPPPGYGAQGYGAQGYGPQGYGAQSYGAQGY 130 Query: 202 PPP-GYPPQGYPPPPYSAQGYPPQ 270 P P G P GYP Y G P Q Sbjct: 131 PSPYGAYPGGYPGADY-GYGTPAQ 153 [248][TOP] >UniRef100_C0PCD9 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PCD9_MAIZE Length = 239 Score = 77.0 bits (188), Expect = 6e-13 Identities = 57/123 (46%), Positives = 61/123 (49%), Gaps = 33/123 (26%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEG-YPPP--------GYPPPGYPPQGY 186 G+P+ P Y PP PP QGYPP GY + G YPPP GYPPPG QGY Sbjct: 102 GYPSPPGQGY-----PP---PPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPG---QGY 150 Query: 187 PP-QG--YPPPG-YPPQGYPPP---PYSAQG--------YPPQ---------YAPQYAQP 294 P QG YPPPG YPPQG PP Y AQG YP Q Y Q + P Sbjct: 151 PQGQGGAYPPPGSYPPQGSYPPAEGSYPAQGSYHPAQGSYPAQGSYSPAQGSYPAQGSYP 210 Query: 295 PPP 303 PPP Sbjct: 211 PPP 213 Score = 63.9 bits (154), Expect = 5e-09 Identities = 45/101 (44%), Positives = 51/101 (50%), Gaps = 17/101 (16%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPE-GYGKEGYPPPGYPPPGYPPQGYPP---QGYPPPGY 216 PP+ ++ P+ PPP GY P+ YG+ P GYP P P QGYPP QGYPP GY Sbjct: 72 PPVQQMSRIDQPM--PPPAGYAPQPAYGQ---PYGGYPSP--PGQGYPPPPGQGYPPAGY 124 Query: 217 --------PPQGYP-----PPPYSAQGYPPQYAPQYAQPPP 300 P QGYP PPP QGYP Y PPP Sbjct: 125 SQGGAYPPPAQGYPHGGGYPPP--GQGYPQGQGGAY--PPP 161 Score = 60.8 bits (146), Expect = 4e-08 Identities = 53/127 (41%), Positives = 57/127 (44%), Gaps = 38/127 (29%) Frame = +1 Query: 31 RGHPTTPPMSY----YNQ----QQPPVGTPPPQGYPPEGYGKE-----GYPPPG-YPPPG 168 +G+P P Y Y+Q P G P GYPP G G YPPPG YPP G Sbjct: 109 QGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPGQGYPQGQGGAYPPPGSYPPQG 168 Query: 169 -YPPQ--GYPPQG--------YPPPG--------YPPQG-YPPPPYSAQG-YPP---QYA 276 YPP YP QG YP G YP QG YPPPP AQG YPP Y Sbjct: 169 SYPPAEGSYPAQGSYHPAQGSYPAQGSYSPAQGSYPAQGSYPPPP--AQGSYPPAQGSYP 226 Query: 277 PQYAQPP 297 Q + PP Sbjct: 227 AQGSYPP 233 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/89 (42%), Positives = 44/89 (49%), Gaps = 5/89 (5%) Frame = +1 Query: 91 TPPPQGYPP-EGYGKEGYPPPGYPPPGYPPQ---GYPPQGYPPPGYPPQGYPPPPYSAQG 258 +P P PP + + P P PP GY PQ G P GYP P P QGYPPPP QG Sbjct: 65 SPQPMAVPPVQQMSRIDQPMP--PPAGYAPQPAYGQPYGGYPSP--PGQGYPPPP--GQG 118 Query: 259 YPPQ-YAPQYAQPPPPHHHNNSNNSSSPG 342 YPP Y+ A PPP + + PG Sbjct: 119 YPPAGYSQGGAYPPPAQGYPHGGGYPPPG 147 [249][TOP] >UniRef100_C0HFT3 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0HFT3_MAIZE Length = 357 Score = 77.0 bits (188), Expect = 6e-13 Identities = 57/123 (46%), Positives = 61/123 (49%), Gaps = 33/123 (26%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEG-YPPP--------GYPPPGYPPQGY 186 G+P+ P Y PP PP QGYPP GY + G YPPP GYPPPG QGY Sbjct: 220 GYPSPPGQGY-----PP---PPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPG---QGY 268 Query: 187 PP-QG--YPPPG-YPPQGYPPP---PYSAQG--------YPPQ---------YAPQYAQP 294 P QG YPPPG YPPQG PP Y AQG YP Q Y Q + P Sbjct: 269 PQGQGGAYPPPGSYPPQGSYPPAEGSYPAQGSYHPAQGSYPAQGSYSPAQGSYPAQGSYP 328 Query: 295 PPP 303 PPP Sbjct: 329 PPP 331 Score = 63.9 bits (154), Expect = 5e-09 Identities = 45/101 (44%), Positives = 51/101 (50%), Gaps = 17/101 (16%) Frame = +1 Query: 49 PPMSYYNQQQPPVGTPPPQGYPPE-GYGKEGYPPPGYPPPGYPPQGYPP---QGYPPPGY 216 PP+ ++ P+ PPP GY P+ YG+ P GYP P P QGYPP QGYPP GY Sbjct: 190 PPVQQMSRIDQPM--PPPAGYAPQPAYGQ---PYGGYPSP--PGQGYPPPPGQGYPPAGY 242 Query: 217 --------PPQGYP-----PPPYSAQGYPPQYAPQYAQPPP 300 P QGYP PPP QGYP Y PPP Sbjct: 243 SQGGAYPPPAQGYPHGGGYPPP--GQGYPQGQGGAY--PPP 279 Score = 60.8 bits (146), Expect = 4e-08 Identities = 53/127 (41%), Positives = 57/127 (44%), Gaps = 38/127 (29%) Frame = +1 Query: 31 RGHPTTPPMSY----YNQ----QQPPVGTPPPQGYPPEGYGKE-----GYPPPG-YPPPG 168 +G+P P Y Y+Q P G P GYPP G G YPPPG YPP G Sbjct: 227 QGYPPPPGQGYPPAGYSQGGAYPPPAQGYPHGGGYPPPGQGYPQGQGGAYPPPGSYPPQG 286 Query: 169 -YPPQ--GYPPQG--------YPPPG--------YPPQG-YPPPPYSAQG-YPP---QYA 276 YPP YP QG YP G YP QG YPPPP AQG YPP Y Sbjct: 287 SYPPAEGSYPAQGSYHPAQGSYPAQGSYSPAQGSYPAQGSYPPPP--AQGSYPPAQGSYP 344 Query: 277 PQYAQPP 297 Q + PP Sbjct: 345 AQGSYPP 351 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/89 (42%), Positives = 44/89 (49%), Gaps = 5/89 (5%) Frame = +1 Query: 91 TPPPQGYPP-EGYGKEGYPPPGYPPPGYPPQ---GYPPQGYPPPGYPPQGYPPPPYSAQG 258 +P P PP + + P P PP GY PQ G P GYP P P QGYPPPP QG Sbjct: 183 SPQPMAVPPVQQMSRIDQPMP--PPAGYAPQPAYGQPYGGYPSP--PGQGYPPPP--GQG 236 Query: 259 YPPQ-YAPQYAQPPPPHHHNNSNNSSSPG 342 YPP Y+ A PPP + + PG Sbjct: 237 YPPAGYSQGGAYPPPAQGYPHGGGYPPPG 265 [250][TOP] >UniRef100_Q55CL4 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q55CL4_DICDI Length = 125 Score = 77.0 bits (188), Expect = 6e-13 Identities = 45/77 (58%), Positives = 47/77 (61%), Gaps = 9/77 (11%) Frame = +1 Query: 106 GYP---PEGYGKEGYPPP-GYPPP-GYPPQGYPP-QGYPPPGYPPQ-GYPPPPYSAQGYP 264 GYP P GY ++GYPP GYPP GYPPQGYPP QGYPP GYPPQ GYP P GYP Sbjct: 3 GYPNQYPHGYPQQGYPPQQGYPPQQGYPPQGYPPQQGYPPQGYPPQPGYPMQP----GYP 58 Query: 265 --PQYAPQYAQPPPPHH 309 P Q P HH Sbjct: 59 MQPGVVVQPNMYPQGHH 75 Score = 73.9 bits (180), Expect = 5e-12 Identities = 40/72 (55%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Frame = +1 Query: 34 GHPTTPPMSYYNQQQPPVGTPPPQGYPPEGYGKEGYPPPGYPP-PGYPPQGYPPQGYPPP 210 G+P P Y P G PP QGYPP+ +GYPP GYPP GYPPQGYPPQ P Sbjct: 3 GYPNQYPHGY-----PQQGYPPQQGYPPQ----QGYPPQGYPPQQGYPPQGYPPQ----P 49 Query: 211 GYPPQ-GYPPPP 243 GYP Q GYP P Sbjct: 50 GYPMQPGYPMQP 61 Score = 53.9 bits (128), Expect = 5e-06 Identities = 32/64 (50%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = +1 Query: 49 PPMSYYNQQQ--PPVGTPPPQGYPPEGYGKEGYPPPGYP-PPGYPPQGYPPQGYPPPGYP 219 PP Y QQ PP G PP QGYPP+GY P PGYP PGYP Q P P Sbjct: 18 PPQQGYPPQQGYPPQGYPPQQGYPPQGYP----PQPGYPMQPGYPMQ---PGVVVQPNMY 70 Query: 220 PQGY 231 PQG+ Sbjct: 71 PQGH 74