[UP]
[1][TOP] >UniRef100_C3PP34 Actin polymerization protein RickA n=1 Tax=Rickettsia africae ESF-5 RepID=C3PP34_RICAE Length = 500 Score = 82.4 bits (202), Expect = 1e-14 Identities = 34/51 (66%), Positives = 37/51 (72%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDT 28 NNIP SPPPPPPPPPPPPPPP PPPPPPPPP+AP L+ +E T Sbjct: 329 NNIPP---SPPPPPPPPPPPPPPPSPPPPPPPPPMAPAQAETLSKPVESTT 376 [2][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 78.6 bits (192), Expect = 2e-13 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQFVFL 13 PPPPPPPPPPPPPPPPPPPPPPPPPL P +++ + + F+F+ Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPLRTQFFLLFLFI 119 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 LPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [3][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 77.4 bits (189), Expect = 5e-13 Identities = 30/43 (69%), Positives = 32/43 (74%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 PPPPPPPPPPPPPPPPPPPPPPPPP H S+ L E+ Q Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQ 545 Score = 77.0 bits (188), Expect = 6e-13 Identities = 34/52 (65%), Positives = 36/52 (69%) Frame = -3 Query: 225 KIEGEE*IFVILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 KI E I V LV ++ P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 470 KIGWEHCIDVQLVFSHLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 [4][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 77.0 bits (188), Expect = 6e-13 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++VD + S PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 639 LVVDDVAVRSVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 680 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 681 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 656 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 657 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 Score = 72.4 bits (176), Expect = 1e-11 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 + V + P PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 644 VAVRSVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPPPPPP LA Sbjct: 662 PPPPPPPPPPPPPPPPPPPPPPPDVLA 688 [5][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 77.0 bits (188), Expect = 6e-13 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 ++L+ NN + PPPPPPPPPPPPPPPPPPPP PPPP PK Sbjct: 31 ILLLTLNNKAEAAPPPPPPPPPPPPPPPPPPPPPPTPPPPPLPK 74 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/33 (78%), Positives = 27/33 (81%), Gaps = 4/33 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPP----PPLAPK 67 PPPPPPPPPPPPPPPPP PPPPP PP+ PK Sbjct: 49 PPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPK 81 [6][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 77.0 bits (188), Expect = 6e-13 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 ++L+ NN + PPPPPPPPPPPPPPPPPPPP PPPP PK Sbjct: 31 ILLLTLNNKAEAAPPPPPPPPPPPPPPPPPPPPPPTPPPPPLPK 74 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/33 (78%), Positives = 27/33 (81%), Gaps = 4/33 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPP----PPLAPK 67 PPPPPPPPPPPPPPPPP PPPPP PP+ PK Sbjct: 49 PPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDPK 81 [7][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 77.0 bits (188), Expect = 6e-13 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 T+++PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 TAVNPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 N P PPPPPPPPPPPPPPPPPPPPPPPPP+ Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPI 75 Score = 73.9 bits (180), Expect = 5e-12 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 PPPPPPPPPPPPPPPPPPPPPPPPP P L+ S Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIKLIAS 80 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 71.6 bits (174), Expect = 3e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PEVTAVNPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 69.7 bits (169), Expect = 1e-10 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 N P PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP P PPPPPPPPPPPPPPPPPP P Sbjct: 29 IPKKDWKPEVTAVNPPPPPPPPPPPPPPPPPPPPP 63 [8][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 76.6 bits (187), Expect = 8e-13 Identities = 29/41 (70%), Positives = 29/41 (70%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L T P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1402 LTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 72.0 bits (175), Expect = 2e-11 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPP PP AP Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 70.9 bits (172), Expect = 4e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP PPP P Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPP PPP PPPPPP P +S Sbjct: 1426 PPPPPPPPPPPPPPTPPPAPPPPPPPPPPISS 1457 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP PPP P Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP PPP PP P Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP PPP PPP P Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPP PPPP P Sbjct: 1424 PPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 67.0 bits (162), Expect = 6e-10 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 5/32 (15%) Frame = -3 Query: 153 PPPPPPPPPPPPPPP-----PPPPPPPPPPLA 73 PPPPPPPPPPPPPPP PPPPPPPPPP++ Sbjct: 1425 PPPPPPPPPPPPPPPTPPPAPPPPPPPPPPIS 1456 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 D N++ T PPPPPPPPPPPPPPPPPPPPP P Sbjct: 1394 DGNDVGLTLTPTGTAPPPPPPPPPPPPPPPPPPPPPPPP 1432 [9][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 76.6 bits (187), Expect = 8e-13 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++ +DT + ST +PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 LLFLDTP-VASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + T P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 VASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 74.3 bits (181), Expect = 4e-12 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQFVFLLPRA 1 PPPPPPPPPPPPPPPPPPPPPPPPP P + + + V + PR+ Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDAVEVAPRS 82 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 [10][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 76.6 bits (187), Expect = 8e-13 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 PPPPPPPPPPPPPPPPPPPPPPPPP P++N + Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEV 37 Score = 75.5 bits (184), Expect = 2e-12 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPPPPPPPP P N+ Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPENN 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 [11][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 76.3 bits (186), Expect = 1e-12 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+T PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 74.7 bits (182), Expect = 3e-12 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP AP Sbjct: 938 PPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 935 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 939 PPPPPPPPPPPPPPPPPPPPPPPPGAPP 966 Score = 68.2 bits (165), Expect = 3e-10 Identities = 26/30 (86%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPP--PPPLAP 70 PPPPPPPPPPPPPPPPPPPPPP PPP P Sbjct: 941 PPPPPPPPPPPPPPPPPPPPPPGAPPPPPP 970 Score = 67.8 bits (164), Expect = 4e-10 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 845 PMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPP 878 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/30 (86%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPP--PPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP PPPPPP L P Sbjct: 945 PPPPPPPPPPPPPPPPPPGAPPPPPPALPP 974 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 N P+ + P PPPPPPPPPPPPPPPPPPPP P Sbjct: 840 NYEPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPP 876 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 P T+ + PPPPPPPPPPPPPPP PPPP P Sbjct: 116 PETTPTTPPPPPPPPPPPPPPPQPPPPEP 144 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPPPPP PP AP Sbjct: 950 PPPPPPPPPPPPPGAPPPPPPALPPGAP 977 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 6/34 (17%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP------PPPPPLAP 70 PPPPPPPPPPPP PPPPPP PPPPP P Sbjct: 951 PPPPPPPPPPPPGAPPPPPPALPPGAPPPPPALP 984 Score = 60.1 bits (144), Expect = 8e-08 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 +P PPPPPPPPPPPPPPP PPPP P Sbjct: 119 TPTTPPPPPPPPPPPPPPPQPPPPEP 144 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = -3 Query: 174 IPSTSISPPP-----PPPPPPPPPPPPPPPPPPPPPPLAP 70 + S + P P P PPPPPPPPPPPPPPPPPPP P Sbjct: 836 VGSDNYEPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPP 875 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 144 PPPPPPPPPPPPPPPPPPPPPPLAPKH 64 P PPPPPPPPPPPPPPP PPP P + Sbjct: 120 PTTPPPPPPPPPPPPPPPQPPPPEPDY 146 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPP 79 I P P PPPPPPPPPPPPPPP PP Sbjct: 114 ICPETTPTTPPPPPPPPPPPPPPPQPP 140 [12][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 76.3 bits (186), Expect = 1e-12 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPPL P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 233 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 73.2 bits (178), Expect = 9e-12 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 PPPPPPPPPPPPPPP PPPPPPPPPL P SL Sbjct: 257 PPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSL 289 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 225 VPPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 65.9 bits (159), Expect = 1e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPP PPPPP P Sbjct: 263 PPPPPPPPPLPPPPPPPPPLPPPPPSLP 290 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/38 (57%), Positives = 26/38 (68%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + +P+ + PPP PPPPPPPPPPPPPPPPP P Sbjct: 216 STTLPTAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPPP 253 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPP PPPPPPPPP PPPPP PL Sbjct: 266 PPPPPPLPPPPPPPPPLPPPPPSLPL 291 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 T+ T++ PPP PPPPPPPPPPPPPPPP P Sbjct: 215 TSTTLPTAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPP 252 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 PPPP PPPPPPPPP PPPPP P PL ++ + TQ Sbjct: 268 PPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPPSTSQPTQ 310 [13][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 76.3 bits (186), Expect = 1e-12 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 PPPPPPPPPPPPPPPPPPPPPPPPP P LL S + Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNM 56 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PPPPPPPPPPPPPPPPPPPPPPPPPL + S + Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYM 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [14][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 76.3 bits (186), Expect = 1e-12 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSK 43 PPPPPPPPPPPPPPPPPPPPPPPPP P H ++ + Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRR 48 Score = 74.7 bits (182), Expect = 3e-12 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSK 43 PPPPPPPPPPPPPPPPPPPPPPPPP P + L S+ Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSR 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [15][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPPL P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPLLP 454 Score = 72.8 bits (177), Expect = 1e-11 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 T S PPPPPPPPPPPPPPPPPPPPPPP PK +L Sbjct: 140 TQSSQTPPPPPPPPPPPPPPPPPPPPPPPKPPKTQHVL 177 Score = 72.4 bits (176), Expect = 1e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P I PP PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 416 PLPQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 72.4 bits (176), Expect = 1e-11 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPP 79 + PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 424 LPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 72.0 bits (175), Expect = 2e-11 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP L P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPLLPP 455 Score = 70.5 bits (171), Expect = 6e-11 Identities = 28/36 (77%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPP--PPPLAPKHNSLL 52 PPPPPPPPPPPPPPPPPPPPPP PPP P +S L Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPLLPPPPPPSISSFL 465 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 S+ PPPPPPPPPPPPPPPPPPPPPP PP Sbjct: 142 SSQTPPPPPPPPPPPPPPPPPPPPPPPKPP 171 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPP--PPPP 79 +P PPPPPPPPPPPPPPPPPPPPP PPPP Sbjct: 424 LPPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPP 457 Score = 67.0 bits (162), Expect = 6e-10 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 N + + S PPPPPPPPPPPPPPPPPPPPPP P + K++ Sbjct: 134 NQMQQQTQSSQTPPPPPPPPPPPPPPPPPPPPPPPKPPKTQHVLKKVQ 181 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 4/44 (9%) Frame = -3 Query: 171 PSTSISP----PPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PS +P PP PPPPPPPPPPPPPPPPPPPP P LL Sbjct: 410 PSLPFAPLPQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPLL 453 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 PPPPPPPPPPPPPPPPPPP PP K L KL Sbjct: 150 PPPPPPPPPPPPPPPPPPPKPPKTQHVLKKVQNLKPKL 187 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPP 94 ++ P PPPPPPPPPPPPPPPPP PP Sbjct: 142 SSQTPPPPPPPPPPPPPPPPPPPPPPPKPP 171 [16][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 75.9 bits (185), Expect = 1e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P I PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 74.7 bits (182), Expect = 3e-12 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPP 69 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPRPCPP 107 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRPCP 68 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPRPCP 106 Score = 68.2 bits (165), Expect = 3e-10 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP----PPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP PPPPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPARP 113 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPP---PPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP PPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPP---PPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP PPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPRPCPPPPPPPPPPP 78 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPPPPPP---PPPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPPPP 82 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPPPPP---PPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPP 83 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPPPP---PPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP PPPPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPPP---PPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPRPCPPPPPPPPPPPPPPPPPP 85 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPP---PPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPP---PPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPPPPPPPPPP P Sbjct: 57 PPPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPP---PPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPP---PPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 59 PPPPPPRPCPPPPPPPPPPPPPPPPPPPPPP 89 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/37 (75%), Positives = 28/37 (75%), Gaps = 7/37 (18%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPP---PPPPP----PPPLAPKH 64 PPPPPPPPPPPPPPPPP PPPPP PPP PKH Sbjct: 86 PPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKH 122 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P T I+P PPPPPPPPPPPPPPPPPPPP P Sbjct: 12 VPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +P P PPPPPPPPPPPPPPPPP P Sbjct: 10 PKVPYTPIAPERIIPPPPPPPPPPPPPPPPPPPP 43 [17][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +PPPPPPPPPPPPPPPPPPPPPPPPP AP+ Sbjct: 230 APPPPPPPPPPPPPPPPPPPPPPPPPPAPE 259 Score = 73.2 bits (178), Expect = 9e-12 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 T N PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 222 TFNFGGQDAPPPPPPPPPPPPPPPPPPPPPPPPPP 256 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPAPEP 260 Score = 68.9 bits (167), Expect = 2e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPP P AP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPAPEPAP 262 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP P P P P Sbjct: 240 PPPPPPPPPPPPPPPPPAPEPAPCNTGP 267 [18][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPPL P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 75.1 bits (183), Expect = 2e-12 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 240 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 72.0 bits (175), Expect = 2e-11 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PPPPPPPPPPPPPPPPPPPPP PPP +P Sbjct: 675 LPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPPPPPPPPP PPPP P Sbjct: 677 PSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710 Score = 71.6 bits (174), Expect = 3e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + P PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHP 704 Score = 71.6 bits (174), Expect = 3e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 673 PPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 71.2 bits (173), Expect = 3e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPP PPPPPPPPPPPPPPPPPPPP P Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 71.2 bits (173), Expect = 3e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 71.2 bits (173), Expect = 3e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P +P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 70.1 bits (170), Expect = 7e-11 Identities = 27/34 (79%), Positives = 27/34 (79%), Gaps = 4/34 (11%) Frame = -3 Query: 153 PPPPP----PPPPPPPPPPPPPPPPPPPPLAPKH 64 PPPPP PPPPPPPPPPPPPPPPPPPP P H Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPH 703 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPP PP P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPPP PPPL P Sbjct: 687 PPPPPPPPPPPPPPPPHPPPPSPPPLVP 714 Score = 68.2 bits (165), Expect = 3e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPP PPPP PPPPPPPPPPPPPPP P Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPP 258 Score = 68.2 bits (165), Expect = 3e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PP PPPP PPPPPPPPPPPPPPPPP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPP----PPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP PPPP P Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPP----PPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPPPPPPPP P Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPP----PPPPPPPPPPPLAP 70 PPPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPP----PPPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPPPPPPPPPPP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPPPPPPPPPPP----PPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPPPPPPPPP----PPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPPPPPPPPPP P Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 65.1 bits (157), Expect = 2e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPP PPPP PPPPPPPPPPPP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + P PPPPPP PPPP PPPPPPPPPPP P Sbjct: 220 LPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPP 254 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -3 Query: 156 SPPPPPP-PPPPPPPPPPPPPPPPPPPLAP 70 SPPPPPP PP PPPP PPPPPP PPPPL P Sbjct: 213 SPPPPPPLPPSPPPPSPPPPPPSPPPPLPP 242 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +PPPP PPPPPP PP PPPP PPPPP +P Sbjct: 208 NPPPPSPPPPPPLPPSPPPPSPPPPPPSP 236 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPP PPPPPP PP PPPP PPPPPP P Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPP 237 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPPP PPP P P Sbjct: 690 PPPPPPPPPPPPPHPPPPSPPPLVPALP 717 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 6/42 (14%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPP------PPPPPPLAP 70 N P S PPPP PP PPPP PPPPPP PPPPPP P Sbjct: 208 NPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPP 249 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPP PPP P L P Sbjct: 691 PPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ST I PPPP PPPPPP PP PPPP PPP P Sbjct: 202 STVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPP 234 [19][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PPPPPPPPPPPPPPPPPPPPPPPPP P N+++ Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 73 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + PPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 14 VDPPPPHCPPPPPPPPPPPPPPPPPPPPPP 43 [20][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PPPPPPPPPPPPPPPPPPPPPPPPP P N+++ Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 73 Score = 75.1 bits (183), Expect = 2e-12 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 70.1 bits (170), Expect = 7e-11 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPP PPPPPPPPPPPPPPPP P Sbjct: 17 PPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPP 50 Score = 69.3 bits (168), Expect = 1e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPLPPPPPPPPPPPPPPPPPPPP 51 Score = 69.3 bits (168), Expect = 1e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 69.3 bits (168), Expect = 1e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPP 53 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + PPPP PPPPPPPPP PPPPPPPPP P Sbjct: 14 VDPPPPHCPPPPPPPPPLPPPPPPPPPPPP 43 [21][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PPPPPPPPPPPPPPPPPPPPPPPPP P N+++ Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 70 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + PPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 14 VDPPPPHCPPPPPPPPPPPPPPPPPPPPPP 43 [22][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 75.9 bits (185), Expect = 1e-12 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 PS+S SP PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 1531 PSSSSSPSPPPPPPPPPPPPPPPPPPPPPPP 1561 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P +S S P PPPPPPPPPPPPPPPPPPPPPP Sbjct: 1530 PPSSSSSPSPPPPPPPPPPPPPPPPPPPPPP 1560 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 7/46 (15%) Frame = -3 Query: 183 TNNIPSTSISPPPPP-------PPPPPPPPPPPPPPPPPPPPLAPK 67 +N+ P PPPPP PPPPPPPPPPPPPPPPPPPP PK Sbjct: 1517 SNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPPPPPPPPPK 1562 Score = 67.0 bits (162), Expect = 6e-10 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 7/46 (15%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPP-------PPPPPPPPPPPPPLAP 70 D+ + S S S PPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 1509 DSASAGSGSNSSPPPPPPPPPPPSSSSSPSPPPPPPPPPPPPPPPP 1554 [23][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPPL P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 73.6 bits (179), Expect = 7e-12 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 71.6 bits (174), Expect = 3e-11 Identities = 29/39 (74%), Positives = 29/39 (74%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 PPPPPPPPPPPPPPPPPPPPPPPP P S N LE Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLHLE 116 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 PPPPPPPPPPPPPPPPP PPPPPP H L+ L + Q Sbjct: 85 PPPPPPPPPPPPPPPPPLPPPPPPSQENLHLELILGGLVNEPQ 127 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + PP PP PPPPPPPPPPPPPPPPPPP P Sbjct: 54 LPPPLPPAPPPPPPPPPPPPPPPPPPPPPP 83 Score = 63.9 bits (154), Expect = 5e-09 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 I PPP PP PPPPPPPPPPPPPPPPP P Sbjct: 52 IELPPPLPPAPPPPPPPPPPPPPPPPPPPP 81 [24][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +S+ PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 96 SSLQPPPPPPPPPPPPPPPPPPPPPPPPPPPP 127 Score = 72.8 bits (177), Expect = 1e-11 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 + + S PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 93 DGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPPPP 126 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPPPPPP P S Sbjct: 100 PPPPPPPPPPPPPPPPPPPPPPPPPPPPGS 129 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 T N +S PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 87 TRNRNGDGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPP 124 [25][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 75.9 bits (185), Expect = 1e-12 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 T PS++ PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 490 TRGGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 71.6 bits (174), Expect = 3e-11 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 496 STPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 70.9 bits (172), Expect = 4e-11 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPPP P +L + K+ Sbjct: 495 SSTPPPPPPPPPPPPPPPPPPPPPPPPPPPSVTLSSQKM 533 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ST P PPPPPPPPPPPPPPPPPPPPP P Sbjct: 489 STRGGPSSTPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/72 (38%), Positives = 31/72 (43%), Gaps = 29/72 (40%) Frame = -3 Query: 171 PSTSISPPPP-----------------------------PPPPPPPPPPPPPPPPPPPPP 79 P PPP PPPPPPPPPPPPPPPPPPPPP Sbjct: 460 PQKGQKRPPPPPTPPDEESKKNSECSSQDSTRGGPSSTPPPPPPPPPPPPPPPPPPPPPP 519 Query: 78 LAPKHNSLLNSK 43 P + L+S+ Sbjct: 520 PPPPPSVTLSSQ 531 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 PPPPPPPPPPPPPPPPP +A LL+ KL Sbjct: 508 PPPPPPPPPPPPPPPPPSVTLSSQKMAGLRELLLSEKL 545 [26][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 PPPPPPPPPPPPPPPPPPPPPPPPP P H Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 70.5 bits (171), Expect = 6e-11 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 PPPPPPPPPPPPPPPPPPPPPPPP + N+ +E Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPHITKISLPFFNALIE 72 [27][TOP] >UniRef100_B3M2B3 GF17078 n=1 Tax=Drosophila ananassae RepID=B3M2B3_DROAN Length = 599 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPPPPPPPPPPPPPPPPPPP P H+ Sbjct: 157 PPPPPPPPPPPPPPPPPPPPPPPPPHHPHHH 187 Score = 69.7 bits (169), Expect = 1e-10 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPPPPPPP H S Sbjct: 158 PPPPPPPPPPPPPPPPPPPPPPPPHHPHHHPS 189 Score = 63.5 bits (153), Expect = 7e-09 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PPPPPPPPPPPPPPPPPPPPP P P S++ Sbjct: 161 PPPPPPPPPPPPPPPPPPPPPHHPHHHPSPPSVI 194 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P ++ PPPPPPPPPPPPP P P PP P PP +P Sbjct: 235 PPGTVYPPPPPPPPPPPPPYPAPYPPAPYPPPSP 268 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPPPPPP--PPPPPPPPPPPPPPPPPLAP 70 P S+ PP PP PPPPPPPPPPPPP P P P Sbjct: 225 PGMSVPGPPGPPGTVYPPPPPPPPPPPPPYPAPYPP 260 [28][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 75.9 bits (185), Expect = 1e-12 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +L +P+ PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 972 LLPPAEEVPNGLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1013 Score = 72.0 bits (175), Expect = 2e-11 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 990 PPPPPPPPPPPPPPPPPPPPPPPPP 1014 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/53 (52%), Positives = 29/53 (54%), Gaps = 17/53 (32%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPP-----------------PPPPPPPLAPKHNSLLNS 46 PPPPPPPPPPPPPPPPPP PPPPPPP P S +S Sbjct: 994 PPPPPPPPPPPPPPPPPPPPPGFKGIIPSSSGIPLPPPPPPPPGPGFKSASSS 1046 [29][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 75.9 bits (185), Expect = 1e-12 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S++PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 PPPPPPPPPPPPPPPPPPPPPPPPP P + ++ + Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNI 67 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [30][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 75.5 bits (184), Expect = 2e-12 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 P S PPPPPPPPPPPPPPPPPPPPPPPPP N+ L L+ Sbjct: 170 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNARLKIALK 214 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 73.6 bits (179), Expect = 7e-12 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 202 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPP PPPPPPPPPPPPPPPPP P Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 193 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 162 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 195 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 164 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPP PPPPPPPPPPPPPPPPPPPP P Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 70.5 bits (171), Expect = 6e-11 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 161 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPP PPPPPPP PPPPPPPPPPP P Sbjct: 154 PPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPP 187 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPP PPPPPPP PPPPPPPPPPPPP P Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 189 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS P PPPPPPP PPPPPPPPPPPPPPP P Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 67.8 bits (164), Expect = 4e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PP PPPPPPP PPPPPPPPPPPPPP P Sbjct: 157 PPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 190 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPP PPPPPPP PPPPPPPPPPPP P Sbjct: 155 PPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 188 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPP PPPPP PPPPPPP PPPPP P Sbjct: 134 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPP 167 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPP PPPPPPP PPPPP PPPPPPP P Sbjct: 142 PPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPP 175 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPP PPPPP PPPPPPP PPP P Sbjct: 146 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPP 179 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPP PPPPP PPPPPPP PPPPP P Sbjct: 148 PPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPP 181 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPP PPPPP PPPPPPP PPPPPPP P Sbjct: 150 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPP 183 Score = 65.1 bits (157), Expect = 2e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPP PPPPP PPPPPPP PPPP +P Sbjct: 133 PPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSP 166 Score = 65.1 bits (157), Expect = 2e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPP PPPPPPP PPPPP PPPPPP +P Sbjct: 141 PPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSP 174 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP-PPPPPPPPPPPPLAP 70 P PPPPP PPPPPPP PPPPP PPPPPP +P Sbjct: 126 PEPECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSP 160 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPPPPP PPPPP PPPPPPP P Sbjct: 128 PECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPP 161 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPP PPPPP PPPPPPP PPPPPP P Sbjct: 149 PPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPP 182 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPP PPPPP PPPPPPP PPPP P Sbjct: 147 PPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPP 180 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPP PPPPP PPPPPPP PPPPP P P Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPP 169 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS P PPPPPPP PPPPP PPPPPPP P P Sbjct: 144 PSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPP 177 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPP PPPPP PPPPPPP PPPPP P Sbjct: 135 PPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPP 168 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PP PPPPPPP PPPPP PPPPPPP P Sbjct: 143 PPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPP 176 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/30 (76%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 153 PPPPPP--PPPPPPPPPPPPPPPPPPPLAP 70 PPPP P PPPPPP PPPPPPP PPPP +P Sbjct: 123 PPPPEPECPPPPPPSPPPPPPPSPPPPPSP 152 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPP----PPPPPPPPPPPPPPPPPPPPPPLAP 70 PPP PPPPPP PPPPPPP PPPPP P P Sbjct: 124 PPPEPECPPPPPPSPPPPPPPSPPPPPSPPPP 155 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP P PPPPPP PPPPPPP P P Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPP 149 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 6/35 (17%) Frame = -3 Query: 156 SPPP------PPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPP PPPPP P PPPPPP PPPPPP +P Sbjct: 112 SPPPEYEEGCPPPPPEPECPPPPPPSPPPPPPPSP 146 [31][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 75.5 bits (184), Expect = 2e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 378 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 376 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 73.6 bits (179), Expect = 7e-12 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPP PPPP P Sbjct: 353 PCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 386 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PPPPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPPP 387 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP PPPPPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPP 388 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 362 PPPPPPPPPPPPPPPPPSPPPPPPPPPP 389 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPPPPPPP P Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPP 390 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP PPPPPPPPP P Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPPP 391 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPP PPPPPPPPPP P Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPPPPPPPP P Sbjct: 367 PPPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPPPPPPPPP P Sbjct: 369 PPPPPPPPPPSPPPPPPPPPPPPPPPPP 396 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPPPPPPPP P Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 397 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPPPPPPPPP P Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPPPPPP P Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 Score = 66.6 bits (161), Expect = 8e-10 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S +P P PPPPPPPPPPPPPPPPPPPP +P Sbjct: 347 PPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSP 380 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS + P PPPPPPPPPPPPPPPPPPPPP P Sbjct: 349 PSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPP 382 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P +P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPCPASCSP 416 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 6/31 (19%) Frame = -3 Query: 153 PPPP------PPPPPPPPPPPPPPPPPPPPP 79 PPPP P PPPPPPPPPPPPPPPPPPP Sbjct: 346 PPPPSANPCQPCPPPPPPPPPPPPPPPPPPP 376 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ PPP P P PPPPPPPPPPPPPP P Sbjct: 341 PNACCPPPPSANPCQPCPPPPPPPPPPPPPPPPP 374 [32][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PPP +PK L KL Sbjct: 2340 SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2381 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2334 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2370 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PPP P P + PK Sbjct: 2337 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPK 2378 [33][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PPP +PK L KL Sbjct: 1278 SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 1319 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 1272 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 1308 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PPP P P + PK Sbjct: 1275 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPK 1316 [34][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PPP +PK L KL Sbjct: 2340 SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2381 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2334 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2370 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PPP P P + PK Sbjct: 2337 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPK 2378 [35][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 75.5 bits (184), Expect = 2e-12 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 S+ PPPPPPPPPPPPPPPPPPPPPPPPPL Sbjct: 458 SLPPPPPPPPPPPPPPPPPPPPPPPPPPL 486 Score = 73.2 bits (178), Expect = 9e-12 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 IP S PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 452 IPHAGASLPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 67.4 bits (163), Expect = 5e-10 Identities = 32/62 (51%), Positives = 36/62 (58%), Gaps = 11/62 (17%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPP---------PPPPPLAPKHNSL--LNSKLEED 31 ++P PPPPPPPPPPPPPPPPPPPP PPPPL P S S L +D Sbjct: 458 SLPPPPPPPPPPPPPPPPPPPPPPPPPPLDVGEASNLQPPPPLPPPPYSCDPSGSDLPQD 517 Query: 30 TQ 25 T+ Sbjct: 518 TK 519 [36][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PPP +PK L KL Sbjct: 2402 SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2443 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2396 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2432 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PPP P P + PK Sbjct: 2399 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPK 2440 [37][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PPP +PK L KL Sbjct: 2402 SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2443 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2396 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2432 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PPP P P + PK Sbjct: 2399 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPK 2440 [38][TOP] >UniRef100_Q2RTE8 Putative uncharacterized protein n=1 Tax=Rhodospirillum rubrum ATCC 11170 RepID=Q2RTE8_RHORT Length = 208 Score = 75.5 bits (184), Expect = 2e-12 Identities = 36/68 (52%), Positives = 41/68 (60%) Frame = -3 Query: 234 KAEKIEGEE*IFVILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 K E +E E +FV D IP PPPPPPPPPPPPPPPPPPPPP PPP Sbjct: 69 KDEVLELTEDMFV---DDEPIPEPEPEPPPPPPPPPPPPPPPPPPPPPEPPPFV------ 119 Query: 54 LNSKLEED 31 S++E+D Sbjct: 120 --SEIEDD 125 [39][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 75.5 bits (184), Expect = 2e-12 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 T N + PPPPPPPPPPPPPPPPPPPPPPPPP P N+ Sbjct: 216 TYNFGGEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNT 257 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPCNTGP 259 [40][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 75.5 bits (184), Expect = 2e-12 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 +D + + SPPPPPPPPPPPPPPPPPPPPPPPPP P + Sbjct: 367 IDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP + P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 6/34 (17%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP------PPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP PPPPP +P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/33 (72%), Positives = 25/33 (75%), Gaps = 5/33 (15%) Frame = -3 Query: 153 PPPPPPPPPPPPPP-----PPPPPPPPPPPLAP 70 PPPPPPPPPPPPPP PPPPPP PPP + P Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 8/33 (24%) Frame = -3 Query: 153 PPPPPPPPPPP-----PPPPPPPPPP---PPPP 79 PPPPPPPPPPP PPPPPP PPP PPPP Sbjct: 397 PPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 8/33 (24%) Frame = -3 Query: 153 PPPPPPPPPP-----PPPPPPPPPP---PPPPP 79 PPPPPPPPPP PPPPPP PPP PPPPP Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 11/39 (28%) Frame = -3 Query: 153 PPPPP-----PPPPPPPPPP---PPPPPP---PPPPLAP 70 PPPPP PPPPPP PPP PPPPPP PPPP P Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 6/37 (16%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP---PPPPPP---PPPPPPP 79 P + P PPPPPP PPP PPPPPP PPPP PP Sbjct: 405 PPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 12/38 (31%) Frame = -3 Query: 156 SPPPPPPPPPP---PPPPPP---PPPP------PPPPP 79 SPPPPPP PPP PPPPPP PPPP PPPPP Sbjct: 412 SPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 [41][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 75.5 bits (184), Expect = 2e-12 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PPPPPPPPPPPPPPPPPPPPPPPPP P+ + +L Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEIL 50 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 MEPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.6 bits (179), Expect = 7e-12 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPPPPPPPP P S Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 65.9 bits (159), Expect = 1e-09 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P + P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPQPSEILP 51 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPP P AP + + Sbjct: 26 PPPPPPPPPPPPPPPPPPPQPSEILPAPANRA 57 [42][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PPP +PK L KL Sbjct: 2333 SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2327 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PPP P P + PK Sbjct: 2330 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPK 2371 [43][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PPP +PK L KL Sbjct: 2333 SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2327 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PPP P P + PK Sbjct: 2330 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPK 2371 [44][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 75.5 bits (184), Expect = 2e-12 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PPP +PK L KL Sbjct: 2333 SAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2327 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2363 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/42 (59%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PPP P P + PK Sbjct: 2330 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPK 2371 [45][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 75.1 bits (183), Expect = 2e-12 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 I + + PPPPPPP PPPPPPPPPPPPPPPPP P+H+ Sbjct: 2794 ISAVATPPPPPPPPTPPPPPPPPPPPPPPPPPPPPQHS 2831 Score = 73.2 bits (178), Expect = 9e-12 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 S +PPPPPPPP PPPPPPPPPPPPPPPP P +S+ Sbjct: 2795 SAVATPPPPPPPPTPPPPPPPPPPPPPPPPPPPPQHSI 2832 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 ++++ PPPPPPPP PPPPPPPPPPPPPPP P +N Sbjct: 2795 SAVATPPPPPPPPTPPPPPPPPPPPPPPPPPPPPQHSIN 2833 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + +IS PPPPPPPP PPPPPPPPPPPP P Sbjct: 2791 AAAISAVATPPPPPPPPTPPPPPPPPPPPPPPP 2823 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = -3 Query: 228 EKIEGEE*IFVILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPP 94 EK + + V T P +PPPPPPPPPPPPPPPPPPPP Sbjct: 2784 EKAQAAAAAAISAVATPPPPPPPPTPPPPPPPPPPPPPPPPPPPP 2828 [46][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 75.1 bits (183), Expect = 2e-12 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S+ PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [47][TOP] >UniRef100_UPI0000E23E7D PREDICTED: WAS protein homology region 2 domain containing 1 n=1 Tax=Pan troglodytes RepID=UPI0000E23E7D Length = 813 Score = 75.1 bits (183), Expect = 2e-12 Identities = 31/44 (70%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -3 Query: 204 IFVILVD-TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 +FV + D T++ S +S PPPPPPPPPPPPPPPPPPPPPPPPL Sbjct: 620 VFVPVGDQTHSKSSEELSLPPPPPPPPPPPPPPPPPPPPPPPPL 663 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 PPPPPPPPPPPPPPPPPPPPPP L+ + + L Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPLRALSSSSQAATHQNL 678 Score = 62.4 bits (150), Expect = 2e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -3 Query: 141 PPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 138 PPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 PPPPPPPPPPPPPPPPPPPP P +L +S Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPLRALSSS 669 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = -3 Query: 135 PPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDT 28 PPPPPPPPPPPPPPPPPPP P L+S + T Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPLRALSSSSQAAT 674 [48][TOP] >UniRef100_C6XK60 OmpA/MotB domain protein n=1 Tax=Hirschia baltica ATCC 49814 RepID=C6XK60_HIRBI Length = 386 Score = 75.1 bits (183), Expect = 2e-12 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -3 Query: 219 EGEE*IFVILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 EGE ++ N + +PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 212 EGEYREHSVMAGLNFLLGAPAAPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 PPPPPPPPPPPPPPPPPPPPPPPP + ++N Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPETLVEEAPVVN 269 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +P PPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 230 APAAPPPPPPPPPPPPPPPPPPPPPPPPPE 259 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + P PPPPPPPPPPPPPPPPPPPPP P Sbjct: 228 LGAPAAPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 P PPPPPPPPPPPPPPPPPPPP P +L+ Sbjct: 231 PAAPPPPPPPPPPPPPPPPPPPPPPPPPETLV 262 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSK 43 PPPPPPPPPPPPPPPPPPPP AP N + S+ Sbjct: 239 PPPPPPPPPPPPPPPPPPPPETLVEEAPVVNCVAQSQ 275 [49][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 75.1 bits (183), Expect = 2e-12 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP AP Sbjct: 215 PPPPPPPPPPPPPPPPPPPPPPPPPPAP 242 Score = 72.8 bits (177), Expect = 1e-11 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPP 79 + PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 214 VPPPPPPPPPPPPPPPPPPPPPPPPPP 240 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 212 APVPPPPPPPPPPPPPPPPPPPPPPPPPP 240 Score = 69.3 bits (168), Expect = 1e-10 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPAPV 243 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPP 88 +P PPPPPPPPPPPPPPPPPPPP P Sbjct: 214 VPPPPPPPPPPPPPPPPPPPPPPPPPPAP 242 [50][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 P PPPPPPPPPPPPPPPPPPPPPPPPP+ P S+ Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCSV 310 Score = 73.9 bits (180), Expect = 5e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS SPPPPPPPPPPPPPPPPPPPPPPP P P Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P SPPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 72.4 bits (176), Expect = 1e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPPPPPPPPPPPPPPPPPP PPP P Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPPPPPPPP PPPPP P Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 72.0 bits (175), Expect = 2e-11 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 P S PPPPPPPPPPPPPPPPPPPPPPPP + + + +KL+ Sbjct: 273 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCSVCIVAKLQ 317 Score = 71.2 bits (173), Expect = 3e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP PPPPPPPPPPPPPPPPPPPPPP +P Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 70.9 bits (172), Expect = 4e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS SPPPPPPPPPP PPP PPPPPPPPPP P Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P SPPP PPPPPPPPPPPPPPPPPPPPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPP PPPP P Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP PPPPPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPPPPPPP P Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP PPPPPPPPP P Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPP PPPPPPPPPP P Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPPPPPPPP P Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPPPPPPPPP P Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPPPPPPPP P Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPPPPPPPPP P Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPPPPPP P Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPPPPP PPP PPPPPPPPPPPP P Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPP PPP PPPPPPPPPPPPPP P Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 67.8 bits (164), Expect = 4e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 66.2 bits (160), Expect = 1e-09 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPPPPP PPP PPPPPPPPPP PP +P Sbjct: 225 SPPPPPPPSPPPSPPPPPPPPPPSPPPSP 253 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPP PPPPPPPPPP PPP PPPPPP P Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPP 261 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPPPPPPPPP PPP PPPPPPPP P Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPP 263 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 N P + + P PPPPPPP PPP PPPPPPPPPP P Sbjct: 216 NAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPP 251 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPP PPP PPPPPPPPP P Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPP 264 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPP PPPPPPPPPP PPP P Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPP 254 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP PPPPPPPPPP PPP PPPPPPP P Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/36 (69%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPP-PPPPPPPPPPPPPLAP 70 +P+ SP PP PPPPPPP PPP PPPPPPPPP +P Sbjct: 214 LPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSP 249 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPP PPP PPPPPPPPPP PPP PP P Sbjct: 224 PSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPP 257 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PPPP PPP PPPPPPPPPP PPP P P Sbjct: 222 LPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPP 256 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + P P PP PPPPPPP PPP PPPPPP P Sbjct: 212 LPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPP 246 [51][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 75.1 bits (183), Expect = 2e-12 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + L + N S PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 LFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPQWEP 102 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPQWEPADP 105 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/28 (82%), Positives = 23/28 (82%), Gaps = 3/28 (10%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP---PPPPP 79 PPPPPPPPPPPPPPPPPPPP P PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPQWEPADPP 106 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP P PP P Sbjct: 83 PPPPPPPPPPPPPPPPQWEPADPPSKWP 110 [52][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSK 43 PPPPPPPPPPPPPPPPPPPPPPPPP P L+ S+ Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSR 104 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPP PL+ Sbjct: 81 PPPPPPPPPPPPPPPPPPRLVTSRPLS 107 [53][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 75.1 bits (183), Expect = 2e-12 Identities = 29/30 (96%), Positives = 29/30 (96%), Gaps = 1/30 (3%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL-APK 67 PPPPPPPPPPPPPPPPPPPPPPPPPL APK Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPLRAPK 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP P AP Sbjct: 20 PPPPPPPPPPPPPPPPPPPLRAPKGRAP 47 [54][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 75.1 bits (183), Expect = 2e-12 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP PK Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPK 45 Score = 74.7 bits (182), Expect = 3e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPKTPR 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPP P +A Sbjct: 26 PPPPPPPPPPPPPPPPPPPKTPRTTVA 52 [55][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 75.1 bits (183), Expect = 2e-12 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +I T+ P+ ++ PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 60 IIGAKTSRRPAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 T+ PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 74 TTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 114 Score = 73.6 bits (179), Expect = 7e-12 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +++ T P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 71 MMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 70.9 bits (172), Expect = 4e-11 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 90 PPPPPPPPPPPPPPPPPPPPPPPPRRRPR 118 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = -3 Query: 156 SPP---PPPPPPPPPPPPPPPPPPPPPPPLAP 70 +PP PPPPPPPPPPP PP P PPP PP AP Sbjct: 149 APPAAAPPPPPPPPPPPSPPSPQPPPAPPAAP 180 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPPPPPPPPPPPPP P P Sbjct: 95 PPPPPPPPPPPPPPPPPPPRRRPRP 119 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ + PPPPPPPPPPP PP P PPP PP P Sbjct: 148 PAPPAAAPPPPPPPPPPPSPPSPQPPPAPPAAPP 181 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPP-PPPPPPPPPPPPPPPPLAP 70 P+ + PPPPPPPPP PP P PPP PP PPP AP Sbjct: 151 PAAAPPPPPPPPPPPSPPSPQPPPAPPAAPPPAAP 185 [56][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 75.1 bits (183), Expect = 2e-12 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP AP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPAP 68 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 68.2 bits (165), Expect = 3e-10 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPP P + P+ Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPAPYVYPR 73 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP P P P Sbjct: 48 PPPPPPPPPPPPPPPPPPPAPYVYPRRP 75 [57][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 75.1 bits (183), Expect = 2e-12 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 T++ PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 1030 TAVPPPPPPPPPPPPPPPPPPPPPPPPPP 1058 Score = 74.3 bits (181), Expect = 4e-12 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P+ + PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 1027 PAVTAVPPPPPPPPPPPPPPPPPPPPPPPPP 1057 Score = 73.2 bits (178), Expect = 9e-12 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPPPPPPPP++ Sbjct: 1035 PPPPPPPPPPPPPPPPPPPPPPPPPMS 1061 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 69.3 bits (168), Expect = 1e-10 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + + +++ PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1022 DEVSKPAVTAVPPPPPPPPPPPPPPPPPPPPPPPPPP 1058 Score = 69.3 bits (168), Expect = 1e-10 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 6/34 (17%) Frame = -3 Query: 153 PPPPPPPPPPPP------PPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPPPPPPPPP++P Sbjct: 1048 PPPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMSP 1081 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 6/41 (14%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPP------PPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPPP PPPP P Sbjct: 1032 VPPPPPPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPP 1072 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 I PPPPPPPPPPPP P PPPPPPPP AP Sbjct: 1065 IPPPPPPPPPPPPPMSPGMPPPPPPPPGAP 1094 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 11/39 (28%) Frame = -3 Query: 153 PPPPPPPPP------PPPPPPPPPPPPP-----PPPLAP 70 PPPPPPPPP PPPPPPPPPPPPP PPP P Sbjct: 1051 PPPPPPPPPMSAGGIPPPPPPPPPPPPPMSPGMPPPPPP 1089 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP P PPPPPPPP P Sbjct: 1069 PPPPPPPPPPMSPGMPPPPPPPPGAPVP 1096 [58][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 75.1 bits (183), Expect = 2e-12 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 I V N + PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 IFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPP 91 Score = 72.0 bits (175), Expect = 2e-11 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + + + +P PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 IFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPP PPPP P Sbjct: 62 LPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPP PPPPPPPP P+ Sbjct: 73 PPPPPPPPPPPPPPPPSPPPPPPPPPPPQ 101 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP PPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L DT IP T PPP PPPPPPPPPPPPPPP P Sbjct: 40 LSDTPLIPLTIFVGENTGVPPPLPPPPPPPPPPPPPPPPPP 80 [59][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 74.7 bits (182), Expect = 3e-12 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 132 PPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 165 Score = 72.4 bits (176), Expect = 1e-11 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPPPPPP+ Sbjct: 141 PPPPPPPPPPPPPPPPPPPPPPPPPV 166 Score = 71.6 bits (174), Expect = 3e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 131 PPPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 143 PPPPPPPPPPPPPPPPPPPPPPPVVFCP 170 Score = 67.4 bits (163), Expect = 5e-10 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPPP--PPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 124 PPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPP 159 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 10/44 (22%) Frame = -3 Query: 171 PSTSISPPPPPPP----------PPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 115 PPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPP 158 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/44 (61%), Positives = 28/44 (63%), Gaps = 10/44 (22%) Frame = -3 Query: 171 PSTSISPPPPPPPP----------PPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPP PPPPPPPPPPPPPPPPP P Sbjct: 114 PPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPP 157 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 4/32 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPP----PPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPPPP PPP AP Sbjct: 150 PPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAP 181 Score = 65.1 bits (157), Expect = 2e-09 Identities = 25/31 (80%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP---PPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PPPPP P Sbjct: 147 PPPPPPPPPPPPPPPPPPPVVFCPPPPPCPP 177 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPP P PPPPPP PPP AP Sbjct: 188 PPPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAP 221 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/40 (67%), Positives = 27/40 (67%), Gaps = 6/40 (15%) Frame = -3 Query: 171 PSTSISPPP---PPPPPPPP---PPPPPPPPPPPPPPLAP 70 P PPP PPPPPPPP PPPPPPPPPPPP PL P Sbjct: 171 PPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPP 210 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 11/42 (26%) Frame = -3 Query: 171 PSTSISPPPPP--------PPPPPPPP---PPPPPPPPPPPP 79 P PPPPP PPPPPPPP PPPPPPPPPPPP Sbjct: 164 PPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPPP 205 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 6/40 (15%) Frame = -3 Query: 171 PSTSISPPPPPPPPP--PPPPPPPPPPP----PPPPPLAP 70 P + PPPPPPPP PPPPPPPPPPP PPPPP P Sbjct: 177 PPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPPCP 216 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 10/44 (22%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP-----PPPPPPP-----PPPPPPPLAP 70 P + PPPPPPPPPPP PPPP PP PPPPPPP P Sbjct: 189 PPMCLPPPPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPPPPACP 232 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPP---PPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPP PPPP PPPP P PPPPPPPP+ P Sbjct: 94 PPQPACPPPPPGCGPPPPCPPPPAPCPPPPPPPPVCP 130 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 10/44 (22%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPP----------PPPPPPPPPPPLAP 70 P PPP P PPPPPPPP PPPPPPPPPPP P Sbjct: 108 PPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPP 151 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -3 Query: 171 PSTSISPPPPPPPPP---PPPPPPPP---PPPPPPPPLAP 70 P PPPP PPPP PPPPPPPP PPPPPPPP P Sbjct: 165 PVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPPPP 204 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/34 (67%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPP--PPPPPL 76 P PPPP PPPP P PPPPPPPP PPPPP+ Sbjct: 102 PPPGCGPPPPCPPPPAPCPPPPPPPPVCPPPPPM 135 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 7/35 (20%) Frame = -3 Query: 153 PPPPPPPPPP----PPPPPPPPPP---PPPPPLAP 70 PPPPPPPPPP PPPPP PPPP PPPPP P Sbjct: 156 PPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPP 190 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP---PPPPPPPP---PPPPPPLAP 70 P + PPPPP PPPP PPPPPPPP PPPPPP P Sbjct: 163 PPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPPP 202 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/48 (50%), Positives = 24/48 (50%), Gaps = 21/48 (43%) Frame = -3 Query: 150 PPPPPPPPP---------------------PPPPPPPPPPPPPPPLAP 70 PPPP PPPP PPPPPPPPPPPPPPP P Sbjct: 108 PPPPCPPPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPP 155 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 16/44 (36%) Frame = -3 Query: 153 PPPPPPPP----------PPPP---PPPPPPPP---PPPPPLAP 70 PPPPPPPP PPPP PPPPPPPP PPPPP P Sbjct: 158 PPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPPPPPP 201 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 P + PPPPP PPPP P PPPPPPP P P+ Sbjct: 204 PPCPLPPPPPPCPPPPAPCPPPPPPPACPAPM 235 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPP PPPP P PPPPPPP AP Sbjct: 207 PLPPPPPPCPPPPAPCPPPPPPPACPAP 234 [60][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 74.7 bits (182), Expect = 3e-12 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 N + + +PPP PPPPPPPPPPPPPPPPPPPPP AP+ L Sbjct: 1999 NTVSAPLQAPPPTPPPPPPPPPPPPPPPPPPPPPSAPQQVQL 2040 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 V + +T + P + P PPPPPPPPPPPPPPPPPPPPP Sbjct: 1995 VKIPNTVSAPLQAPPPTPPPPPPPPPPPPPPPPPPPPP 2032 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP+T +P PPP PPPPPPPPPPPPPPPPP P Sbjct: 1997 IPNTVSAPLQAPPPTPPPPPPPPPPPPPPPPPPPP 2031 [61][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 74.7 bits (182), Expect = 3e-12 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 305 SPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 72.4 bits (176), Expect = 1e-11 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPPPPPPPP A Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPA 337 Score = 72.0 bits (175), Expect = 2e-11 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S + PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 302 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 [62][TOP] >UniRef100_B4RDQ2 OmpA family protein n=1 Tax=Phenylobacterium zucineum HLK1 RepID=B4RDQ2_PHEZH Length = 410 Score = 74.7 bits (182), Expect = 3e-12 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S + PPPPPPPPPPPPPPPPPPPPPPPP AP + + Sbjct: 267 SFAAPPPPPPPPPPPPPPPPPPPPPPPPPAPAYEA 301 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S + PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 267 SFAAPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPP P K Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPAPAYEAK 302 [63][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 74.7 bits (182), Expect = 3e-12 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 467 SPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPPPPPPPP P S Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPVETS 502 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 72.8 bits (177), Expect = 1e-11 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDT 28 PPPPPPPPPPPPPPPPPPPPPPPPP+ +L D+ Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPVETSPKIVLAGTTANDS 515 Score = 70.9 bits (172), Expect = 4e-11 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 D + P PPPPPPPPPPPPPPPPPPPPPPP +PK Sbjct: 465 DASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVETSPK 504 [64][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 74.7 bits (182), Expect = 3e-12 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 258 SPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPPPPPPPP P + + Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPAYEA 292 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 72.0 bits (175), Expect = 2e-11 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S + PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 255 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 [65][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 74.7 bits (182), Expect = 3e-12 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 76 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 74.3 bits (181), Expect = 4e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 91 PPPPPPPPPPPPPPPPPPPPPPPPPTCP 118 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 75 VIPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 66.2 bits (160), Expect = 1e-09 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPP P K Sbjct: 94 PPPPPPPPPPPPPPPPPPPPPPTCPCCEK 122 [66][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 74.7 bits (182), Expect = 3e-12 Identities = 31/45 (68%), Positives = 31/45 (68%) Frame = -3 Query: 204 IFVILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 I VIL P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 66 IEVILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +I ++ P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 63 IIRIEVILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 73.9 bits (180), Expect = 5e-12 Identities = 31/50 (62%), Positives = 33/50 (66%) Frame = -3 Query: 219 EGEE*IFVILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +G + I I V P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 58 KGRDIIIRIEVILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 90 PPPPPPPPPPPPPPPPPPPPPPPPPPVP 117 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [67][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 74.7 bits (182), Expect = 3e-12 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 + + + +PPPPPPPPPPPPPPPPPPPPPPPPP P L+ S Sbjct: 38 VTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVKLIAS 80 Score = 70.5 bits (171), Expect = 6e-11 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 N P PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 42 NPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PEVTAVNPAPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP P P PPPPPPPPPPPPPPPP P Sbjct: 29 IPKKDWKPEVTAVNPAPPPPPPPPPPPPPPPPPPP 63 [68][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 74.7 bits (182), Expect = 3e-12 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 PPPPPPPPPPPPPPPPPPPPPPPPP P+ L Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHL 111 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 [69][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 74.7 bits (182), Expect = 3e-12 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P+ PPPPPPPPPPPPPPPPPPPPPPPPP A Sbjct: 347 PAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPA 379 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P + +PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 346 PPAAQAPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP + K Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPASTK 382 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 68.9 bits (167), Expect = 2e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 344 PQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEE 34 PPPPPPPPPPPPPPPPPPPPPPP P +L++ Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPASTKPPQALSFAKRLQQ 395 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PP PP PPPPPPPPPPPPPPPP P Sbjct: 343 PPQPPAAQAPPPPPPPPPPPPPPPPPPP 370 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP PP PPPPPPPPPPPPPP P Sbjct: 341 PRPPQPPAAQAPPPPPPPPPPPPPPPPP 368 [70][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 74.3 bits (181), Expect = 4e-12 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 ++++ +++ PPPPPPPPPPPPPPPPPPPPP PPP +PK Sbjct: 2337 SSSVDASAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPK 2375 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2337 SSSVDASAQPPPPPPPPPPPPPPPPPPPPPPLPPPTS 2373 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/33 (75%), Positives = 26/33 (78%), Gaps = 4/33 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPP----PPLAPK 67 PPPPPPPPPPPPPPPPPPP PPP P + PK Sbjct: 2349 PPPPPPPPPPPPPPPPPPPLPPPTSPKPAVHPK 2381 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 PPPPPPPPPPPPPPPPPP PPP P H Sbjct: 2350 PPPPPPPPPPPPPPPPPPLPPPTSPKPAVH 2379 [71][TOP] >UniRef100_UPI0000EE3DB8 zinc finger homeodomain 4 n=1 Tax=Homo sapiens RepID=UPI0000EE3DB8 Length = 3571 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 N ST + PPP PPPPPPPPPPPPPPPPPPPP AP Sbjct: 1984 NTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 N + + +PPP PPPPPPPPPPPPPPPPPPPP P+ Sbjct: 1984 NTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQ 2021 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP+T +P PPP PPPPPPPPPPPPPPPPP P Sbjct: 1982 IPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPP 2016 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 V + +T + P + P PPPPPPPPPPPPPPPPPPPP P Sbjct: 1980 VKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PP P Sbjct: 1998 PPPPPPPPPPPPPPPPPPPSAPPQVQLP 2025 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P+ PPPPPPPPPPPPPPPP PP P++ Sbjct: 1995 PTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVS 2027 [72][TOP] >UniRef100_UPI00004576BB Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Homo sapiens RepID=UPI00004576BB Length = 3567 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 N ST + PPP PPPPPPPPPPPPPPPPPPPP AP Sbjct: 1984 NTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 N + + +PPP PPPPPPPPPPPPPPPPPPPP P+ Sbjct: 1984 NTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQ 2021 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP+T +P PPP PPPPPPPPPPPPPPPPP P Sbjct: 1982 IPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPP 2016 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 V + +T + P + P PPPPPPPPPPPPPPPPPPPP P Sbjct: 1980 VKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PP P Sbjct: 1998 PPPPPPPPPPPPPPPPPPPSAPPQVQLP 2025 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P+ PPPPPPPPPPPPPPPP PP P++ Sbjct: 1995 PTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVS 2027 [73][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 74.3 bits (181), Expect = 4e-12 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + + +PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 225 LDAAGFAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 74.3 bits (181), Expect = 4e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPFQP 264 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPFQPPR 266 [74][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 74.3 bits (181), Expect = 4e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 224 PPPPPPPPPPPPPPPPPPPPPPPPPTTP 251 Score = 72.4 bits (176), Expect = 1e-11 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 +PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 221 APPPPPPPPPPPPPPPPPPPPPPPPP 246 Score = 72.0 bits (175), Expect = 2e-11 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 223 PPPPPPPPPPPPPPPPPPPPPPPPP 247 Score = 70.5 bits (171), Expect = 6e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 T N + PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 215 TYNFGAAPPPPPPPPPPPPPPPPPPPPPPPPPPP 248 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPP 248 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 144 PPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 PPPPPPPPPPPPPPPPPPPPPP P + N+ Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPPTTPCNT 254 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP P P Sbjct: 229 PPPPPPPPPPPPPPPPPPPPTTPCNTGP 256 [75][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 D P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 317 DVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPE 364 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPEPPPQ 368 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPP PP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPEPPPQP 369 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP PPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPEPPPQPDP 371 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PPP P P Sbjct: 345 PPPPPPPPPPPPPPPPPPPEPPPQPDPP 372 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (5%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL--APKHNSL 55 PPPPPPPPPPPPPPPP PPP P PP+ AP NS+ Sbjct: 348 PPPPPPPPPPPPPPPPEPPPQPDPPVTTAPGSNSV 382 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPP P Sbjct: 315 TPDVEQPPPPPPPPPPPPPPPPPPPPPPP 343 [76][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S +SPPPPPPPPPPPPPPPPPP PPPPPP +P Sbjct: 481 SGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSP 513 Score = 72.4 bits (176), Expect = 1e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 503 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPP PPPPPPPPPPPPPPPPP P Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPP 514 Score = 70.5 bits (171), Expect = 6e-11 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 69.3 bits (168), Expect = 1e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPP P P+ P Sbjct: 508 PPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPP 515 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP PPPPPPP P P Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPP 516 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPP PPPPPPP PP P Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPPPPPP PPP P Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPPP PPPP P Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP PPPPPPP PPPPP P Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPP PPPPPP P Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPP PPPPPPP P Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPP PPPPPPPP P Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPP PPPPPPPPP P Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPP PPPPPPPPPP P Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPP P P P + P+ Sbjct: 518 PPPPPPPPPPPPPPPPPGPSPITPSVRPE 546 [77][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 PPPPPPPPPPPPPPPPPPPPPPPPP P L Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDL 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 4/34 (11%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL----APKH 64 PPPPPPPPPPPPPPPPPPPPP L AP+H Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPTQEDLAGGNAPQH 43 [78][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPPP P+ S Sbjct: 28 PPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLS 59 [79][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 PPPPPPPPPPPPPPPPPPPPPPPPP P L N Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCN 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [80][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 74.3 bits (181), Expect = 4e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 122 PPPPPPPPPPPPPPPPPPPPPPPPPPTPR 150 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + +PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 114 PIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 147 Score = 71.6 bits (174), Expect = 3e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +P PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 112 PPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 69.3 bits (168), Expect = 1e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P I P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPP 144 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = -3 Query: 156 SPPPPPPPPP---PPPPPPPPPPPPPPPPLAP 70 S PP PPPP P PPPPPPPPPPPPPP P Sbjct: 105 SHAPPDPPPPIFTPAPPPPPPPPPPPPPPPPP 136 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S +PP PPPP P PPPPPPPPPPPPP P Sbjct: 105 SHAPPDPPPPIFTPAPPPPPPPPPPPPPPPP 135 [81][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 T PPPPPPPPPPPPPPPPPPPPPPPPPL Sbjct: 117 TPAPPPPPPPPPPPPPPPPPPPPPPPPPPL 146 Score = 72.8 bits (177), Expect = 1e-11 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P + +PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 114 PIFTPAPPPPPPPPPPPPPPPPPPPPPPPPP 144 Score = 71.6 bits (174), Expect = 3e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +P PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 112 PPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPP 145 Score = 69.3 bits (168), Expect = 1e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P I P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPP 144 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 3/40 (7%) Frame = -3 Query: 153 PPPP---PPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSK 43 PPPP P PPPPPPPPPPPPPPPPPPP P L ++ Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPLFTTR 150 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = -3 Query: 156 SPPPPPPPPP---PPPPPPPPPPPPPPPPLAP 70 S PP PPPP P PPPPPPPPPPPPPP P Sbjct: 105 SHAPPDPPPPIFTPAPPPPPPPPPPPPPPPPP 136 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S +PP PPPP P PPPPPPPPPPPPP P Sbjct: 105 SHAPPDPPPPIFTPAPPPPPPPPPPPPPPPP 135 [82][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP S PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 833 IPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 867 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 S+ PPPPPPPPPPPPPPPPPPPPPPPPP A Sbjct: 839 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPA 868 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPPPPP L Sbjct: 844 PPPPPPPPPPPPPPPPPPPPPPPPAL 869 Score = 69.7 bits (169), Expect = 1e-10 Identities = 33/64 (51%), Positives = 37/64 (57%), Gaps = 13/64 (20%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP-----------PPPPLAPKHNSL--LNSKLE 37 ++P PPPPPPPPPPPPPPPPPPPPP PPPPL P S S L Sbjct: 839 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLP 898 Query: 36 EDTQ 25 +DT+ Sbjct: 899 QDTK 902 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++ + + P S P PPPPPPPPPPPPPPPPPP P Sbjct: 821 VIASPSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPP 861 [83][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP S PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 911 IPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 S+ PPPPPPPPPPPPPPPPPPPPPPPPP A Sbjct: 917 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPA 946 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPPPPP L Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPAL 947 Score = 69.7 bits (169), Expect = 1e-10 Identities = 33/64 (51%), Positives = 37/64 (57%), Gaps = 13/64 (20%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP-----------PPPPLAPKHNSL--LNSKLE 37 ++P PPPPPPPPPPPPPPPPPPPPP PPPPL P S S L Sbjct: 917 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLP 976 Query: 36 EDTQ 25 +DT+ Sbjct: 977 QDTK 980 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++ + + P S P PPPPPPPPPPPPPPPPPP P Sbjct: 899 VIASPSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPP 939 [84][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP S PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 911 IPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 74.3 bits (181), Expect = 4e-12 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 S+ PPPPPPPPPPPPPPPPPPPPPPPPP A Sbjct: 917 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPA 946 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPPPPP L Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPAL 947 Score = 69.7 bits (169), Expect = 1e-10 Identities = 33/64 (51%), Positives = 37/64 (57%), Gaps = 13/64 (20%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP-----------PPPPLAPKHNSL--LNSKLE 37 ++P PPPPPPPPPPPPPPPPPPPPP PPPPL P S S L Sbjct: 917 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDPSGSDLP 976 Query: 36 EDTQ 25 +DT+ Sbjct: 977 QDTK 980 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++ + + P S P PPPPPPPPPPPPPPPPPP P Sbjct: 899 VIASPSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPP 939 [85][TOP] >UniRef100_Q86UP3 Zinc finger homeobox protein 4 n=1 Tax=Homo sapiens RepID=ZFHX4_HUMAN Length = 3567 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 N ST + PPP PPPPPPPPPPPPPPPPPPPP AP Sbjct: 1984 NTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 N + + +PPP PPPPPPPPPPPPPPPPPPPP P+ Sbjct: 1984 NTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQ 2021 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP+T +P PPP PPPPPPPPPPPPPPPPP P Sbjct: 1982 IPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPP 2016 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 V + +T + P + P PPPPPPPPPPPPPPPPPPPP P Sbjct: 1980 VKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAP 2019 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PP P Sbjct: 1998 PPPPPPPPPPPPPPPPPPPSAPPQVQLP 2025 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P+ PPPPPPPPPPPPPPPP PP P++ Sbjct: 1995 PTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVS 2027 [86][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 1478 PPPPPPPPPPPPPPPPPPPPPPPPPPLPR 1506 Score = 73.6 bits (179), Expect = 7e-12 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 +T +P PPPPPPPPPPPPPPPPPPPPPPP P P+ + + ++ Q Sbjct: 1470 ETPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPRTPRGGKRKHKQQQQQQQ 1523 [87][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPAKP 273 Score = 72.8 bits (177), Expect = 1e-11 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 +PPPPPPPPPPPPPPPPPPPPPPPPP A Sbjct: 244 APPPPPPPPPPPPPPPPPPPPPPPPPPA 271 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 P+ PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 242 PAAPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 242 PAAPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPPPPP P A Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPAKPAA 275 [88][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 73.9 bits (180), Expect = 5e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S SPPPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 219 PVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 252 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + S S PPPPPPPPPPPPPPP PPPPPPPPP P Sbjct: 220 VASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 254 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 70.9 bits (172), Expect = 4e-11 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPPPPPP +P Sbjct: 235 PPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPPPPPPPP P Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPPPPPPPPP P Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPPPPPPPP P Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPPPPPPPPP PPPP P P Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPP PPPPPPPPPPPPPPPPPP P P N Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPPPSPN 268 Score = 67.4 bits (163), Expect = 5e-10 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP---PPPPLAP 70 P S PPPPPPPPPPPPPPPP PPPP PPPP P Sbjct: 239 PPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGP 275 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPP PPPP P PPPP +P N+ Sbjct: 250 PPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNN 281 [89][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 73.9 bits (180), Expect = 5e-12 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 52 APPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 81 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPQQP 83 Score = 72.8 bits (177), Expect = 1e-11 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 P + PPPPPPPPPPPPPPPPPPPPPPPP P L Sbjct: 46 PICCVPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQPL 84 Score = 71.2 bits (173), Expect = 3e-11 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 +P+ PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 50 VPAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPQQPLP 85 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP P P P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPQQPLPGNP 88 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP P P P P Sbjct: 64 PPPPPPPPPPPPPPPPPQQPLPGNPGPP 91 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/45 (51%), Positives = 23/45 (51%), Gaps = 21/45 (46%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPP---------------------PPPPP 82 PPPPPPPPPPPPPPPPPPP PP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPQQPLPGNPGPPGRPGPAGPPGPPGPP 106 [90][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 73.9 bits (180), Expect = 5e-12 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 T PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 266 TGPGPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 72.4 bits (176), Expect = 1e-11 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 70.9 bits (172), Expect = 4e-11 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP + P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPFILP 303 Score = 69.7 bits (169), Expect = 1e-10 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P I+ P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 261 PFQEITGPGPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 67.8 bits (164), Expect = 4e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP L P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPFILPP 304 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 6/34 (17%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPP---PPP---PPPLAP 70 PPPPPPPPPPPPPPPPPPP PPP PPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPFILPPPFILPPPFIP 314 [91][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 73.9 bits (180), Expect = 5e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S SPPPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 73.9 bits (180), Expect = 5e-12 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS S PPPPPPPPPPPPPPP PPPPPPPPP P Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 258 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 71.2 bits (173), Expect = 3e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPP PPPPPPPP P Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 70.9 bits (172), Expect = 4e-11 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPPPPPP +P Sbjct: 270 PPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPPPPPPPP P Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 68.2 bits (165), Expect = 3e-10 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPP PPPPPPPPPPPPPPPPPP P P+ Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPPR 301 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPPPPPPPPPPP +P Sbjct: 272 PPPPPSPPPPPPPPPPPPPPPPPPSPSP 299 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPP P PPPPPPPPPPPPPPPPP P Sbjct: 246 PSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPP 279 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 3/32 (9%) Frame = -3 Query: 156 SPPPP---PPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPP PPPPPPPPPPPPPPPPP PPP P Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPP 283 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/37 (72%), Positives = 28/37 (75%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPP---PPPPPPPPPPPPPPPPLAP 70 PS SP PP PPPP PPPPPPPPPPPPPPPP +P Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSP 278 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP P PPPPPPPPPPPPPPPPP P P Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPP 281 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPP P PP P Sbjct: 276 PSPPPPPPPPPPPPPPPPPPSPSPPRKP 303 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/41 (63%), Positives = 27/41 (65%), Gaps = 7/41 (17%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPP-------PPPPPPPLAP 70 P SPPPPPPPPPPPPPPPPPP PP P PP+ P Sbjct: 272 PPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPP 312 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -3 Query: 171 PSTSISPPPPPP------PPPPPPPPPPPPPPPPPPPLAP 70 P+ S PP PPP PPPP P PPPPPPPPPPPP P Sbjct: 235 PTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPP 274 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/46 (54%), Positives = 26/46 (56%), Gaps = 12/46 (26%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPP------------PPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPPP PP PPPP PP + P Sbjct: 276 PSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPPSVLP 321 [92][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 73.6 bits (179), Expect = 7e-12 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S + PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 212 SFAAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 72.4 bits (176), Expect = 1e-11 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPPPPPPPP A Sbjct: 220 PPPPPPPPPPPPPPPPPPPPPPPPPPA 246 [93][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 +PPPPPPPPPPPPPPPPPPPPPPPPP A Sbjct: 63 TPPPPPPPPPPPPPPPPPPPPPPPPPAA 90 Score = 72.4 bits (176), Expect = 1e-11 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 P+ + PPPPPPPPPPPPPPPPPPPPPPPP A K Sbjct: 57 PAQARPTPPPPPPPPPPPPPPPPPPPPPPPPPAAK 91 Score = 70.9 bits (172), Expect = 4e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPAAKP 92 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 V +D + + + P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 46 VTALDNPQSAAPAQARPTPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 67.0 bits (162), Expect = 6e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ PPPPPPPPPPPPPPPPPPPPP P AP Sbjct: 62 PTPPPPPPPPPPPPPPPPPPPPPPPPPAAKPSAP 95 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 7/35 (20%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPP-------PPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PP P P+ P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPAAKPSAPPAPAPVTP 103 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 LV + P ++ P PPPPPPPPPPPPPPPPPPP P Sbjct: 45 LVTALDNPQSAAPAQARPTPPPPPPPPPPPPPPPPPPPPPP 85 [94][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 73.6 bits (179), Expect = 7e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 83 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPPPPP L Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPQL 84 [95][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 73.6 bits (179), Expect = 7e-12 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPPPPPPPPPPP P S Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 [96][TOP] >UniRef100_UPI0000E1F767 PREDICTED: formin-like 2 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F767 Length = 994 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 S++PP PPPPPPPPPPPPPPPPPPPPPPL Sbjct: 448 SVTPPMPPPPPPPPPPPPPPPPPPPPPPL 476 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 443 LPVVASVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 477 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 9/37 (24%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPP---------PPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 491 [97][TOP] >UniRef100_UPI0000E1F766 PREDICTED: formin-like 2 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E1F766 Length = 1026 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 S++PP PPPPPPPPPPPPPPPPPPPPPPL Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPL 527 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 494 LPVVASVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 528 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 9/37 (24%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPP---------PPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 542 [98][TOP] >UniRef100_UPI0000E1F765 PREDICTED: formin-like 2 isoform 7 n=1 Tax=Pan troglodytes RepID=UPI0000E1F765 Length = 1045 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 S++PP PPPPPPPPPPPPPPPPPPPPPPL Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPL 527 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 494 LPVVASVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 528 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 9/37 (24%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPP---------PPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 542 [99][TOP] >UniRef100_UPI0000E1F763 PREDICTED: formin-like 2 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F763 Length = 1037 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 S++PP PPPPPPPPPPPPPPPPPPPPPPL Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPL 527 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 494 LPVVASVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 528 Score = 67.0 bits (162), Expect = 6e-10 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 9/37 (24%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPP---------PPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 542 [100][TOP] >UniRef100_UPI0001A2D80C UPI0001A2D80C related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D80C Length = 815 Score = 73.2 bits (178), Expect = 9e-12 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 11/47 (23%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPP-----------PPPPPPLAP 70 N PS ++ PPPPPPPPPPPPPPPPPPP PPPPPP AP Sbjct: 277 NGPSAALPPPPPPPPPPPPPPPPPPPPPGHSIEISAPLPPPPPPCAP 323 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 6/53 (11%) Frame = -3 Query: 180 NNIPSTSISPPPPP------PPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 +++ + S+ PP P PPPPPPPPPPPPPPPPPPPP P H+ +++ L Sbjct: 264 SSVSTVSLFPPVPNGPSAALPPPPPPPPPPPPPPPPPPPP--PGHSIEISAPL 314 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/51 (50%), Positives = 28/51 (54%), Gaps = 21/51 (41%) Frame = -3 Query: 159 ISPPPPPPPPPP------------PP---------PPPPPPPPPPPPPLAP 70 ++PPPPPPPPPP PP PPPPPPPPPPPPP P Sbjct: 249 VTPPPPPPPPPPMTDSSVSTVSLFPPVPNGPSAALPPPPPPPPPPPPPPPP 299 [101][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 73.2 bits (178), Expect = 9e-12 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [102][TOP] >UniRef100_C9S8M2 Cytokinesis protein sepA n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S8M2_9PEZI Length = 842 Score = 73.2 bits (178), Expect = 9e-12 Identities = 32/56 (57%), Positives = 35/56 (62%), Gaps = 10/56 (17%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPP----------PPPPPPPPPPPPLAPKHNSLLN 49 DT I TS +PPPPPPPPPPPPP PPPPPPPPPPPP P +L+ Sbjct: 153 DTPKIEVTSAAPPPPPPPPPPPPPMPGQGGAPPPPPPPPPPPPPPPPPPPMPGMLS 208 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 10/38 (26%) Frame = -3 Query: 153 PPPPPPPPPPPPPP----------PPPPPPPPPPPLAP 70 PPPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 189 PPPPPPPPPPPPPPMPGMLSPGGGPPPPPPPPPPPPMP 226 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 10/38 (26%) Frame = -3 Query: 153 PPPPPPPPPPP----------PPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP PPPPPPPPPPPP P AP Sbjct: 192 PPPPPPPPPPPMPGMLSPGGGPPPPPPPPPPPPMPGAP 229 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 17/45 (37%) Frame = -3 Query: 153 PPPPPPP----------PPPPPPPPPPPP-------PPPPPPLAP 70 PPPPPPP PPPPPPPPPPPP PPPPPP P Sbjct: 196 PPPPPPPMPGMLSPGGGPPPPPPPPPPPPMPGAPGMPPPPPPPMP 240 [103][TOP] >UniRef100_Q2NNS2 1629capsid n=1 Tax=Hyphantria cunea nucleopolyhedrovirus RepID=Q2NNS2_NPVHC Length = 539 Score = 72.8 bits (177), Expect = 1e-11 Identities = 34/56 (60%), Positives = 39/56 (69%), Gaps = 4/56 (7%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPP--PPPPPPPPPPPLA--PKHNSLLNSKLEE 34 +DTN P + PPPP PPPPPPPP PPPPPPPPPPPL+ P N LLN+ + E Sbjct: 235 IDTNVPPPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPPLSLPPIDNLLLNAIVSE 290 [104][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 72.8 bits (177), Expect = 1e-11 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPPPPPPPPPL P Sbjct: 255 PPPPPPPPPPSPPPPPPPPPPPPPPLLP 282 Score = 72.4 bits (176), Expect = 1e-11 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 P + PPPPPPPPPPPPPPPPP PPPPPPP P LL Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLL 281 Score = 70.5 bits (171), Expect = 6e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS S PPPPP PPPPPPPPPPPPPPPPPP P Sbjct: 235 PSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPP 268 Score = 70.1 bits (170), Expect = 7e-11 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S S SP PPPPP PPPPPPPPPPPPPPPPP +P Sbjct: 234 SPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSP 266 Score = 68.9 bits (167), Expect = 2e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPPPPPPP L P Sbjct: 256 PPPPPPPPPSPPPPPPPPPPPPPPLLPP 283 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +S SP P PPPPP PPPPPPPPPPPPPPP P Sbjct: 231 PPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPP 264 Score = 65.1 bits (157), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPPP PPL P Sbjct: 259 PPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISP--PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS S P P P P PPPPP PPPPPPPPPPPP P Sbjct: 226 PSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPP 261 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPP--PPPPPPPPPPPLAP 70 P SPPPPPPPPPPPPPP PP PP P PP++P Sbjct: 260 PPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPP PPPPPPPPPPPPPP PP PP K Sbjct: 262 PPPSPPPPPPPPPPPPPPLLPPLPPFPAK 290 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P ++ SPP P P P PPPPP PPPPPPPPP P Sbjct: 225 PPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPP 258 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S S PP P P P PPPPP PPPPPPPP P Sbjct: 224 PPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPP 257 [105][TOP] >UniRef100_UPI0001926BC7 PREDICTED: similar to mini-collagen isoform 3 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC7 Length = 148 Score = 72.4 bits (176), Expect = 1e-11 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 +P + PPPPPPPPPPPPPPPPPPPPPPP PL Sbjct: 44 LPICCVPPPPPPPPPPPPPPPPPPPPPPPPLPL 76 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPLP 75 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P P P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPLPLPGNP 80 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPPPPPPPPPPPP P P P P Sbjct: 49 VPPPPPPPPPPPPPPPPPPPPPPPPLPLPGNPGPP 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP P P P PP P Sbjct: 59 PPPPPPPPPPPPPPPLPLPGNPGPPGRP 86 [106][TOP] >UniRef100_UPI0000E1F764 PREDICTED: formin-like 2 isoform 6 n=1 Tax=Pan troglodytes RepID=UPI0000E1F764 Length = 1032 Score = 72.4 bits (176), Expect = 1e-11 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPL-APKHNSLLNSKLEEDTQFVFLLP 7 ++PP PPPPPPPPPPPPPPPPPPPPPPL P + + K+++ + F +P Sbjct: 516 VTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETGPSVKIKKPIKTKFRMP 567 Score = 70.5 bits (171), Expect = 6e-11 Identities = 31/57 (54%), Positives = 35/57 (61%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQF 22 +V N P T PPPPPPPPPPPPPPPPPPPPPP P A + + K T+F Sbjct: 508 VVAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETGPSVKIKKPIKTKF 564 Score = 63.2 bits (152), Expect = 9e-09 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 V+ V + PPPPPPPPPPPPPPPPPPPP P P Sbjct: 508 VVAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGP 546 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/43 (51%), Positives = 27/43 (62%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 V+ T ++ S ++ P PP PPPPPPPPPPPPPPP P Sbjct: 496 VVASGTLSMGSEVVAVQNGPVTPPMPPPPPPPPPPPPPPPPPP 538 [107][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 72.4 bits (176), Expect = 1e-11 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 +PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 233 APPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 72.0 bits (175), Expect = 2e-11 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 71.2 bits (173), Expect = 3e-11 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S + P PPPPPPPPPPPPPPPPPPPPPPP P+ + Sbjct: 227 SFAAPPAPPPPPPPPPPPPPPPPPPPPPPPPPPEETT 263 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 4/43 (9%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPP----PPLAPKHNSL 55 P PPPPPPPPPPPPPPPPPPPPPPP PPLA + ++L Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPEETTPPLAQQCSAL 273 [108][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 72.4 bits (176), Expect = 1e-11 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPPPPP PPPPPPPPPPPPPPPPP +P Sbjct: 258 SPPPPPPPSPPPPPPPPPPPPPPPPPPSP 286 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + + P PPPPPPP PPPPPPPPPPPPPPP P Sbjct: 251 PPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 284 Score = 68.9 bits (167), Expect = 2e-10 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PPPP PPPPPPPPPPPPPPPPPP P P Sbjct: 255 LPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 289 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPPPPPPPPP P PPPP P Sbjct: 261 PPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPELP 294 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PPPPPPP PPPPPPPPPPPPPP P Sbjct: 250 PPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPP 283 Score = 67.0 bits (162), Expect = 6e-10 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPP P PPPP L P Sbjct: 262 PPPPSPPPPPPPPPPPPPPPPPPSPSPPPPELPP 295 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/32 (78%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = -3 Query: 156 SPPPP---PPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPP PP PPPPPPP PPPPPPPPPP P Sbjct: 248 SPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPP 279 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPPP P PPPP PP P Sbjct: 265 PSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQP 298 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ PPP P PP PPPPPPP PPPPPPPP P Sbjct: 244 PAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPP 277 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S +PP PPPP P PP PPPPPPP PPPP P Sbjct: 240 PPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPP 273 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS + PPPP P PP PPPPPPP PPPPPP P Sbjct: 242 PSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPP 275 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 14/48 (29%) Frame = -3 Query: 171 PSTSISPPPPPP--------------PPPPPPPPPPPPPPPPPPPLAP 70 P + PPPP P PPPPPPP PPPPPPPPPPP P Sbjct: 233 PPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPP 280 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/52 (50%), Positives = 26/52 (50%), Gaps = 21/52 (40%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPP---------------------PPPPPPPPP 79 P S PPPPPPPPPPPPPPPP PPPP PPPP Sbjct: 263 PPPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKRPPPPAPPPP 314 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP P PPPP PP P+ P Sbjct: 274 PPPPPPPPPPPSPSPPPPELPPAQPVTP 301 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 16/47 (34%) Frame = -3 Query: 162 SISPPPPPPPPPP----------------PPPPPPPPPPPPPPPLAP 70 S PP P PPPPP PPPPPPP PPPPPPP P Sbjct: 230 SPQPPSPSPPPPPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPP 276 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS P PP P PPPPP P PP PPPP PL P Sbjct: 224 PSPQPPSPQPPSPSPPPPPSPAPPSPPPPSPLPP 257 [109][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 72.4 bits (176), Expect = 1e-11 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 +PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 41 APPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 144 PPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 PPPPPPPPPPPPPPPPPPPPPP PK S K+ Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPKKTSDTKKKI 76 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSK 43 PPPPPPPPPPPPPPPPPPPPPPP + ++ K Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPKKTSDTKKKIVYKK 80 [110][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 72.4 bits (176), Expect = 1e-11 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 +PPPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 145 APPPPPPPPPPPPPPPPPPPPPPPPP 170 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP L P Sbjct: 148 PPPPPPPPPPPPPPPPPPPPPPPTTLEP 175 Score = 68.9 bits (167), Expect = 2e-10 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 P PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPP 168 Score = 67.4 bits (163), Expect = 5e-10 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPP 170 Score = 67.0 bits (162), Expect = 6e-10 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 4/35 (11%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP----PPPP 79 P+ PPPPPPPPPPPPPPPPPPPPP PPPP Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPPTTLEPPPP 178 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 4/29 (13%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP----PPPPP 79 PPPPPPPPPPPPPPPPPPPP PPPPP Sbjct: 151 PPPPPPPPPPPPPPPPPPPPTTLEPPPPP 179 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 4/29 (13%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPP----PPPPPP 79 PPPPPPPPPPPPPPPPPPP PPPPPP Sbjct: 152 PPPPPPPPPPPPPPPPPPPTTLEPPPPPP 180 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 144 PPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 P PPPPPPPPPPPPPPPPPPPP P +L Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPPTTL 173 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 8/32 (25%) Frame = -3 Query: 153 PPPPPPPPPPPPP----PPPPPP----PPPPP 82 PPPPPPPPPPPPP PPPPPP PPPPP Sbjct: 158 PPPPPPPPPPPPPTTLEPPPPPPTSSEPPPPP 189 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%), Gaps = 4/29 (13%) Frame = -3 Query: 153 PPPPPPPPPP----PPPPPPPPPPPPPPP 79 PPPPPPPPPP PPPPPP PPPPP Sbjct: 161 PPPPPPPPPPTTLEPPPPPPTSSEPPPPP 189 [111][TOP] >UniRef100_Q92H62 Arp2/3 complex-activating protein rickA n=1 Tax=Rickettsia conorii RepID=RICKA_RICCN Length = 517 Score = 72.4 bits (176), Expect = 1e-11 Identities = 33/54 (61%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPP---PPPPPPPPPPPPPPLAPKHNSLLNSKLEEDT 28 NNIPS SPPPPPPPP P P PPPPPPPPPPPP+AP L+ +E T Sbjct: 343 NNIPS---SPPPPPPPPLPENNIPSPPPPPPPPPPPPMAPAQAETLSKPIESTT 393 [112][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 72.0 bits (175), Expect = 2e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140 Score = 71.6 bits (174), Expect = 3e-11 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP-PPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPP PPPPPPPPPPPP +P Sbjct: 91 PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSP 125 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 93 PPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P SPPPPPPPPPPPPP PPPPPPPPPPP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 70.5 bits (171), Expect = 6e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS S PPPPPP PPPPPPPPPPPPPP PPP P Sbjct: 83 PSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPP 116 Score = 70.1 bits (170), Expect = 7e-11 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPP PPPPPPPPPPPP P Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139 Score = 69.3 bits (168), Expect = 1e-10 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPPPP PPPPPPPPPP +P Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SP PPPPPPPP PPPPPPPPPPPPPP P Sbjct: 79 PPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPP 112 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P + PPPPPPP PPPPPPPPPPPPPP PP P Sbjct: 81 LPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPP 115 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPP PPPPPPPPPPPPP P P Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPPPPP PPPPPPPPPPPPP PP P Sbjct: 95 VPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PP PPPPPPPPPPPPP PPPPPPPP P N Sbjct: 108 PPSPPPPPPPPPPPPPSPPPPPPPPPPPPPN 138 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPP PPPPPPPPPPPPP P Sbjct: 108 PPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPP PPPPPPPPPP P P Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPP 153 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPP PPP P Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPP 130 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPP PPPP P Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPP 131 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPPPPPP PPPPP P Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPP 132 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPP PPP P Sbjct: 117 PPPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPP PPPP P Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPPP 145 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPP---PPPLAP 70 P S PPPPPPPPPPP PPPPPPPPPP PPP P Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPP 157 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P + P P PPPPPPPP PPPPPPPPPPPP Sbjct: 77 PQPPLPPSPSPPPPPPPPVPPPPPPPPPPPP 107 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 4/38 (10%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP----PPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPP PP P PPPPPPPP+ P Sbjct: 60 PSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPP 97 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 9/37 (24%) Frame = -3 Query: 153 PPPPPPPP---------PPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPP PPPPPPPP P Sbjct: 70 PPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPP 106 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPP PPPP PPPP PPPP PPPP PL P Sbjct: 261 PPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPP 294 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPPP P PPP PP +P Sbjct: 133 PPPPPNPPPPPPPPPPSPSPPPSPPPSP 160 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP PPPPPPPPPP P PPP PPP P Sbjct: 134 PPPPNPPPPPPPPPPSPSPPPSPPPSPP 161 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 9/52 (17%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPP--PPP-------PPPPPPPPPPPPPPPLAP 70 V LV+T P PP PPP PPP PPPPPPPPPPPP PPL P Sbjct: 32 VALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPP 83 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP PPPP PPPP PPPP PPPPL P Sbjct: 241 PPPPRPPPPAPPPPRPPPPSPPPPLPP 267 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPP---PPPPPPPPPPPPPPPLAP 70 P +PPPPPPPPPP PPP PPP PPP PPP P Sbjct: 133 PPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPP 169 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP PPPP PPPP PPPP PPPPL P Sbjct: 251 PPPPRPPPPSPPPPLPPPPSPPPPLPP 277 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS S P PPP PPP PPP PPP PPP PPP P Sbjct: 148 PSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 181 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPP PPPP PPPP PPPP PPPP P Sbjct: 239 PSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPP 272 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPP-PPPLAP 70 P S PP PPPP PPPP PPPP PPPP PPP +P Sbjct: 237 PPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSP 271 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP-PPPPPPPPPPPPPLAP 70 P S PP PPPP PPPP PPPP PPPP PPP +P Sbjct: 257 PPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSP 291 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPP-PPPPPPPPPPPPPPPPPPLAP 70 P S SPPP PPP PPP PPP PPP PPP PP +P Sbjct: 146 PPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 180 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPP-PPPPPPLAP 70 PS SPPP PPP PPP PPP PPP PPP PP +P Sbjct: 162 PSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSP 196 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP-PPPPPPPPPPPPPPLAP 70 PS SPPP PPP PPP PPP PPP PPP PP +P Sbjct: 170 PSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSP 204 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 PS SPPP PPP PPP PPP PPP PPP P Sbjct: 154 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 184 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 PPPP PPPP PPPP PPPP PPPP P + L Sbjct: 261 PPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPL 292 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SP PPP PPP PPP PPP PPP PPP P Sbjct: 144 PPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPP 177 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPP PPP PPP PPP PPP PPP P Sbjct: 152 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 185 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPP PPP PPP PPP PPP PPP P Sbjct: 156 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPP 189 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPPPPP--PPPPPPPPPPPPPPPPPPLAP 70 PS SPPP PPP PP PPP PPP PPP PPP P Sbjct: 174 PSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPP 209 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P P PPPP PPPP PPPP PPPP PPP +P Sbjct: 248 PPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSP 281 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP PPPP PPPP PPPP PPPP P Sbjct: 256 PPPPSPPPPLPPPPSPPPPLPPPPSPP 282 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S +PP PPPP P PP PPPPP PPP PP P Sbjct: 342 PPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRP 375 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPP---PPPPPPPPPPPPPPPPPPPLAP 70 P+ PPPPPP PPP PPP PPP PPP PPP P Sbjct: 137 PNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPP 173 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPP PPP PPP PPP PPP PPP P Sbjct: 160 PPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPP 193 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPP PPP PPP PPP PPP PPP P Sbjct: 164 PPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPP 197 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPP PPP PPP PPP PPP PPP P Sbjct: 168 PPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPP 201 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PP PPP PPPP PPPP PPPP PPP +P Sbjct: 234 PPFPPPSPPPPRPPPPAPPPPRPPPPSP 261 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPP PPPP PPPP PPPP P P Sbjct: 246 PPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPP 279 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +P PPP PPPP PPPP PPPP P PP P PK Sbjct: 265 LPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPK 300 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 P+ PPP PPPP PPPP P PP PPPP P PK Sbjct: 326 PNPPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPK 360 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPP PPP PPP PPP PPP PPP P P Sbjct: 182 PSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPP 215 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPP PPPP PPPP PPPP P Sbjct: 235 PFPPPSPPPPRPPPPAPPPPRPPPPSPP 262 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP PPPP PPPP PPPP PPPP P Sbjct: 256 PPPPSPPPPLPPPPSPPPPLPPPPSPPP 283 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ PPPP PPPP PPPP P PP PPPP P Sbjct: 304 PNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPP 337 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = -3 Query: 156 SPPPPPPPPP---PPPPPPPPPPPPPPPPLAP 70 +PPPP PPPP PP PPPP PPPP PPP +P Sbjct: 315 NPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSP 346 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = -3 Query: 171 PSTSISPPP--PPPPPPPPPPPPPPPPPPPPPP 79 PS SPPP PP PPP PPP PPP PPP PPP Sbjct: 178 PSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPP 210 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 N P PPPP PPPP P PP PPPP PPPP P Sbjct: 306 NPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPP 342 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPP PPPP P PP PPPP PPPP P P N Sbjct: 317 PPPRPPPPSPNPPRPPPPSPPPPRPPPPSPN 347 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + P PPPP PPPP PPPP P PP PPP +P Sbjct: 303 PPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSP 336 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP P PP PPPP P PP PPPPP P Sbjct: 341 PPPPSPNPPRPPPPSPSPPKPPPPPSPP 368 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/38 (60%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = -3 Query: 171 PSTSISPPPPPPP---PPPPPPPPPPPPPPPPPPLAPK 67 PS SPPP PPP P PPP PPP PPP PPP P+ Sbjct: 150 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPR 187 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = -3 Query: 156 SPPPPPPPPPPP----PPPPPPPPPPPPPPLAP 70 SPPPP PPPP P PPPP P PP PPPP +P Sbjct: 335 SPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSP 367 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PP PP PPP PPPP PPPP PPPP P Sbjct: 224 PPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPP 257 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPP PPPP PPPP P PP P PP +P +N Sbjct: 276 PPPPSPPPPSPPPPSPLPPSPRPPKPSPPNN 306 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 PS SPPP PPP PPP PPP P PP P PP Sbjct: 190 PSPPPSPPPSPPPSPPPRPPPSPNPPSPRPP 220 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/36 (55%), Positives = 22/36 (61%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 P + PPP PPPP PPPP P PP P PP P P + Sbjct: 271 PPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNN 306 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP P PP PPPP PPPP PPPP P Sbjct: 321 PPPPSPNPPRPPPPSPPPPRPPPPSPNP 348 [113][TOP] >UniRef100_A2XDP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XDP2_ORYSI Length = 820 Score = 72.0 bits (175), Expect = 2e-11 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 8/44 (18%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPP--------PPPPPPPPLAPKHNSL 55 S +PPPPPPPPPPPPPPPPP PPPPPPPP P +N+L Sbjct: 346 SNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNL 389 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/44 (56%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -3 Query: 183 TNNIPSTS--ISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 T + P T SP P P P PPPPPPPPPPPPPP PK N+ Sbjct: 326 TGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNT 369 [114][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 72.0 bits (175), Expect = 2e-11 Identities = 31/56 (55%), Positives = 33/56 (58%), Gaps = 7/56 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP-------PPPPLAPKHNSLLNSKLEEDTQ 25 P SPPPPPPPPPPPPPPPPPPPPP PPPP P + S L+ Q Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETPSQSQPQQSLLQPQPQ 102 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 153 PPPPPPP--PPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPP PPPPPPPPPPPPPPPPPP P+ Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPE 74 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPP 69 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPPPPPPPP P Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 7/41 (17%) Frame = -3 Query: 171 PSTSISPPPPPPPPP---PPPPPPPP----PPPPPPPPLAP 70 P T PPPPPPPPP PPPPPPPP PPPPPP PL P Sbjct: 1945 PPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTPLMP 1985 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = -3 Query: 165 TSISPP------PPPPPPPPPPPPPPPPPPPPPPPLAP 70 TS +PP PPPPPPPPPP PPPPPPPPP AP Sbjct: 1938 TSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAP 1975 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/37 (59%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPP---PPPPPPLAP 70 P+ + + PP PP PPPPPPPPPP PPPPPP P Sbjct: 1935 PTITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPP 1971 [115][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 72.0 bits (175), Expect = 2e-11 Identities = 31/56 (55%), Positives = 33/56 (58%), Gaps = 7/56 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP-------PPPPLAPKHNSLLNSKLEEDTQ 25 P SPPPPPPPPPPPPPPPPPPPPP PPPP P + S L+ Q Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETPSQSQPQQSLLQPQPQ 102 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 153 PPPPPPP--PPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPP PPPPPPPPPPPPPPPPPP P+ Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPE 74 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPP 69 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPPPPPPPP P Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 7/41 (17%) Frame = -3 Query: 171 PSTSISPPPPPPPPP---PPPPPPPP----PPPPPPPPLAP 70 P T PPPPPPPPP PPPPPPPP PPPPPP PL P Sbjct: 1848 PPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTPLMP 1888 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = -3 Query: 165 TSISPP------PPPPPPPPPPPPPPPPPPPPPPPLAP 70 TS +PP PPPPPPPPPP PPPPPPPPP AP Sbjct: 1841 TSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAP 1878 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/37 (59%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPP---PPPPPPLAP 70 P+ + + PP PP PPPPPPPPPP PPPPPP P Sbjct: 1838 PTITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPP 1874 [116][TOP] >UniRef100_Q10Q99 Formin-like protein 8 n=1 Tax=Oryza sativa Japonica Group RepID=FH8_ORYSJ Length = 892 Score = 72.0 bits (175), Expect = 2e-11 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 8/44 (18%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPP--------PPPPPPPPLAPKHNSL 55 S +PPPPPPPPPPPPPPPPP PPPPPPPP P +N+L Sbjct: 346 SNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNL 389 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/44 (56%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -3 Query: 183 TNNIPSTS--ISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 T + P T SP P P P PPPPPPPPPPPPPP PK N+ Sbjct: 326 TGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNT 369 [117][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 72.0 bits (175), Expect = 2e-11 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 T++ P PPPPPPPPPPPPPPPPP PPPPPPP+ Sbjct: 345 TSDAPKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPI 380 Score = 67.4 bits (163), Expect = 5e-10 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 3/36 (8%) Frame = -3 Query: 168 STSISP---PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +TS +P PPPPPPPPPPPPPPPPPPP PPPP P Sbjct: 344 ATSDAPKLMPPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 66.6 bits (161), Expect = 8e-10 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 NN S + PPPPPPPPPPPPPPPPPPP PPP P Sbjct: 342 NNATSDAPKLMPPPPPPPPPPPPPPPPPPPRPPPPPP 378 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 5/34 (14%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPP-----PPPLAPK 67 PPPPPPPPPPPPPP PPPPPPP PPP PK Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPPK 391 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/41 (58%), Positives = 26/41 (63%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 LV + + S P PPPPPPPPPPPPPPPPPPP P Sbjct: 334 LVTGGTQENNATSDAPKLMPPPPPPPPPPPPPPPPPPPRPP 374 [118][TOP] >UniRef100_UPI0000E1F761 PREDICTED: formin-like 2 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E1F761 Length = 1087 Score = 71.6 bits (174), Expect = 3e-11 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 ++PP PPPPPPPPPPPPPPPPPPPPPPL Sbjct: 548 VTPPMPPPPPPPPPPPPPPPPPPPPPPL 575 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 10/46 (21%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP----------PPPPLAP 70 N P T PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 590 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L +++ P T + P PP PPPPPPPPPPPPPPPPPP P Sbjct: 533 LPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 573 [119][TOP] >UniRef100_UPI0000E1F760 PREDICTED: formin-like 2 isoform 8 n=1 Tax=Pan troglodytes RepID=UPI0000E1F760 Length = 1093 Score = 71.6 bits (174), Expect = 3e-11 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 ++PP PPPPPPPPPPPPPPPPPPPPPPL Sbjct: 548 VTPPMPPPPPPPPPPPPPPPPPPPPPPL 575 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 10/46 (21%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP----------PPPPLAP 70 N P T PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 590 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L +++ P T + P PP PPPPPPPPPPPPPPPPPP P Sbjct: 533 LPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 573 [120][TOP] >UniRef100_UPI00016E10B6 UPI00016E10B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B6 Length = 1270 Score = 71.6 bits (174), Expect = 3e-11 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 5/53 (9%) Frame = -3 Query: 213 EE*IFVILVDTNNIPSTSISPPPPPPPPPPPPPP-----PPPPPPPPPPPLAP 70 EE I V+ +D+ + + PPPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 664 EEDIDVLDMDSAGLGAPPAPPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPP 716 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPP--PPPPPPPPPLAP 70 P+ SPPPPPPPPPPPPPPP PPPPPPPP AP Sbjct: 697 PALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAP 732 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPPP P AP Sbjct: 708 PPPPPPPPPPGVLGPPPPPPPPGAPSAP 735 [121][TOP] >UniRef100_UPI00016E10A1 UPI00016E10A1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10A1 Length = 1396 Score = 71.6 bits (174), Expect = 3e-11 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 5/53 (9%) Frame = -3 Query: 213 EE*IFVILVDTNNIPSTSISPPPPPPPPPPPPPP-----PPPPPPPPPPPLAP 70 EE I V+ +D+ + + PPPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 790 EEDIDVLDMDSAGLGAPPAPPPPPPPPPPPPPPPALLASPPPPPPPPPPPPPP 842 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPP--PPPPPPPPPLAP 70 P+ SPPPPPPPPPPPPPPP PPPPPPPP AP Sbjct: 823 PALLASPPPPPPPPPPPPPPPGVLGPPPPPPPPGAP 858 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPPPP P AP Sbjct: 834 PPPPPPPPPPGVLGPPPPPPPPGAPSAP 861 [122][TOP] >UniRef100_Q4THH6 Chromosome undetermined SCAF2934, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4THH6_TETNG Length = 300 Score = 71.6 bits (174), Expect = 3e-11 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 P+ S + PPP PPPPPPPPPPPPP PPPPPP P+ S NS Sbjct: 254 PTRSYTNPPPAPPPPPPPPPPPPPTPPPPPPPPPERKSEKNS 295 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 +PPPPPPPPPPPPP PPPPPPPPP + K++ LN Sbjct: 264 APPPPPPPPPPPPPTPPPPPPPPPERKSEKNSCKLN 299 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPP 94 N P PPPPPPPPPP PPPPPPPPP Sbjct: 260 NPPPAPPPPPPPPPPPPPTPPPPPPPPP 287 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPP 97 TN P+ PPPPPPPPP PPPPPPPPP Sbjct: 259 TNPPPAPPPPPPPPPPPPPTPPPPPPPPP 287 [123][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 71.2 bits (173), Expect = 3e-11 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPPPPPPPPP PPPPPPPPP PPPL P Sbjct: 34 SPPPPPPPPPPPSPPPPPPPPPSPPPLPP 62 Score = 63.9 bits (154), Expect = 5e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPP PPP PP P Sbjct: 38 PPPPPPPPSPPPPPPPPPSPPPLPPWGP 65 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P +S P PPPPPPPPPPP PPPPPPPP +P Sbjct: 23 LPQPLLSQSWPSPPPPPPPPPPPSPPPPPPPPPSP 57 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPP PPPPPPPPP P Sbjct: 33 PSPPPPPPPPPPPSPPPPPPPPPSPP 58 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 PS PPPPPPP PPPPPPPPP PPP PP Sbjct: 33 PSPPPPPPPPPPPSPPPPPPPPPSPPPLPP 62 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 P SPPPPPPPPP PPP PP PPP PPP P H Sbjct: 41 PPPPPSPPPPPPPPPSPPPLPPWGPPPSPPPSPPLH 76 [124][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 71.2 bits (173), Expect = 3e-11 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 10/50 (20%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPPP----------PPPPPPPPLAP 70 + N P ++ SPPPPPPPPPPPPPPPPP PPPPPPPP AP Sbjct: 440 ISMENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAP 489 [125][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 71.2 bits (173), Expect = 3e-11 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS +PP PPPPPPPPPPPPPPPPPP PPP P Sbjct: 87 PSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPP 120 Score = 68.9 bits (167), Expect = 2e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ PPPPPPPPPPPPPPPPPP PPP PP P Sbjct: 90 PTAPPQPPPPPPPPPPPPPPPPPPTPPPTPPPTP 123 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP PPP PPP P Sbjct: 97 PPPPPPPPPPPPPPPPPTPPPTPPPTPP 124 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPP PPP PPP PP P Sbjct: 94 PQPPPPPPPPPPPPPPPPPPTPPPTPPPTPPPTP 127 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPP PPP PPP P Sbjct: 101 PPPPPPPPPPPPPTPPPTPPPTPPPTPP 128 Score = 63.9 bits (154), Expect = 5e-09 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 IP+ S PP PPPPPPPPPPPPPPPPPP P Sbjct: 84 IPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTP 115 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPP PPP PPP PPP P Sbjct: 105 PPPPPPPPPTPPPTPPPTPPPTPPPTPP 132 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPP PPP PPP PP P Sbjct: 104 PPPPPPPPPPTPPPTPPPTPPPTPPPTP 131 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ +PPP PPP PPP PPP PPP PPPPP+ P Sbjct: 52 PTFPPTPPPTPPPTPPPTPPPTPPPTPPPPPIIP 85 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPP PPP PPP P Sbjct: 102 PPPPPPPPPPPPTPPPTPPPTPPPTPPP 129 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P I P P PP PP PPPPPPPPPPPPPP P Sbjct: 79 PPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPP 112 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P I P PP PP PPPPPPPPPPPPPPP P Sbjct: 80 PPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPP 113 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/57 (45%), Positives = 28/57 (49%), Gaps = 23/57 (40%) Frame = -3 Query: 171 PSTSISPPPPPPP-----------------------PPPPPPPPPPPPPPPPPPLAP 70 P+ +PPP PPP PPPPPPPPPPPPPPPPPP P Sbjct: 60 PTPPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPP 116 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PPPPPP PPP PPP PPP PPP PP P ++++ Sbjct: 108 PPPPPPTPPPTPPPTPPPTPPPTPPPTPNPDAVI 141 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPP PPP PPP PPP PPP P N Sbjct: 106 PPPPPPPPTPPPTPPPTPPPTPPPTPPPTPN 136 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/57 (45%), Positives = 26/57 (45%), Gaps = 23/57 (40%) Frame = -3 Query: 171 PSTSISPPPPPPPP-----------------------PPPPPPPPPPPPPPPPPLAP 70 P T PPP PPP PPPPPPPPPPPPPPPPP P Sbjct: 59 PPTPPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTP 115 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/57 (43%), Positives = 29/57 (50%), Gaps = 13/57 (22%) Frame = -3 Query: 201 FVILVDTNNIPSTSISPPPPPPP-------------PPPPPPPPPPPPPPPPPPLAP 70 F++ T + PS + PPP PPP PP PPP PPP PPP PPP P Sbjct: 19 FILKPKTIHTPSPPLPPPPTPPPTPPTSPATPPPTFPPTPPPTPPPTPPPTPPPTPP 75 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/36 (63%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPP--PPPPPPPPPPPPPPPPPPPPPLAP 70 P TS + PPP PP PPP PPP PPP PPP PP P Sbjct: 43 PPTSPATPPPTFPPTPPPTPPPTPPPTPPPTPPPTP 78 [126][TOP] >UniRef100_B1KJL7 Putative lipoprotein n=1 Tax=Shewanella woodyi ATCC 51908 RepID=B1KJL7_SHEWM Length = 508 Score = 71.2 bits (173), Expect = 3e-11 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPP 82 I+PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 36 IAPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 69.3 bits (168), Expect = 1e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 68.9 bits (167), Expect = 2e-10 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 ++ P + PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 27 SSTPEEKVEIAPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 62.8 bits (151), Expect = 1e-08 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 141 PPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPE 62 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -3 Query: 138 PPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKL 40 PPPPPPPPPPPPPPPPPPPP P ++ K+ Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPETVGMSGKV 70 [127][TOP] >UniRef100_Q3ECQ3 Uncharacterized protein At1g54215.1 n=1 Tax=Arabidopsis thaliana RepID=Q3ECQ3_ARATH Length = 169 Score = 71.2 bits (173), Expect = 3e-11 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 +LV + + P SPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 28 LLVQSQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 66.6 bits (161), Expect = 8e-10 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPP 82 PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 66.6 bits (161), Expect = 8e-10 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 2/36 (5%) Frame = -3 Query: 162 SISPP--PPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 S PP P PPPPPPPPPPPPPPPPPPPP P N Sbjct: 32 SQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVN 67 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/40 (57%), Positives = 25/40 (62%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 S PP P PPPPPPPPPPPPPPPP P +N +E Sbjct: 32 SQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVE 71 [128][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 71.2 bits (173), Expect = 3e-11 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +PPPPPPPPPPPPPPPPPPPPP PPP P+ Sbjct: 418 APPPPPPPPPPPPPPPPPPPPPTPPPPPPR 447 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP PPPPPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPTPPPPPPRPP 449 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PPPPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPTPPPPPPRP 448 Score = 67.4 bits (163), Expect = 5e-10 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPPPPP P +P Sbjct: 424 PPPPPPPPPPPPPPPPTPPPPPPRPPSP 451 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP PPPPPP PP P Sbjct: 425 PPPPPPPPPPPPPPPTPPPPPPRPPSPP 452 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +++ S + PPPPPPPPPPPPPPPPPPPPP P P Sbjct: 404 VINLERTESEIFAAAPPPPPPPPPPPPPPPPPPPPPTPPPP 444 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 PPPPPPPPPPPPPP PPPPPP PP P +N Sbjct: 426 PPPPPPPPPPPPPPTPPPPPPRPPSPPPVEKVTVN 460 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDT 28 PPPPPPPPPP PPPPPP PP PPP N ++ S+ T Sbjct: 430 PPPPPPPPPPTPPPPPPRPPSPPPVEKVTVNPIVRSEKRVST 471 [129][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 71.2 bits (173), Expect = 3e-11 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 3/38 (7%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPP---PPPPPLAP 70 +P + PPPPPPPPPPPPPPPPPPPP PPPPP P Sbjct: 132 LPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPP 169 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P + PP PPPPPPPPPPPPPPPPPPPP+A Sbjct: 128 PPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMA 160 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 174 IPSTSISPPPP--PPPPPPPPPPPPPPPPPPPPPLAP 70 +P + P PP PPPPPPPPPPPPPPPPPPPP P Sbjct: 126 MPPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGP 162 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/31 (80%), Positives = 25/31 (80%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPP---PPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PPPPP PPP P Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHP 173 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 5/33 (15%) Frame = -3 Query: 153 PPPPPPPPPP-----PPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPP PPPP PPPP P Sbjct: 147 PPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGP 179 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 3/31 (9%) Frame = -3 Query: 153 PPPPPPPPP---PPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPP PPPP PPPP P Sbjct: 150 PPPPPPPPPMAGPPPPPGPPPPHPPPPAGPP 180 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 P PPPPP PPPP PPPP PPP PP+ P H Sbjct: 156 PPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPH 191 [130][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 70.9 bits (172), Expect = 4e-11 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 S PPPPPP PPPPPPPPPPPPPPPPPP A K+ Sbjct: 333 SAPPPPPPPRPPPPPPPPPPPPPPPPPPPALKN 365 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P ++ PPPPP PPPPPPPPPPPPPPPPPPP Sbjct: 331 PVSAPPPPPPPRPPPPPPPPPPPPPPPPPPP 361 Score = 69.7 bits (169), Expect = 1e-10 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 +S PPPPPPP PPPPPPPPPPPPPPPP P ++ N Sbjct: 332 VSAPPPPPPPRPPPPPPPPPPPPPPPPPPPALKNVEN 368 Score = 69.3 bits (168), Expect = 1e-10 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 PPPP PPPPPPPPPPPPPPPPPPP L N ++ S Sbjct: 338 PPPPRPPPPPPPPPPPPPPPPPPPALKNVENPMIPS 373 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 +S PPPPPPP PPPPPPPPPPPPPPP L N ++ S Sbjct: 779 VSAPPPPPPPRPPPPPPPPPPPPPPPALKNVENPMIPS 816 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 I S + P PPPPPPP PPPPPPPPPPPPP P +L N Sbjct: 324 ISSAFLKPVSAPPPPPPPRPPPPPPPPPPPPPPPPPPPALKN 365 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 I S + P PPPPPPP PPPPPPPPPPPPP Sbjct: 771 ISSAFLKPVSAPPPPPPPRPPPPPPPPPPPPP 802 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP 88 S PPPPPP PPPPPPPPPPPPPPP Sbjct: 780 SAPPPPPPPRPPPPPPPPPPPPPPP 804 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/42 (57%), Positives = 27/42 (64%), Gaps = 10/42 (23%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP----------PPPPL 76 P ++ PPPPP PPPPPPPPPPPPPPP P PP+ Sbjct: 778 PVSAPPPPPPPRPPPPPPPPPPPPPPPALKNVENPMIPSPPI 819 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 S++ P PPPPPPP PPPPPPPPPPPP P ++ N Sbjct: 772 SSAFLKPVSAPPPPPPPRPPPPPPPPPPPPPPPALKNVEN 811 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/42 (52%), Positives = 25/42 (59%), Gaps = 8/42 (19%) Frame = -3 Query: 171 PSTSISPPP--------PPPPPPPPPPPPPPPPPPPPPPLAP 70 P +++ PP P PPPPPPP PPPPPPPPPP P Sbjct: 314 PMSTVESPPKISSAFLKPVSAPPPPPPPRPPPPPPPPPPPPP 355 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/42 (52%), Positives = 25/42 (59%), Gaps = 8/42 (19%) Frame = -3 Query: 171 PSTSISPPP--------PPPPPPPPPPPPPPPPPPPPPPLAP 70 P +++ PP P PPPPPPP PPPPPPPPPP P Sbjct: 761 PMSTVESPPKISSAFLKPVSAPPPPPPPRPPPPPPPPPPPPP 802 [131][TOP] >UniRef100_UPI0001926BAB PREDICTED: similar to mini-collagen n=1 Tax=Hydra magnipapillata RepID=UPI0001926BAB Length = 149 Score = 70.9 bits (172), Expect = 4e-11 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 49 MAPPPPPPPPPPPPPPPPPPPPPPPPAPLP 78 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPAPLPGNP 81 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP P P P P Sbjct: 57 PPPPPPPPPPPPPPPPPPAPLPGNPGPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP P P P PP P Sbjct: 60 PPPPPPPPPPPPPPPAPLPGNPGPPGRP 87 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 26/54 (48%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP--------------------------PPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP PP PP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPAPLPGNPGPPGRPGPPGGPGPMGPPGPPGPPGPP 108 [132][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 +P P PPPPPPPPPPPPPPPPPPPPPPPL Sbjct: 18 LPPPPPPPRPPPPPPPPPPPPPPPPPPPPPPPL 50 Score = 70.1 bits (170), Expect = 7e-11 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P PPPPP PPPPPPPPPPPPPPPPPPP P Sbjct: 14 LPPPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPP 48 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP PPPPPPPPPPPPPPPPPPPP P Sbjct: 22 PPPPRPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PP PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPLP 51 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPPPP PL Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPLPL 52 [133][TOP] >UniRef100_UPI00004D6F7F Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7F Length = 555 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 8/49 (16%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPP--------PPPPPPPPLAP 70 L+ ++++ + S PPPPPPPPPPPPPPPPP PPPPPPPP AP Sbjct: 13 LLGSSSVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAP 61 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 10/43 (23%) Frame = -3 Query: 174 IPSTSISPPPPP----------PPPPPPPPPPPPPPPPPPPPL 76 + ST++ PP P PPPPPPPPPPPPPPPPPPPL Sbjct: 1 LSSTTLVPPSSPLLGSSSVSAPSPPPPPPPPPPPPPPPPPPPL 43 [134][TOP] >UniRef100_UPI00004D6F7D Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7D Length = 1054 Score = 70.9 bits (172), Expect = 4e-11 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 10/50 (20%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPPP----------PPPPPPPPLAP 70 + N P ++ SPPPPPPPPPPPPPPPPP PPPPPPPP AP Sbjct: 522 IPLENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAP 571 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/40 (62%), Positives = 25/40 (62%), Gaps = 10/40 (25%) Frame = -3 Query: 171 PSTSISPPP----------PPPPPPPPPPPPPPPPPPPPP 82 P SIS P P PPPPPPPPPPPPPPPPPPP Sbjct: 513 PGASISGPSIPLENGPVSAPSPPPPPPPPPPPPPPPPPPP 552 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 PS + P P PPPPPPPPPPPPPPPPP Sbjct: 520 PSIPLENGPVSAPSPPPPPPPPPPPPPPPPP 550 [135][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 1490 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKL 1531 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 1486 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 1514 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 1484 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 1520 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 1487 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 1528 [136][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 1486 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKL 1527 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 1482 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 1510 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 1480 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 1516 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 1483 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 1524 [137][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 1486 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKKKL 1527 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 1482 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 1510 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 1480 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 1516 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 1483 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 1524 [138][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 70.9 bits (172), Expect = 4e-11 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS S SPPPP PPPP PPPPPPPPPPPPP P +P Sbjct: 200 PSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSP 233 Score = 70.5 bits (171), Expect = 6e-11 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 P S SP PPPP PPPP PPPPPPPPPPPPP P N Sbjct: 198 PPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPN 234 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/39 (66%), Positives = 28/39 (71%), Gaps = 6/39 (15%) Frame = -3 Query: 168 STSISPPPP------PPPPPPPPPPPPPPPPPPPPPLAP 70 S S +PPPP PPP PPPP PPPPPPPPPPPP +P Sbjct: 192 SASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSP 230 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS SPPPP PPPP PPPP PPPP PPPP P Sbjct: 88 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 121 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPP---PPPPLAP 70 SPPPP PPPPPPPPPPPPP PP PPP +P Sbjct: 210 SPPPPSPPPPPPPPPPPPPSPPSPNPPPSASP 241 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPP PPP PPP PPPP PPP PPPPL P Sbjct: 36 SPPPLPPPLPPPSPPPPSPPPSPPPPLPP 64 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPP PPPP PPPP PP PPP PPPP P Sbjct: 67 PSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPP 100 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + SPPP PPPP PPPP PPPP PPPP P P Sbjct: 84 PPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 117 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PPPP PPPP PPPP PPPP PP +P Sbjct: 90 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSP 123 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +PP PPPP PPPP PPPP PPP PPPL P Sbjct: 18 TPPSPPPPSPPPPSPPPPSPPPLPPPLPP 46 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPP PPPP PP PPP PPPP PPP +P Sbjct: 76 SPPPPSPPPPSPPSPPPSPPPPSPPPPSP 104 Score = 60.1 bits (144), Expect = 8e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPP PP PPP PPPP PPPP PPP +P Sbjct: 81 SPPPPSPPSPPPSPPPPSPPPPSPPPPSP 109 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/45 (53%), Positives = 28/45 (62%) Frame = -3 Query: 204 IFVILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IFV+++ + PPP PPPP PPPP PPP PPP PPP P Sbjct: 6 IFVVILCGGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPP 50 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPP---PPPPPPPPPPPPPPPPPLAP 70 PS SPPPP PPP PP PPPP PPPP PPPP P Sbjct: 52 PSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPP 88 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPP PPPP PPPP PPPP PPPP P Sbjct: 87 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 120 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPP PPPP PPPP PPP PP +P Sbjct: 94 PPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSP 127 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPP PPPP PPP PPP PPP PPP +P Sbjct: 26 SPPPPSPPPPSPPPLPPPLPPPSPPPPSP 54 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPP PP PPP PPPP PPPP P Sbjct: 72 PPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPP 105 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PP PPP PPPP PPPP PPPP P Sbjct: 77 PPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPP 110 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P P PPP PPPP PPPP PPPP PPPP P Sbjct: 82 PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 115 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 23/57 (40%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPP-----------------------PPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 209 PSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPGLP 265 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPP PPP PPP PPP PPPP PPP P Sbjct: 31 SPPPPSPPPLPPPLPPPSPPPPSPPPSPP 59 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/35 (68%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPPP-PPPPPPPPPPPPPPPLAP 70 PS S PPPP PPPP PPPP PP PPP PPP +P Sbjct: 65 PSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSP 99 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 5/36 (13%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPP-----PPPPPPP 79 PS SPPP P PP PPPP PPPP PPPPPPP Sbjct: 117 PSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPP 152 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P S PP PPP PPPP PPP P PP PPPP P Sbjct: 44 LPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPP 78 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPP PPPP PPPP PPP PPP P P Sbjct: 97 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPP 130 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PPPP PPPP PPP PPP P PP P Sbjct: 100 PPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPP 133 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PPPP PPP PPP P PP PPPP P Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPP 138 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 PS PPP PPP PPPP PPP PPPP PPP Sbjct: 35 PSPPPLPPPLPPPSPPPPSPPPSPPPPLPPP 65 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PPPP PP PPP PPPP PPPP P Sbjct: 73 PPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPP 106 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PP PPP PPPP PPPP PPPP P Sbjct: 78 PPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPP 111 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPP PPPP PPPP PPPP PPPP P Sbjct: 83 PPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 116 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPP PPPP PPPP PPPP PPP P Sbjct: 92 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 125 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = -3 Query: 156 SPPPPPPPPPPPP---PPPPPPPPPPPPPLAP 70 SPPPP PPP PPP PP PPPP PPPP ++P Sbjct: 113 SPPPPSPPPSPPPSPSPPSPPPPSPPPPSISP 144 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPPP PPP P PP PPPP PPPP P Sbjct: 50 PPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPP 83 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + P PPPP PPPP PPPP PPP PPP +P Sbjct: 96 PPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSP 129 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 P PPP PPPP PPP PPP P PP PPP +P S+ Sbjct: 104 PPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSI 142 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 6/35 (17%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPP------PPPPPPPPLAP 70 SPPPP PPP PPPP PPP PPPP PPP +P Sbjct: 48 SPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSP 82 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPP PPPP PPP PPP P P +P Sbjct: 99 PPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSP 132 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + P PPPP PP PPP PPPP PPPP P P Sbjct: 74 PPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPP 107 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + P PP PPP PPPP PPPP PPPP P P Sbjct: 79 PPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPP 112 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 15/46 (32%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP-----PPPPPPP----------PPPPPP 79 P S SPP PPPP PPPP PPPPPPP PPPPPP Sbjct: 123 PPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPP 168 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PPPP PPP PPP PPP PPPP P Sbjct: 23 PPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPP 56 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPP PPP PPPP PPP PPPP PP +P Sbjct: 41 PPPLPPPSPPPPSPPPSPPPPLPPPSP 67 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 13/39 (33%) Frame = -3 Query: 156 SPPPPPPPPP-----PPPPPPP--------PPPPPPPPP 79 SPPPP PPPP PPPPPPP P PPPPPPP Sbjct: 131 SPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPP 169 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 7/41 (17%) Frame = -3 Query: 171 PSTSISPPPP----PPPPPP---PPPPPPPPPPPPPPPLAP 70 P SISP PP P PPPP P PPPP PPPP PPP P Sbjct: 181 PPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPP 221 [139][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 70.9 bits (172), Expect = 4e-11 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS SPPPPP PPPPPPPPPPP PPPPPPP P Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 69.3 bits (168), Expect = 1e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS P PPPPPPPPPPP PPPPPPPPPPP P Sbjct: 219 PSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 252 Score = 69.3 bits (168), Expect = 1e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPP PPPPPPPPPPP PPPPP P Sbjct: 225 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPP 258 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPP PPPPPPPPPPP P P Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPP PPPPPPPPPPP PPPP +P Sbjct: 224 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSP 257 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPP PPPPP PPPP PPL P Sbjct: 233 PPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPP 266 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S SPPP PPPPP PPPPPPPPPPP PPP P Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPP 244 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS S P PPPPP PPPPPPPPPPP PPPPP P Sbjct: 213 PSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPP PPPPPPPPPPP PP P Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 7/35 (20%) Frame = -3 Query: 153 PPPPPPPPP-------PPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPP PPPPPPPPPP +P Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSP 239 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SP PPP PPPPP PPPPPPPPPPP P P Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPP 242 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPP PPPPP PPPP PP PPP P Sbjct: 237 PSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIP 270 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 7/41 (17%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP-------PPPPPPPPPPPPPPLAP 70 P++ S PPPPPPPPP PPPPP PPPPPPPP P Sbjct: 197 PTSRASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPP 237 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPP----PPLA 73 PPPPP PPPPP PPPP PP PPP PP A Sbjct: 245 PPPPPSPPPPPSPPPPSPPLPPPSIPSPPFA 275 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP PPPPP PPPP PP PPP P P Sbjct: 246 PPPPSPPPPPSPPPPSPPLPPPSIPSPP 273 [140][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 70.9 bits (172), Expect = 4e-11 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P ++PPPPP PPPPPPPPP PPPPPPPPPL P Sbjct: 1203 PPPPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPP 1236 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPP PPPPPPPPP PPPPPP P Sbjct: 1210 PPPPLPPPPPPPPPLPPPPPPPPPLPPPPPPPPP 1243 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPP PPPPPPP P Sbjct: 1217 PPPPPPPLPPPPPPPPPLPPPPPPPPPP 1244 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPP PPPPPPPP P Sbjct: 1218 PPPPPPLPPPPPPPPPLPPPPPPPPPPP 1245 Score = 65.1 bits (157), Expect = 2e-09 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 +P PPP PPPPPPPPP PPPPPPPPPPP Sbjct: 1214 LPPPPPPPPPLPPPPPPPPPLPPPPPPPPPPP 1245 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PP PPPPPPPPP PPPPPPPPPPPP+ Sbjct: 1222 PPLPPPPPPPPPLPPPPPPPPPPPPV 1247 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P T PP PPPPPPPPP PPPPPPPPP PP P Sbjct: 1206 PLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPPPP 1239 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP 91 P + PPPPPPPP PPPPPPPPPPPP Sbjct: 1220 PPPPLPPPPPPPPPLPPPPPPPPPPPP 1246 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +P+ + PPPP PPPPP PPPPPPPPP PP P Sbjct: 1195 VPAPVPAGPPPPLTPPPPPLPPPPPPPPPLPPPPP 1229 [141][TOP] >UniRef100_B4M7B5 GJ16487 n=1 Tax=Drosophila virilis RepID=B4M7B5_DROVI Length = 880 Score = 70.9 bits (172), Expect = 4e-11 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 P+ + PPPPPPPPPPPPPPPPPPPPPPP A +S +S Sbjct: 179 PAVDMETPPPPPPPPPPPPPPPPPPPPPPPESASSCSSSSSS 220 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 S PPPPPPPPPPPPPPPPPPP P PP Sbjct: 805 SKPPPPPPPPPPPPPPPPPPPLPLPP 830 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPP P PP PL Sbjct: 808 PPPPPPPPPPPPPPPPPPLPLPPQPL 833 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEE 34 PPPPPPPPPPPPPPPPPPPP + +S +S +EE Sbjct: 189 PPPPPPPPPPPPPPPPPPPPESASSCSSSSSSSSSSSVEE 228 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP P PP P Sbjct: 807 PPPPPPPPPPPPPPPPPPPLPLPPQPLP 834 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = -3 Query: 141 PPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQFV 19 PPPPPPPPPPPPPPPPPPPPP +S +S + V Sbjct: 186 PPPPPPPPPPPPPPPPPPPPPPPESASSCSSSSSSSSSSSV 226 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEED 31 PPPPPPPPPPPPPPPPPPPPP +S +S E+ Sbjct: 188 PPPPPPPPPPPPPPPPPPPPPESASSCSSSSSSSSSSSVEE 228 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 141 PPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPP PL P+ Sbjct: 807 PPPPPPPPPPPPPPPPPPPLPLPPQ 831 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 PPPPPPPPPPPPPPPPPPP P P P S +S + Q Sbjct: 807 PPPPPPPPPPPPPPPPPPPLPLPPQPLPLSSASSSSSQSGQ 847 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPPP P PP P PL+ +S Sbjct: 810 PPPPPPPPPPPPPPPPLPLPPQPLPLSSASSS 841 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 + +++ PPPPPPPPPPPPPPPPPPP P Sbjct: 799 AAAVAQSKPPPPPPPPPPPPPPPPPPPLP 827 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+ P PPPPPPPPPPPPPPPPPP P S Sbjct: 176 SLEPAVDMETPPPPPPPPPPPPPPPPPPPPPPPES 210 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/70 (38%), Positives = 29/70 (41%), Gaps = 37/70 (52%) Frame = -3 Query: 174 IPSTSISPPPPPP-------------------------------------PPPPPPPPPP 106 +P + PPPPPP PPPPPPPPPP Sbjct: 757 LPMPAPPPPPPPPPSPSDMFQANGHIDNWQQVAMLQYQEPELAAAVAQSKPPPPPPPPPP 816 Query: 105 PPPPPPPPPL 76 PPPPPPPPPL Sbjct: 817 PPPPPPPPPL 826 [142][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 70.9 bits (172), Expect = 4e-11 Identities = 29/42 (69%), Positives = 29/42 (69%), Gaps = 8/42 (19%) Frame = -3 Query: 171 PSTSISPPPPPPPP--------PPPPPPPPPPPPPPPPPLAP 70 P S SPPPPPPPP PPPPPPPPPPPPPPPPP P Sbjct: 114 PPLSYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPP 155 Score = 66.6 bits (161), Expect = 8e-10 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 P + SP P PPPPPPPPPPPPPPPPP PP AP + S Sbjct: 126 PPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAPAPSNPS 163 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 9/43 (20%) Frame = -3 Query: 171 PSTSISPPPPPPPPP---------PPPPPPPPPPPPPPPPLAP 70 PS +S PPPPPPP PPPPPPPPPPPPPPPP +P Sbjct: 112 PSPPLSYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSP 154 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS S PPPPPPPPPPPPPPP PP P P P P Sbjct: 132 PSPSPPPPPPPPPPPPPPPPPSPPAPAPSNPSTP 165 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 13/49 (26%) Frame = -3 Query: 177 NIPSTSISPPPPPPP-----PPPPPPP--------PPPPPPPPPPPLAP 70 N+P+ + PP P PP PPPPPPP PPPPPPPPPPP P Sbjct: 101 NVPTVTAQPPSPSPPLSYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPP 149 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPP---PPPPPPPPPPPPPPPPPPPLAP 70 PS S SPPPPPP PPPPPPPP PP P P P P Sbjct: 130 PSPSPSPPPPPPPPPPPPPPPPPSPPAPAPSNPSTPP 166 [143][TOP] >UniRef100_UPI000176023F PREDICTED: similar to protein kinase beta like (3E511) n=1 Tax=Danio rerio RepID=UPI000176023F Length = 639 Score = 70.5 bits (171), Expect = 6e-11 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 D+ + PS +PPP PPP PPPPPPPPPPPPPPPPP Sbjct: 341 DSASGPSPGTAPPPAPPPQPPPPPPPPPPPPPPPPP 376 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P T+ P PPP PPPPPPPPPPPPPPPPP P Sbjct: 348 PGTAPPPAPPPQPPPPPPPPPPPPPPPPPSRCNP 381 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 PPP PPP PPPPPPPPPPPPPPP + N L Sbjct: 352 PPPAPPPQPPPPPPPPPPPPPPPPPSRCNPL 382 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -3 Query: 144 PPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 PPP PPP PPPPPPPPPPPPPP P + L+S Sbjct: 352 PPPAPPPQPPPPPPPPPPPPPPPPPSRCNPLSS 384 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 T++ ++ SP PPP PPP PPPPPPPPPPPPP P Sbjct: 338 TSSDSASGPSPGTAPPPAPPPQPPPPPPPPPPPPPPPP 375 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/48 (47%), Positives = 26/48 (54%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 L + ++ P P PPP PPP PPPPPPPPPPP P S N Sbjct: 333 LQEARTSSDSASGPSPGTAPPPAPPPQPPPPPPPPPPPPPPPPPSRCN 380 [144][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2332 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2373 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2328 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2356 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2326 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2370 [145][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2332 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2373 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2328 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2356 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2326 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2370 [146][TOP] >UniRef100_UPI0000D9B853 PREDICTED: similar to Formin-1 isoform IV (Limb deformity protein) n=1 Tax=Macaca mulatta RepID=UPI0000D9B853 Length = 1164 Score = 70.5 bits (171), Expect = 6e-11 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 9/42 (21%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPP---------PPPPPPPPPPPPPL 76 +P S PPPPPPPPPPPP PPPPPPPPPPPPPL Sbjct: 676 VPPVSAGPPPPPPPPPPPPPLPLSSSAGPPPPPPPPPPPPPL 717 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 8/46 (17%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPP--------PPPPPPPPPPLAPKHNS 58 P +S PPPPPPPPPPPPP PPPPPPPPPP P NS Sbjct: 675 PVPPVSAGPPPPPPPPPPPPPLPLSSSAGPPPPPPPPPPPPPLPNS 720 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/45 (57%), Positives = 29/45 (64%), Gaps = 10/45 (22%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPP----------PPPPPPPPPLAP 70 +P +S + PPPPPPPPPPPPP P PPP PPPP LAP Sbjct: 696 LPLSSSAGPPPPPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAP 740 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 15/45 (33%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPP------------PPPPPPPP---PPPP 79 S+S PPPPPPPPPPPPP PPP PPPP PPPP Sbjct: 699 SSSAGPPPPPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPP 743 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 13/39 (33%) Frame = -3 Query: 153 PPPPP---------PPPPPPP----PPPPPPPPPPPPPL 76 PPPPP P PP PP PPPPPPPPPPPPPL Sbjct: 658 PPPPPLPLGLDSLSPAPPVPPVSAGPPPPPPPPPPPPPL 696 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPP 82 S+SP PP PP PPPPPPPPPPPPP Sbjct: 669 SLSPAPPVPPVSAGPPPPPPPPPPPPP 695 [147][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 70.5 bits (171), Expect = 6e-11 Identities = 30/46 (65%), Positives = 32/46 (69%), Gaps = 10/46 (21%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPP----------PPPPPPPPLAP 70 N P ++ SPPPPPPPPPPPPPPPPP PPPPPPPP AP Sbjct: 545 NGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAP 590 Score = 66.2 bits (160), Expect = 1e-09 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L+ ++++ + +S P PPPPPPPPPPPPPPPPPPP P P Sbjct: 537 LLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEP 577 [148][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 70.5 bits (171), Expect = 6e-11 Identities = 30/46 (65%), Positives = 32/46 (69%), Gaps = 10/46 (21%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPP----------PPPPPPPPLAP 70 N P ++ SPPPPPPPPPPPPPPPPP PPPPPPPP AP Sbjct: 557 NGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAP 602 Score = 66.2 bits (160), Expect = 1e-09 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L+ ++++ + +S P PPPPPPPPPPPPPPPPPPP P P Sbjct: 549 LLGSSSVENGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEP 589 [149][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2302 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2343 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2298 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2326 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2296 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2299 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2340 [150][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2332 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2373 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2328 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2356 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2326 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2370 [151][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2302 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2343 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2298 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2326 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2296 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2299 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2340 [152][TOP] >UniRef100_UPI00016E72DF UPI00016E72DF related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72DF Length = 570 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/44 (65%), Positives = 30/44 (68%), Gaps = 9/44 (20%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPP---------PPPPPPLAP 70 +P SPPPPPPPPPPPPPPPPPP PPPPPPLAP Sbjct: 35 LPVNGTSPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 78 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 6/35 (17%) Frame = -3 Query: 156 SPPPPPPPPP------PPPPPPPPPPPPPPPPLAP 70 +PPPPPPPPP PPPPPPPPPPPPPPP P Sbjct: 25 APPPPPPPPPLPVNGTSPPPPPPPPPPPPPPPPPP 59 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 7/35 (20%) Frame = -3 Query: 153 PPPPPPPPPPP-------PPPPPPPPPPPPPPLAP 70 P PPPPPPPPP PPPPPPPPPPPPPP P Sbjct: 24 PAPPPPPPPPPLPVNGTSPPPPPPPPPPPPPPPPP 58 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 25/39 (64%), Gaps = 7/39 (17%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPP-------PPPPPPPPPPPLAP 70 T ++ P PPPPPPPPP PPPPPPPPPPP P Sbjct: 17 TGVAAGMPAPPPPPPPPPLPVNGTSPPPPPPPPPPPPPP 55 [153][TOP] >UniRef100_Q9Q5L3 EBNA-2 n=1 Tax=Macacine herpesvirus 4 RepID=Q9Q5L3_9GAMA Length = 605 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPP-PPPPPPPPPPPPPPPLAP 70 +I+ D N P T PPPPPPPPP PPPPPPP PPPPPPP+ P Sbjct: 49 IIVGDENEGPQTVPGAPPPPPPPPPLPPPPPPPLPPPPPPPVQP 92 [154][TOP] >UniRef100_Q00484 Mini-collagen n=1 Tax=Hydra sp. RepID=Q00484_9CNID Length = 149 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPPPP PL Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAPL 77 Score = 67.4 bits (163), Expect = 5e-10 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAPLP 78 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 P PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 47 PVCCYPPPPPPPPPPPPPPPPPPPPPPPAP 76 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPAPLPGNP 81 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP P P P P Sbjct: 57 PPPPPPPPPPPPPPPPPPAPLPGNPGPP 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP P P P PP P Sbjct: 60 PPPPPPPPPPPPPPPAPLPGNPGPPGRP 87 [155][TOP] >UniRef100_B2KTD4 Minicollagen 1 n=1 Tax=Clytia hemisphaerica RepID=B2KTD4_9CNID Length = 149 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +PPPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 51 APPPPPPPPPPPPPPPPPPPPPPPPAPIP 79 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 P PPPPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 47 PVCCAPPPPPPPPPPPPPPPPPPPPPPPPAPI 78 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPAPIPGNP 82 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP P P P P Sbjct: 58 PPPPPPPPPPPPPPPPPPAPIPGNPGPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP P P P PP P Sbjct: 61 PPPPPPPPPPPPPPPAPIPGNPGPPGRP 88 [156][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 70.5 bits (171), Expect = 6e-11 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP S PPPPPPP PPPPPPPPPPPPPPPP P Sbjct: 462 IPHAGASLPPPPPPPLPPPPPPPPPPPPPPPPPPP 496 Score = 70.5 bits (171), Expect = 6e-11 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 S+ PPPPPP PPPPPPPPPPPPPPPPPP A Sbjct: 468 SLPPPPPPPLPPPPPPPPPPPPPPPPPPPA 497 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/64 (50%), Positives = 36/64 (56%), Gaps = 13/64 (20%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP-----------PPPPLAPKHNSL--LNSKLE 37 ++P P PPPPPPPPPPPPPPPPPPP PPPPL P S S L Sbjct: 468 SLPPPPPPPLPPPPPPPPPPPPPPPPPPPALDVGETSSLQPPPPLPPPPYSCDPSGSDLP 527 Query: 36 EDTQ 25 +DT+ Sbjct: 528 QDTK 531 [157][TOP] >UniRef100_C1H5C0 Decaprenyl-diphosphate synthase subunit 1 n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1H5C0_PARBA Length = 533 Score = 70.5 bits (171), Expect = 6e-11 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 PPPPPPPPPPPPPPPPPPPPPPP L P + Sbjct: 116 PPPPPPPPPPPPPPPPPPPPPPPSLQPSQTPI 147 Score = 67.0 bits (162), Expect = 6e-10 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPP 85 +PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 115 NPPPPPPPPPPPPPPPPPPPPPPP 138 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPP 88 N+ S + PPPPPPPPPPPPPPPPPPPPPP Sbjct: 109 NLFSKNNPPPPPPPPPPPPPPPPPPPPPPP 138 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 L NN P PPPPPPPPPPPPPPPPPPPPP P Sbjct: 110 LFSKNNPP-----PPPPPPPPPPPPPPPPPPPPPSLQP 142 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 + N P PPPPPPPPPPPPPPPPP P P++ Sbjct: 112 SKNNPPPPPPPPPPPPPPPPPPPPPPPSLQPSQTPIS 148 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -3 Query: 129 PPPPPPPPPPPPPPPPPLAPKHNSLLNSK 43 PPPPPPPPPPPPPPPPP P SL S+ Sbjct: 116 PPPPPPPPPPPPPPPPPPPPPPPSLQPSQ 144 [158][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2302 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2343 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2298 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2326 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2296 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2299 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2340 [159][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2332 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2373 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2328 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2356 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2326 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2370 [160][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2332 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2373 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2328 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2356 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2326 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2362 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2329 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2370 [161][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 70.5 bits (171), Expect = 6e-11 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP-PPPLAPKHNSLLNSKL 40 S PPPPPPPPPPPPPPPPPPPPPP PP +PK + KL Sbjct: 2302 SAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKL 2343 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPP 82 S IS PPPPPPPPPPPPPPPPPPPPPP Sbjct: 2298 SLDISAQPPPPPPPPPPPPPPPPPPPPPP 2326 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S+S+ PPPPPPPPPPPPPPPPPPPPP P S Sbjct: 2296 SSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATS 2332 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPP-PPPPPPPPPLAPK 67 +D + P PPPPPPPPPPPPPPPP PP P PP PK Sbjct: 2299 LDISAQPPPPPPPPPPPPPPPPPPPPPPLPPATSPKPPTYPK 2340 [162][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 258 PPPCPPPPPPPPPPPPPPPPPPPPPCPP 285 Score = 70.1 bits (170), Expect = 7e-11 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP PPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPCPPPCPP 289 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/33 (78%), Positives = 26/33 (78%), Gaps = 5/33 (15%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPP-----PPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PPPPPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPP 296 Score = 66.6 bits (161), Expect = 8e-10 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPP PPPPPPPPP PP P Sbjct: 300 PPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCP 333 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP PPP PPPPPPPPPPPPPPPPPP P Sbjct: 249 PPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPP PPPPPPPPPPPPP PP P Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPP 323 Score = 66.2 bits (160), Expect = 1e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPP PPPPPPPPP PPP P Sbjct: 307 PPPPPPPPPPPCPPPPPPPPPCPPPCPP 334 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPP PPPPPPPP P Sbjct: 288 PPPPPPCPPPPPPPPPCPPPPPPPPPPP 315 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPP PPPPPPPPP P Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPPPP 316 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPP PPP P Sbjct: 297 PPPPPPPCPPPPPPPPPPPPPCPPPPPP 324 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPP PPPP P Sbjct: 298 PPPPPPCPPPPPPPPPPPPPCPPPPPPP 325 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPPPPPP PPPPP P Sbjct: 299 PPPPPCPPPPPPPPPPPPPCPPPPPPPP 326 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 5/33 (15%) Frame = -3 Query: 153 PPPPPPPPPP-----PPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPPPP PPPPPPPP P Sbjct: 273 PPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCP 305 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 5/33 (15%) Frame = -3 Query: 153 PPPPPPPPPPPP-----PPPPPPPPPPPPPLAP 70 PPPPPPPPPPPP PPPPPP PPPPPP P Sbjct: 271 PPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPP 303 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ PPPPPP PPP PPP PPPPPPPPPP P Sbjct: 241 PAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPP 274 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP PPPPPP PPPPPPPPP PPPPP P Sbjct: 279 PPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPP 312 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPP PPP PPP P Sbjct: 311 PPPPPPPCPPPPPPPPPCPPPCPPPCPP 338 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPP PPP PP P Sbjct: 310 PPPPPPPPCPPPPPPPPPCPPPCPPPCP 337 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPP PPP PPPPPPPPPPP P Sbjct: 248 PPPPPCPPPCPPPCPPPPPPPPPPPPPP 275 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPP PPPPPPPPP PPPPPP P Sbjct: 286 PCPPPPPPCPPPPPPPPPCPPPPPPPPP 313 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 13/41 (31%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPP-------------PPPPPPLAP 70 PPPPPPPPP PPPPPPPPP PPPPPP P Sbjct: 309 PPPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPP 349 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 17/45 (37%) Frame = -3 Query: 153 PPPPPP-----------------PPPPPPPPPPPPPPPPPPPLAP 70 PP PPP PPPPPPPPPPPPPPPPPPP P Sbjct: 240 PPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCP 284 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPP PPPP PPPPPP PP P Sbjct: 342 PPPPPCPPPPCPPPPCPPPPPPCPPACP 369 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPP PPPP PPPP PPPPPP P Sbjct: 339 PCPPPPPPCPPPPCPPPPCPPPPPPCPP 366 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPP-PPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPP PPP PPP PPP PPPPP P Sbjct: 314 PPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCP 348 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PP PPPPPP PPPP PPPP PPPPP P Sbjct: 338 PPCPPPPPPCPPPPCPPPPCPPPPPPCP 365 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 13/41 (31%) Frame = -3 Query: 153 PPPPPPPPP-------------PPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPP PPPP PPPP P Sbjct: 319 PPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPPCPP 359 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPP PPPPPP PPPP PPPP PPP P Sbjct: 337 PPPCPPPPPPCPPPPCPPPPCPPPPPP 363 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPP-PPPPPPPPLAP 70 P PP PPP PPP PPPPPP PPPP PPP P Sbjct: 324 PPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPPCP 358 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/47 (51%), Positives = 25/47 (53%), Gaps = 16/47 (34%) Frame = -3 Query: 162 SISPPPPPPPPP----------------PPPPPPPPPPPPPPPPLAP 70 S +P PP PPP PPPPPPPPPPPPPPPP P Sbjct: 234 SAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPP 280 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PP PPP PPPPPP PPPP PPPP P P Sbjct: 334 PPCPPPCPPPPPPCPPPPCPPPPCPPPP 361 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPPPP PPPP PPPP PP P Sbjct: 335 PCPPPCPPPPPPCPPPPCPPPPCPPPPP 362 [163][TOP] >UniRef100_UPI0000603C6F PREDICTED: Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 n=1 Tax=Mus musculus RepID=UPI0000603C6F Length = 1266 Score = 70.1 bits (170), Expect = 7e-11 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 P T+ P PP PPPPPPPPPPPPPPPPPPPPL Sbjct: 619 PYTASQPSPPLPPPPPPPPPPPPPPPPPPPPL 650 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 T I + S P PP PPPPPPPPPPPPPPPPPPP P ++ Sbjct: 614 TKIITPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSA 655 Score = 65.9 bits (159), Expect = 1e-09 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +S+ PPPPPP P P PPPPPPPPPPPPP+ P Sbjct: 926 PESSLVFPPPPPPAPAPAPPPPPPPPPPPPPVPP 959 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPP 91 +I T + PS + PPPPPPPPPPPPPPPPPPP P Sbjct: 616 IITPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLP 651 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -3 Query: 171 PSTSISPP----PPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQFV 19 P T I P P PP PPPPPPPPPPPPPPPPP P + S T FV Sbjct: 612 PQTKIITPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSSGSAATMFV 666 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/36 (66%), Positives = 27/36 (75%), Gaps = 3/36 (8%) Frame = -3 Query: 168 STSISPPPPPPPP---PPPPPPPPPPPPPPPPPLAP 70 S+ + PPPPPP P PPPPPPPPPPPPP PP +P Sbjct: 928 SSLVFPPPPPPAPAPAPPPPPPPPPPPPPVPPTASP 963 [164][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 70.1 bits (170), Expect = 7e-11 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 6/36 (16%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPP------PPPPPLAP 70 ++PPPPPPPPPPPPPPPPPPPP PPPPP AP Sbjct: 270 VAPPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAP 305 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 6/47 (12%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPP------PPPPPPPPPPPPPLAP 70 +VD P PPPPPPPPPPPP PPPPPP PPPPPP P Sbjct: 267 VVDVAPPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPP 313 Score = 65.9 bits (159), Expect = 1e-09 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 6/42 (14%) Frame = -3 Query: 153 PPPPPPPPPPPPP------PPPPPPPPPPPPLAPKHNSLLNS 46 PPPPPPPPPPPPP PPPPPP PPPPP AP + +N+ Sbjct: 279 PPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAPVNN 320 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 6/42 (14%) Frame = -3 Query: 153 PPPPPPPP------PPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 PPPPPPPP PPPPPP PPPPPP PPP AP +N +S Sbjct: 284 PPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAPVNNDPTSS 325 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 P SPP P PPPPPP PPPPPP PPPP P+ Sbjct: 287 PPPPPSPPAPAPPPPPPAPPPPPPAPPPPAPV 318 [165][TOP] >UniRef100_A7Z068 LMOD2 protein n=1 Tax=Bos taurus RepID=A7Z068_BOVIN Length = 553 Score = 70.1 bits (170), Expect = 7e-11 Identities = 28/44 (63%), Positives = 31/44 (70%), Gaps = 9/44 (20%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPP---------PPPPPPPPPLAPK 67 P + +PPPPPPPPPPPPPPPP PPPPPPPPP AP+ Sbjct: 414 PPSPAAPPPPPPPPPPPPPPPPPPPLAPQRLPPPPPPPPPPAPE 457 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/62 (45%), Positives = 30/62 (48%), Gaps = 13/62 (20%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPP-------------PPPPPPPPLAPKHNSLLNSKLEED 31 PS + PPPPPPPPPPPPPPPPP PPPP P N K +E Sbjct: 415 PSPAAPPPPPPPPPPPPPPPPPPPLAPQRLPPPPPPPPPPAPEKKLITRNIAEVIKQQES 474 Query: 30 TQ 25 Q Sbjct: 475 AQ 476 [166][TOP] >UniRef100_C9K0J5 Putative uncharacterized protein RAPH1 n=1 Tax=Homo sapiens RepID=C9K0J5_HUMAN Length = 1302 Score = 70.1 bits (170), Expect = 7e-11 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 P T+ P PP PPPPPPPPPPPPPPPPPPPPL Sbjct: 670 PYTASQPSPPLPPPPPPPPPPPPPPPPPPPPL 701 Score = 65.9 bits (159), Expect = 1e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 SPP PPPPPPPPPPPPPPPPPPPP P Sbjct: 677 SPPLPPPPPPPPPPPPPPPPPPPPLP 702 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S P PP PPPPPPPPPPPPPPPPPPP P ++ Sbjct: 674 SQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSA 706 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPP 91 T + PS + PPPPPPPPPPPPPPPPPPP P Sbjct: 672 TASQPSPPLPPPPPPPPPPPPPPPPPPPPLP 702 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 14/54 (25%) Frame = -3 Query: 189 VDTNNIPSTSISPP--------------PPPPPPPPPPPPPPPPPPPPPPPLAP 70 +++ N P TS+ PP P PP PPPPPPPPPPPPPPPPP P Sbjct: 647 MESMNRPYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPP 700 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPP P P A Sbjct: 683 PPPPPPPPPPPPPPPPPPLPSQSAPSA 709 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/45 (51%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = -3 Query: 174 IPSTSISPPPP------PPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 +PS PPPP PPPPP P P PPPPPPP P K S Sbjct: 963 VPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGS 1007 [167][TOP] >UniRef100_Q5KAA5 Cytokinesis protein sepa (Fh1/2 protein), putative n=1 Tax=Filobasidiella neoformans RepID=Q5KAA5_CRYNE Length = 1776 Score = 70.1 bits (170), Expect = 7e-11 Identities = 29/53 (54%), Positives = 32/53 (60%), Gaps = 11/53 (20%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPP-----------PPPPPPPPPPPPPLAPKHN 61 +T +P PPPPPPPPPPPP PPPPPPPPPPPPPL H+ Sbjct: 1081 ETTPLPHPPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPPLTTLHH 1133 Score = 63.9 bits (154), Expect = 5e-09 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 P +P P PPPPPPPPPPPPPPPPPPPP Sbjct: 1078 PKGETTPLPHPPPPPPPPPPPPPPPPPPPP 1107 [168][TOP] >UniRef100_Q70E73 Ras-associated and pleckstrin homology domains-containing protein 1 n=1 Tax=Homo sapiens RepID=RAPH1_HUMAN Length = 1250 Score = 70.1 bits (170), Expect = 7e-11 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 P T+ P PP PPPPPPPPPPPPPPPPPPPPL Sbjct: 618 PYTASQPSPPLPPPPPPPPPPPPPPPPPPPPL 649 Score = 65.9 bits (159), Expect = 1e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 SPP PPPPPPPPPPPPPPPPPPPP P Sbjct: 625 SPPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 S P PP PPPPPPPPPPPPPPPPPPP P ++ Sbjct: 622 SQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSA 654 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPP 91 T + PS + PPPPPPPPPPPPPPPPPPP P Sbjct: 620 TASQPSPPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 14/54 (25%) Frame = -3 Query: 189 VDTNNIPSTSISPP--------------PPPPPPPPPPPPPPPPPPPPPPPLAP 70 +++ N P TS+ PP P PP PPPPPPPPPPPPPPPPP P Sbjct: 595 MESMNRPYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPP 648 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPP P P A Sbjct: 631 PPPPPPPPPPPPPPPPPPLPSQSAPSA 657 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/45 (51%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = -3 Query: 174 IPSTSISPPPP------PPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 +PS PPPP PPPPP P P PPPPPPP P K S Sbjct: 911 VPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGS 955 [169][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 ++ PS + PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 3057 SSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPP 3090 Score = 67.8 bits (164), Expect = 4e-10 Identities = 26/46 (56%), Positives = 30/46 (65%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEE 34 P PPPPPPPPPPPPPPPPPPPPPP L+ + N + E+ Sbjct: 3063 PLLQTPPPPPPPPPPPPPPPPPPPPPPPSSSLSGQQTEQQNKESEK 3108 Score = 66.6 bits (161), Expect = 8e-10 Identities = 28/53 (52%), Positives = 34/53 (64%), Gaps = 4/53 (7%) Frame = -3 Query: 171 PSTSISPPPPPP----PPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 P+ S+S P P PPPPPPPPPPPPPPPPPPP P +SL + E+ + Sbjct: 3052 PALSLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPPSSSLSGQQTEQQNK 3104 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ISP P PPPPPPPPPPPPPPPPP P P Sbjct: 1981 ISPSSPETPPPPPPPPPPPPPPPPPTPSQP 2010 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/42 (54%), Positives = 27/42 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 P + SP PPPPPPPPPPPPPPPPP P P + + N+ Sbjct: 1980 PISPSSPETPPPPPPPPPPPPPPPPPTPSQPSSAGAGKIQNT 2021 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 I +S PPPPPPPPPPPPPPPPP P P Sbjct: 1981 ISPSSPETPPPPPPPPPPPPPPPPPTPSQP 2010 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 P P PPPPPPPPPPPPPPPPP + +S K++ Sbjct: 1983 PSSPETPPPPPPPPPPPPPPPPPTPSQPSSAGAGKIQ 2019 [170][TOP] >UniRef100_UPI0001926BC8 PREDICTED: similar to mini-collagen isoform 1 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC8 Length = 146 Score = 69.7 bits (169), Expect = 1e-10 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 T I PPPPPPPPPPPPPPPPPPPPPPP+A Sbjct: 44 TPICCAPPPPPPPPPPPPPPPPPPPPPPPVA 74 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPVAIP 76 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPP 88 P PPPPPPPPPPPPPPPPPPPPPP Sbjct: 45 PICCAPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 6/34 (17%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPP------PPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P PP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPVAIPGNPGPPGRP 85 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 26/54 (48%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP--------------------------PPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP PP PP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPVAIPGNPGPPGRPGPPGFPGPMGPPGPPGPPGPP 106 [171][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 69.7 bits (169), Expect = 1e-10 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 N P+T PPPPPPPPPPPPPPPPPPPPP P P A Sbjct: 541 NGPATPPMPPPPPPPPPPPPPPPPPPPPPLPGPAA 575 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 DT + PP PPPPPPPPPPPPPPPPPPPPPL Sbjct: 534 DTPEAVQNGPATPPMPPPPPPPPPPPPPPPPPPPPPL 570 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +PP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 545 TPPMPPPPPPPPPPPPPPPPPPPPPLPGP 573 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L +++ P + P PP PPPPPPPPPPPPPPPPPP P Sbjct: 529 LPPSSDTPEAVQNGPATPPMPPPPPPPPPPPPPPPPPPPPP 569 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 13/41 (31%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPP-------------PPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PP PPPPPP AP Sbjct: 552 PPPPPPPPPPPPPPPPPPLPGPAADTVPAPPLPPPPPPSAP 592 [172][TOP] >UniRef100_UPI000179366E PREDICTED: similar to CG32138 CG32138-PB n=1 Tax=Acyrthosiphon pisum RepID=UPI000179366E Length = 1072 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/44 (65%), Positives = 31/44 (70%), Gaps = 10/44 (22%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPP----------PPPPPPPPPLAPK 67 S SIS PPPPPPPPPPPPPP PPPPPPPPP++PK Sbjct: 513 SNSISASPPPPPPPPPPPPPPPSTTASSIAMPPPPPPPPPISPK 556 [173][TOP] >UniRef100_UPI000155CFFC PREDICTED: similar to diaphanous homolog 2 (Drosophila) n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155CFFC Length = 1111 Score = 69.7 bits (169), Expect = 1e-10 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 3/34 (8%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPP---PPPPPPPPPL 76 S+ +SPPPPP PPPPPPPPPP PPPPPPPPPL Sbjct: 567 SSGVSPPPPPSPPPPPPPPPPQGIPPPPPPPPPL 600 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 7/39 (17%) Frame = -3 Query: 171 PSTSISPPPPPPPPPP---PPPPPPPPP----PPPPPPL 76 P SPPPPPPPPPP PPPPPPPPP PPPPPPL Sbjct: 572 PPPPPSPPPPPPPPPPQGIPPPPPPPPPLFGGPPPPPPL 610 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPP---PPPPPLAP 70 P S S PPPPP PPPPPPPPPP PPPPP P Sbjct: 562 PGLSTSSGVSPPPPPSPPPPPPPPPPQGIPPPPPPPP 598 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Frame = -3 Query: 171 PSTSISPPPPPPPP----PPPPPPPPPPPPPPPPPL 76 P I PPPPPPPP PPPPPP PPPPPP L Sbjct: 586 PPQGIPPPPPPPPPLFGGPPPPPPLGGVPPPPPPGL 621 [174][TOP] >UniRef100_UPI0001B798A6 UPI0001B798A6 related cluster n=1 Tax=Homo sapiens RepID=UPI0001B798A6 Length = 625 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 9/45 (20%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP---------PPPPLAP 70 N P T PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 83 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 127 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L +++ P T + P PP PPPPPPPPPPPPPPPPPP P Sbjct: 71 LPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 111 [175][TOP] >UniRef100_UPI00016E7DED UPI00016E7DED related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7DED Length = 658 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPP-----PPPPPPPPPPLAPKHNSLL 52 P TS PPPPPPPPPPPPPP PPPPPPPPPP P S + Sbjct: 467 PQTSPPPPPPPPPPPPPPPPAARTNVPPPPPPPPPPSMPTPGSAM 511 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 6/43 (13%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPP------PPPPPPPLAP 70 N++P PPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 460 NHVPLQQPQTSPPPPPPPPPPPPPPPPAARTNVPPPPPPPPPP 502 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/51 (50%), Positives = 28/51 (54%), Gaps = 22/51 (43%) Frame = -3 Query: 165 TSISPPPPPPPPP----------------------PPPPPPPPPPPPPPPP 79 T++ PPPPPPPPP PPPPPPPPPPPPPPPP Sbjct: 490 TNVPPPPPPPPPPSMPTPGSAMGFEESPPPAPTPTPPPPPPPPPPPPPPPP 540 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 11/41 (26%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPP-----------PPPPPP 82 P + +P PPPPPPPPPPPPPPPP PPPP P Sbjct: 517 PPPAPTPTPPPPPPPPPPPPPPPPQQQQFHIPSQFPPPPAP 557 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/48 (47%), Positives = 25/48 (52%), Gaps = 14/48 (29%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP--------------PPPPPPPPPPPPPPLAP 70 P+ + PPPPPPPPPP PPP P P PPPPPP P Sbjct: 486 PAARTNVPPPPPPPPPPSMPTPGSAMGFEESPPPAPTPTPPPPPPPPP 533 [176][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 69.7 bits (169), Expect = 1e-10 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 7/41 (17%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPP-------PPPPPPPPLAP 70 PS+ +PPPPPPPPPPPPPPPPP PPPPPPPP P Sbjct: 1926 PSSPETPPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPP 1966 Score = 68.6 bits (166), Expect = 2e-10 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 7/35 (20%) Frame = -3 Query: 153 PPPPPPP-------PPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPPPPPPPPPPPPPP AP Sbjct: 1942 PPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSAP 1976 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 ++ PS + PPPPPPPPPPPPPPPPPPPPPP Sbjct: 3055 SSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPP 3087 Score = 65.9 bits (159), Expect = 1e-09 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 P +P PPP PPPPPPPPPPPPPPPPPP P+ Sbjct: 1944 PPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSAPPQ 1978 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEE 34 +PPPPPPPPPPPPPPPPPPPPPP L+ + + + E+ Sbjct: 3065 TPPPPPPPPPPPPPPPPPPPPPPSSSLSGQQTEQQSKESEK 3105 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 7/42 (16%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPP-------PPPPPPPLAP 70 I +S PPPPPPPPPPPPPPPPP PPPPPPP P Sbjct: 1924 ISPSSPETPPPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPP 1965 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/52 (51%), Positives = 34/52 (65%), Gaps = 3/52 (5%) Frame = -3 Query: 171 PSTSISPPPPPP---PPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 P+ S+S P P PPPPPPPPPPPPPPPPPP P +SL + E+ ++ Sbjct: 3050 PALSLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPSSSLSGQQTEQQSK 3101 Score = 63.9 bits (154), Expect = 5e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + SP PPPPPPPPPPPPPPPPP P PP P Sbjct: 1923 PISPSSPETPPPPPPPPPPPPPPPPPTPAPPPTP 1956 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPP--PPPPPPPPPPPPPPPPPPPPPPPLAP 70 P T PP PPPPPPPPPPPPPPPPP PP P Sbjct: 1947 PPTPAPPPTPPPPPPPPPPPPPPPPPPSAPPQVQLP 1982 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P + PPPPPPPPPPPPPPPP PP P++ Sbjct: 1952 PPPTPPPPPPPPPPPPPPPPPPSAPPQVQLPVS 1984 [177][TOP] >UniRef100_Q08BP2 LOC562403 protein (Fragment) n=1 Tax=Danio rerio RepID=Q08BP2_DANRE Length = 576 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = -3 Query: 228 EKIEGEE*IFVILVDTNNIPSTSISPPP--PPPPPPPPPPPPPPPPPPPPPP 79 +K+ +E I +I++D + + + S PP PPPP PPPPPPPPPPPPPPPPP Sbjct: 342 DKLREKEQIPLIIIDQSEETNDNPSDPPLLPPPPSPPPPPPPPPPPPPPPPP 393 [178][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 69.7 bits (169), Expect = 1e-10 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = -3 Query: 171 PSTSISPPPPPPPPP--PPPPPPPPP--PPPPPPPLAP 70 P +SPPPPPPPPP PPPPPPPPP PPPPPPP++P Sbjct: 1270 PPPPVSPPPPPPPPPVSPPPPPPPPPVSPPPPPPPVSP 1307 Score = 67.4 bits (163), Expect = 5e-10 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 7/38 (18%) Frame = -3 Query: 162 SISPPPPPPPPPP--PPPPPP-----PPPPPPPPPLAP 70 ++SPPPPPPPPPP PPPPPP PPPPPPPPP++P Sbjct: 1261 AVSPPPPPPPPPPVSPPPPPPPPPVSPPPPPPPPPVSP 1298 Score = 66.2 bits (160), Expect = 1e-09 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 4/35 (11%) Frame = -3 Query: 171 PSTSISPPPPPPPPP--PPPPPPP--PPPPPPPPP 79 P +SPPPPPPPPP PPPPPPP PPPPPPPPP Sbjct: 1281 PPPPVSPPPPPPPPPVSPPPPPPPVSPPPPPPPPP 1315 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/30 (83%), Positives = 26/30 (86%), Gaps = 4/30 (13%) Frame = -3 Query: 153 PPPPPPPP--PPPPPPP--PPPPPPPPPPL 76 PPPPPPPP PPPPPPP PPPPPPPPPP+ Sbjct: 1288 PPPPPPPPVSPPPPPPPVSPPPPPPPPPPV 1317 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 N + S++ PPPPPPPPPP PPPPPPPPP++P Sbjct: 1251 NGVVCQSVARAVSPPPPPPPPPPVSPPPPPPPPPVSP 1287 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = -3 Query: 150 PPPPPPPPP--PPPPPPP--PPPPPPPPLAPKHNSLLNSKLEEDT 28 PPPPPPPPP PPPPPPP PPPPPPPP + +N + +T Sbjct: 1287 PPPPPPPPPVSPPPPPPPVSPPPPPPPPPPVIEDPAVNETVTTET 1331 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPP 97 P +SPPPPPPP PPPPPPPPPP Sbjct: 1292 PPPPVSPPPPPPPVSPPPPPPPPPP 1316 [179][TOP] >UniRef100_C4B111 Intracellular motility protein A n=4 Tax=Burkholderia mallei RepID=C4B111_BURMA Length = 373 Score = 69.7 bits (169), Expect = 1e-10 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 V +P+ PPPPPPPPPPPPPPPP PPPP PPP +P Sbjct: 80 VGDRTLPNKVPPPPPPPPPPPPPPPPPPSPPPPSPPPPSP 119 Score = 67.4 bits (163), Expect = 5e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPP PPPP PPPP P Sbjct: 93 PPPPPPPPPPPPPPPSPPPPSPPPPSPP 120 Score = 66.6 bits (161), Expect = 8e-10 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPP-PPPPPPPPPPPPPLAP 70 N +P PPPPPPPPPPPP PPPP PPPP PPP +P Sbjct: 87 NKVPPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSP 124 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPP PPPP PPPP PPPP P Sbjct: 98 PPPPPPPPPPSPPPPSPPPPSPPPPSPP 125 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPP PPPP PPPP PPP +P Sbjct: 102 PPPPPPSPPPPSPPPPSPPPPSPPPPSP 129 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPP PPPP PPPP PPPP P Sbjct: 103 PPPPPSPPPPSPPPPSPPPPSPPPPSPP 130 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPP PPPP PPPP P Sbjct: 99 PPPPPPPPPSPPPPSPPPPSPPPPSPPP 126 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPP PPPP PPPP P P Sbjct: 100 PPPPPPPPSPPPPSPPPPSPPPPSPPPP 127 Score = 60.8 bits (146), Expect = 4e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPP PPPP PPPP PPPP PPPP P Sbjct: 103 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTP 136 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPP PPPP PPPP PPPP P Sbjct: 104 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 [180][TOP] >UniRef100_A3WBS5 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBS5_9SPHN Length = 378 Score = 69.7 bits (169), Expect = 1e-10 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 2/42 (4%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPP--PPPPPPPPPLAPKHNS 58 N+ + PPPPPPPPPPPPPPPP PPP PPPPP AP N+ Sbjct: 224 NLGGQAAPPPPPPPPPPPPPPPPPPLPPPAPPPPPPAPACNT 265 [181][TOP] >UniRef100_A4RZU2 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RZU2_OSTLU Length = 779 Score = 69.7 bits (169), Expect = 1e-10 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPP 82 +PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 340 APPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 69.3 bits (168), Expect = 1e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPPPPPPPPPPPPPPPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 P PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 336 PLECAPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 PS + PPPPPPPPPPPPPPPPPPPPPP Sbjct: 332 PSQAPLECAPPPPPPPPPPPPPPPPPPPPPP 362 Score = 62.4 bits (150), Expect = 2e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -3 Query: 141 PPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/38 (65%), Positives = 26/38 (68%), Gaps = 4/38 (10%) Frame = -3 Query: 171 PSTSISPPPPP----PPPPPPPPPPPPPPPPPPPPLAP 70 P+ SP P PPPPPPPPPPPPPPPPPPPP P Sbjct: 326 PALPTSPSQAPLECAPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 60.1 bits (144), Expect = 8e-08 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 +P++ P PPPPPPPPPPPPPPPPPPP P L+S Sbjct: 328 LPTSPSQAPLECAPPPPPPPPPPPPPPPPPPPPPPPPGFKLSS 370 [182][TOP] >UniRef100_Q00485 Mini-collagen (Fragment) n=1 Tax=Hydra sp. RepID=Q00485_9CNID Length = 142 Score = 69.7 bits (169), Expect = 1e-10 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 T I PPPPPPPPPPPPPPPPPPPPPPP+A Sbjct: 40 TPICCAPPPPPPPPPPPPPPPPPPPPPPPVA 70 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPVAIP 72 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPP 88 P PPPPPPPPPPPPPPPPPPPPPP Sbjct: 41 PICCAPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 6/34 (17%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPP------PPPPLAP 70 PPPPPPPPPPPPPPPPPPPPP P PP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPVAIPGNPGPPGRP 81 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 26/54 (48%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPP--------------------------PPPPPLAP 70 PPPPPPPPPPPPPPPPPPPP PP PP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPVAIPGNPGPPGRPGPPGFPGPMGPPGPPGPPGPP 102 [183][TOP] >UniRef100_B7PLD9 Circumsporozoite protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PLD9_IXOSC Length = 188 Score = 69.7 bits (169), Expect = 1e-10 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPP 79 S +PPPPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 SETPPPPPPPPPPPPPPPPPPPPPPAPP 51 Score = 68.2 bits (165), Expect = 3e-10 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 P + PPPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PRSETPPPPPPPPPPPPPPPPPPPPPPAPP 51 Score = 67.8 bits (164), Expect = 4e-10 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 144 PPPPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 PPPPPPPPPPPPPPPPPPPPPP P +++ Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPAPPSETTII 57 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 P PPPPPPPPPPPPPPPPPPPP Sbjct: 22 PRSETPPPPPPPPPPPPPPPPPPPP 46 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPPPPPPPPPPP P Sbjct: 22 PRSETPPPPPPPPPPPPPPPPPPPPPP 48 [184][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 69.7 bits (169), Expect = 1e-10 Identities = 31/46 (67%), Positives = 32/46 (69%), Gaps = 7/46 (15%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPP------PPPPPPLAP-KHNSL 55 PS PPPPPPPPPP PPPPPPPP PPPPPPL P +H SL Sbjct: 266 PSLPPQPPPPPPPPPPLPPPPPPPPLPPQPPPPPPPPLQPQQHKSL 311 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/33 (72%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPP-PPPPPPPPLAPK 67 + PP PP PPPPPPPPPP PPPPPPPPL P+ Sbjct: 262 TFQPPSLPPQPPPPPPPPPPLPPPPPPPPLPPQ 294 [185][TOP] >UniRef100_Q96PY5-3 Isoform 2 of Formin-like protein 2 n=1 Tax=Homo sapiens RepID=Q96PY5-3 Length = 1092 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 9/45 (20%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP---------PPPPLAP 70 N P T PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 589 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L +++ P T + P PP PPPPPPPPPPPPPPPPPP P Sbjct: 533 LPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 573 [186][TOP] >UniRef100_Q96PY5 Formin-like protein 2 n=1 Tax=Homo sapiens RepID=FMNL2_HUMAN Length = 1086 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 9/45 (20%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPP---------PPPPLAP 70 N P T PPPPPPPPPPPPPPPPPPPPP P PPLAP Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAP 589 Score = 63.9 bits (154), Expect = 5e-09 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L +++ P T + P PP PPPPPPPPPPPPPPPPPP P Sbjct: 533 LPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 573 [187][TOP] >UniRef100_UPI00005A3937 PREDICTED: similar to formin-like 2 isoform B n=1 Tax=Canis lupus familiaris RepID=UPI00005A3937 Length = 1119 Score = 69.3 bits (168), Expect = 1e-10 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S++PP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 573 SVTPPMPPPPPPPPPPPPPPPPPPPPPLPGP 603 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 +P + PP PPPPPPPPPPPPPPPPPPPPPL Sbjct: 568 LPVVASVTPPMPPPPPPPPPPPPPPPPPPPPPL 600 Score = 65.9 bits (159), Expect = 1e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPPPP P P A Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPLPGPAA 605 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/63 (47%), Positives = 35/63 (55%), Gaps = 13/63 (20%) Frame = -3 Query: 219 EGEE*IFVILVDTNNIPSTSISPPPPPPPPPPPPPPPP-------------PPPPPPPPP 79 +G+ I ++ V + P PPPPPPPPPPPPPPPP PP PPPPPP Sbjct: 560 KGDGDIAILPVVASVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLPPPPPP 619 Query: 78 LAP 70 AP Sbjct: 620 SAP 622 [188][TOP] >UniRef100_UPI00016E72E1 UPI00016E72E1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72E1 Length = 951 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 10/47 (21%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPP----------PPPPPPLAP 70 N S S + PPPPPPPPPPPPPPPPPP PPPPPPLAP Sbjct: 444 NGPSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 490 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 S + P P P PPPPPPPPPPPPPPPPP Sbjct: 441 SMANGPSSPSPAAPPPPPPPPPPPPPPPPP 470 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S++ P P P PPPPPPPPPPPPPPP P Sbjct: 441 SMANGPSSPSPAAPPPPPPPPPPPPPPPPPP 471 [189][TOP] >UniRef100_UPI00016E72E0 UPI00016E72E0 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72E0 Length = 1054 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 10/47 (21%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPP----------PPPPPPLAP 70 N S S + PPPPPPPPPPPPPPPPPP PPPPPPLAP Sbjct: 518 NGPSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 564 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 18/44 (40%) Frame = -3 Query: 156 SPPPPPPPPP------------------PPPPPPPPPPPPPPPP 79 +PPPPPPPPP PPPPPPPPPPPPPPPP Sbjct: 500 APPPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPP 543 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 18/43 (41%) Frame = -3 Query: 153 PPPPPPPP------------------PPPPPPPPPPPPPPPPP 79 PPPPPPPP PPPPPPPPPPPPPPPPP Sbjct: 502 PPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPP 544 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 16/48 (33%) Frame = -3 Query: 174 IPSTSISPPPPPPP----------------PPPPPPPPPPPPPPPPPP 79 +P+ PPPPP P PPPPPPPPPPPPPPPPPP Sbjct: 498 MPAPPPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPPP 545 [190][TOP] >UniRef100_UPI00016E72DE UPI00016E72DE related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72DE Length = 1032 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 10/47 (21%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPP----------PPPPPPLAP 70 N S S + PPPPPPPPPPPPPPPPPP PPPPPPLAP Sbjct: 506 NGPSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 552 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 18/44 (40%) Frame = -3 Query: 156 SPPPPPPPPP------------------PPPPPPPPPPPPPPPP 79 +PPPPPPPPP PPPPPPPPPPPPPPPP Sbjct: 488 APPPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPP 531 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 18/43 (41%) Frame = -3 Query: 153 PPPPPPPP------------------PPPPPPPPPPPPPPPPP 79 PPPPPPPP PPPPPPPPPPPPPPPPP Sbjct: 490 PPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPP 532 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 16/48 (33%) Frame = -3 Query: 174 IPSTSISPPPPPPP----------------PPPPPPPPPPPPPPPPPP 79 +P+ PPPPP P PPPPPPPPPPPPPPPPPP Sbjct: 486 MPAPPPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPPP 533 [191][TOP] >UniRef100_UPI00016E72DD UPI00016E72DD related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72DD Length = 1092 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 10/47 (21%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPP----------PPPPPPLAP 70 N S S + PPPPPPPPPPPPPPPPPP PPPPPPLAP Sbjct: 550 NGPSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 596 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 18/44 (40%) Frame = -3 Query: 156 SPPPPPPPPP------------------PPPPPPPPPPPPPPPP 79 +PPPPPPPPP PPPPPPPPPPPPPPPP Sbjct: 532 APPPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPP 575 Score = 60.8 bits (146), Expect = 4e-08 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 18/43 (41%) Frame = -3 Query: 153 PPPPPPPP------------------PPPPPPPPPPPPPPPPP 79 PPPPPPPP PPPPPPPPPPPPPPPPP Sbjct: 534 PPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPP 576 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 16/48 (33%) Frame = -3 Query: 174 IPSTSISPPPPPPP----------------PPPPPPPPPPPPPPPPPP 79 +P+ PPPPP P PPPPPPPPPPPPPPPPPP Sbjct: 530 MPAPPPPPPPPPLPVNGTLANGPSSPSPAAPPPPPPPPPPPPPPPPPP 577 [192][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 69.3 bits (168), Expect = 1e-10 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ +PPPPPPPPPPP PPPPP PPPPPPP P Sbjct: 618 PAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPP 651 Score = 66.2 bits (160), Expect = 1e-09 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + +PPP PPPPPPPPP PPPPP PPPPP P Sbjct: 658 PPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPP 691 Score = 65.9 bits (159), Expect = 1e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPP PPPPPPP PPPP AP Sbjct: 629 PPPPPPAPPPPPAPPPPPPPAPPPPPAP 656 Score = 65.1 bits (157), Expect = 2e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP PPPPPPPPPPP PPPPP PPPP P Sbjct: 615 PPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPP 648 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPP PPPPP PPPPPPP P P Sbjct: 620 PPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPP 653 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPP PPPPPPP PPPPP P Sbjct: 630 PPPPPAPPPPPAPPPPPPPAPPPPPAPP 657 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + +PP P PPP PPPPPPPPPPP PPPP AP Sbjct: 609 PPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAP 642 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPP PPPPP PPPPPPP PP P Sbjct: 621 PPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPP 654 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P+ +PPPPPPPPP PPPPP PPPPP PPP Sbjct: 662 PAPPPAPPPPPPPPPAPPPPPAPPPPPAPPP 692 Score = 63.5 bits (153), Expect = 7e-09 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P +PPPPP PPPPPPP PPPPP PPPPP Sbjct: 630 PPPPPAPPPPPAPPPPPPPAPPPPPAPPPPP 660 Score = 63.5 bits (153), Expect = 7e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPP PPPPPPP PPPPP PPPPP AP Sbjct: 631 PPPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAP 664 Score = 63.5 bits (153), Expect = 7e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPP PPPPP P PPP PPPPPPPP AP Sbjct: 645 PPPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAP 678 Score = 63.5 bits (153), Expect = 7e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPP P PPP PPPPPPPPP PPPP AP Sbjct: 651 PPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAP 684 Score = 63.5 bits (153), Expect = 7e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPPPPPPP PPPPP PPPP AP Sbjct: 657 PPPPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAP 690 Score = 63.5 bits (153), Expect = 7e-09 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P + PPPPPPP PPPPP PPPPP PPPPP Sbjct: 664 PPPAPPPPPPPPPAPPPPPAPPPPPAPPPPP 694 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPP PPPPP PPPPP PPPP A Sbjct: 669 PPPPPPPPAPPPPPAPPPPPAPPPPPA 695 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P P P PPP PPPPPPPPPPP PPPPP P Sbjct: 610 PPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPP 643 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ PPP PPPPPPPPPPP PPPPP PP P Sbjct: 613 PAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPP 646 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPP PPPPPPP PPPPP PPPPP P P Sbjct: 632 PPPAPPPPPAPPPPPPPAPPPPPAPPPPPAPAPP 665 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +PPPPPPP PPPPP PPPPP P PPP P Sbjct: 636 PPPPPAPPPPPPPAPPPPPAPPPPPAPAPPPAPP 669 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPP PPPPP P PPP PPPPPPPPP P Sbjct: 646 PPPAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPP 679 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPP P PPP PPPPPPPPP PPPPP P Sbjct: 652 PPPAPPPPPAPAPPPAPPPPPPPPPAPPPPPAPP 685 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ + P PPPPPPPPP PPPPP PPPPP P P Sbjct: 660 PAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPPP 693 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP PPPPPPPPP PPPPP PPPPP P Sbjct: 659 PPAPAPPPAPPPPPPPPPAPPPPPAPPPPPAPPP 692 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + +PPP P PP P PPP PPPPPPPPPP AP Sbjct: 603 PPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAP 636 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPP PPPPP PP P Sbjct: 668 PPPPPPPPPAPPPPPAPPPPPAPPPPP 694 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP P PP P PPP PPPPPPPPPPP P Sbjct: 604 PPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPP 637 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ +P PP P PPP PPPPPPPPPPP PP P Sbjct: 607 PAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPP 640 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ + P PPP PPPPPPPPPPP PPPPP P Sbjct: 611 PAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPP 644 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ + P P PP P PPP PPPPPPPPPPP P Sbjct: 605 PAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPP 638 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +P PPP P PP P PPP PPPPPPPP P Sbjct: 601 PPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPP 634 [193][TOP] >UniRef100_B0SVF7 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0SVF7_CAUSK Length = 409 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/41 (73%), Positives = 30/41 (73%), Gaps = 4/41 (9%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPP----PPPPPPPLA 73 T I T SPPPPPPPPPPPPPPPPPP PPPPPPP A Sbjct: 256 TLGIRYTFGSPPPPPPPPPPPPPPPPPPEPPAPPPPPPPAA 296 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPP PP PPPP P Sbjct: 267 PPPPPPPPPPPPPPPPPEPPAPPPPPPP 294 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNS 58 PPPPPPPPPPPPPPP PP PPPPPP A + + Sbjct: 269 PPPPPPPPPPPPPPPEPPAPPPPPPPAAAYEA 300 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPP PP P P Sbjct: 266 PPPPPPPPPPPPPPPPPPEPPAPPPP 291 [194][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 69.3 bits (168), Expect = 1e-10 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 3/35 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP---PPPPPPPPPPPPPL 76 P SPPPPPPPPPPPP PPPPPPPPPPPPP+ Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPV 479 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP---PPPPPPPPPPPPL 76 P SPPPPPPPPPPPPP PPPP PPPPPPP+ Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPV 494 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 3/34 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP---PPPPPPPPPPPP 79 P + PPPPPPPPPPPP PPPPPPPPPPPP Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP---PPPPPPPPPPPPPLAP 70 P SPPPP PPPPPPP PPPPPPPPPPPP +P Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSP 512 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 P SPPPPPPPPPP PPPPPPPPPPPP+ Sbjct: 432 PPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPV 463 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 11/42 (26%) Frame = -3 Query: 171 PSTSISPPPP--------PPPPPPPPPP---PPPPPPPPPPP 79 P T SPPPP PPPPPPPPPP PPPPPPPPPPP Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 6/37 (16%) Frame = -3 Query: 153 PPP---PPPPPPPPPPPP---PPPPPPPPPPLAPKHN 61 PPP PPPPPPPPPPPP PPPPPPPPPP P ++ Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYS 481 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP---PPPPPPPPPPPPL 76 P + PPPP PPPPPPP PPPPPPPPPPPP+ Sbjct: 475 PPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPV 509 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/34 (70%), Positives = 25/34 (73%), Gaps = 3/34 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPP---PPPPPPPPPPP 79 P + PPPPPPPPPPPPP PPPP PPPPPP Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 5/32 (15%) Frame = -3 Query: 156 SPPPPPPP--PPPPPPPPPPPPP---PPPPPL 76 SPPPPPPP PPPPPPPPPPPP PPPPP+ Sbjct: 486 SPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPV 517 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/37 (67%), Positives = 27/37 (72%), Gaps = 6/37 (16%) Frame = -3 Query: 153 PPP---PPPPPPPPPPPPP---PPPPPPPPPLAPKHN 61 PPP PPPPPPPPPPPPP PPPP PPPP P ++ Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYS 496 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 7/41 (17%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP---PPPPP----PPPPPPPPLAP 70 P SPPPPPPPPPPPP PPPPP PPPPP P P Sbjct: 491 PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP---PPPPP---PPPPPPPLAP 70 P + PPPPPPPPPPPP PPPPP PPPPP AP Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/50 (50%), Positives = 28/50 (56%), Gaps = 15/50 (30%) Frame = -3 Query: 174 IPSTSISPPPPP------------PPPPPPPPP---PPPPPPPPPPPLAP 70 +P S+ PPPP PPPP PPPP PPPPPPPPPP +P Sbjct: 402 LPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSP 451 [195][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 69.3 bits (168), Expect = 1e-10 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +T ST PPPPPPPPPPPPP PPPPPP PPPP P Sbjct: 425 ETEIFASTPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPP 463 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 PPPPPPPPPP PPPPPP PPPPPPP P ++N Sbjct: 439 PPPPPPPPPPTPPPPPPRPPPPPPPPPPVEKVIVN 473 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQFVFLLPR 4 PPPPPPPPPPP PPPPPP PPPPPP P ++ + + + + V PR Sbjct: 438 PPPPPPPPPPPTPPPPPPRPPPPPPPPPPVEKVIVNPIVKPEKRVSTPPR 487 Score = 66.6 bits (161), Expect = 8e-10 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 I T P PPPPPPP PPPPPP PPPPPPPPPP+ Sbjct: 428 IFASTPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPPPPV 467 Score = 57.4 bits (137), Expect = 5e-07 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 138 PPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPP PPP P+ Sbjct: 433 PPPPPPPPPPPPPPPPTPPPPPPR 456 [196][TOP] >UniRef100_A9TWA3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWA3_PHYPA Length = 2209 Score = 69.3 bits (168), Expect = 1e-10 Identities = 27/37 (72%), Positives = 29/37 (78%), Gaps = 3/37 (8%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPP---PPPPPPPPPPPL 76 ++P S PPPPPPPPPPPPPP PPPPPPPPPPL Sbjct: 1574 SLPGKSAPPPPPPPPPPPPPPPGRSAPPPPPPPPPPL 1610 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/29 (82%), Positives = 24/29 (82%), Gaps = 3/29 (10%) Frame = -3 Query: 153 PPPPPPPPPPPP---PPPPPPPPPPPPPL 76 PPPPPPPPPPPP PPPPPPPPPP PL Sbjct: 1584 PPPPPPPPPPPPGRSAPPPPPPPPPPLPL 1612 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/39 (61%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPP----PPPPPPPLAP 70 +P + PPPPPPPPPPPPPPP PPPPPPP P Sbjct: 1571 LPPSLPGKSAPPPPPPPPPPPPPPPGRSAPPPPPPPPPP 1609 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 16/45 (35%) Frame = -3 Query: 153 PPPPP------PPPPPPP-----PPPPPPP-----PPPPPPLAPK 67 PPPPP PPPPPPP PPPPPPP PPPPPPL K Sbjct: 1698 PPPPPGGRGVAPPPPPPPGGRGAPPPPPPPGGRGAPPPPPPLGKK 1742 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 9/43 (20%) Frame = -3 Query: 171 PSTSISP--PPPPPPP-------PPPPPPPPPPPPPPPPPLAP 70 P S P PPPP PP PPPPPPPPPPPPPPP AP Sbjct: 1558 PGKSAPPRRPPPPLPPSLPGKSAPPPPPPPPPPPPPPPGRSAP 1600 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/56 (48%), Positives = 27/56 (48%), Gaps = 22/56 (39%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP--------PPPPP--------------PPPPPPPPPLAP 70 P S PPPPPPPPPP PPPPP PPPPPPPPL P Sbjct: 1593 PPPGRSAPPPPPPPPPPLPLGGRAAPPPPPGGRAAPPPPPGGRAAPPPPPPPPLPP 1648 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/47 (53%), Positives = 26/47 (55%), Gaps = 16/47 (34%) Frame = -3 Query: 171 PSTSISPPPPPPPPP--------PPPPPPPP--------PPPPPPPP 79 P + PPPPPPPP PPPPPPPP PPPPPPPP Sbjct: 1631 PPGGRAAPPPPPPPPLPPGGRAAPPPPPPPPLPPGGRAAPPPPPPPP 1677 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/52 (51%), Positives = 28/52 (53%), Gaps = 18/52 (34%) Frame = -3 Query: 171 PSTSISPPPPPPPP--------PPPPPPPP-----PPPPPPP-----PPLAP 70 P +PPPPPPPP PPPPPPPP PPPPPPP PP P Sbjct: 1648 PGGRAAPPPPPPPPLPPGGRAAPPPPPPPPGGRAAPPPPPPPGGRGAPPPPP 1699 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/52 (51%), Positives = 28/52 (53%), Gaps = 18/52 (34%) Frame = -3 Query: 171 PSTSISPPPPPPPP-------PPPPP-----PPPPPPPP------PPPPLAP 70 P +PPPPPPPP PPPPP PPPPPPPP PPPP P Sbjct: 1664 PGGRAAPPPPPPPPGGRAAPPPPPPPGGRGAPPPPPPPPGGRGVAPPPPPPP 1715 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 13/44 (29%) Frame = -3 Query: 174 IPSTSISPPPPPPPPP--------PPPPPPPP-----PPPPPPP 82 +P + PPPPPPPP PPPPPPPP PPPPPPP Sbjct: 1646 LPPGGRAAPPPPPPPPLPPGGRAAPPPPPPPPGGRAAPPPPPPP 1689 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 14/42 (33%) Frame = -3 Query: 159 ISPPPPPPP-----PPPPPPP-----PPPPPP----PPPPPL 76 ++PPPPPPP PPPPPPP PPPPPP PPPP L Sbjct: 1707 VAPPPPPPPGGRGAPPPPPPPGGRGAPPPPPPLGKKPPPPAL 1748 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/55 (49%), Positives = 29/55 (52%), Gaps = 20/55 (36%) Frame = -3 Query: 174 IPSTSISPPPPPP-----PPPPP-----PPPPPP----------PPPPPPPPLAP 70 +P + PPPPP PPPPP PPPPPP PPPPPPPPL P Sbjct: 1610 LPLGGRAAPPPPPGGRAAPPPPPGGRAAPPPPPPPPLPPGGRAAPPPPPPPPLPP 1664 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/50 (52%), Positives = 27/50 (54%), Gaps = 19/50 (38%) Frame = -3 Query: 171 PSTSISPPPPPPP--------PPPPP------PPPPPPP-----PPPPPP 79 P +PPPPPPP PPPPP PPPPPPP PPPPPP Sbjct: 1677 PGGRAAPPPPPPPGGRGAPPPPPPPPGGRGVAPPPPPPPGGRGAPPPPPP 1726 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/57 (47%), Positives = 28/57 (49%), Gaps = 23/57 (40%) Frame = -3 Query: 171 PSTSISPPPPPPPP----------PPPPPP--------PPPPPPPP-----PPPLAP 70 P +PPPPPPPP PPPPPP PPPPPPPP PPP P Sbjct: 1632 PGGRAAPPPPPPPPLPPGGRAAPPPPPPPPLPPGGRAAPPPPPPPPGGRAAPPPPPP 1688 [197][TOP] >UniRef100_A2YHG8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2YHG8_ORYSI Length = 278 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 10/42 (23%) Frame = -3 Query: 153 PPPPPPP----PPPPPPPPPPPPPPPPPPL------APKHNS 58 PPPPPPP PPPPPPPPPPPPPPPPPPL AP+ NS Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPPPPPPLFTRRSHAPQDNS 134 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPP PPPPPPPPPPPP P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPPPPPP P Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPP 100 P +S SPPPPPPPPPPPPPPPPPP Sbjct: 98 PPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPP 94 P S PPPPPPPPPPPPPPPPPP Sbjct: 96 PPPPSSGSPPPPPPPPPPPPPPPPPP 121 [198][TOP] >UniRef100_Q5CS67 Signal peptide containing large protein with proline stretches n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CS67_CRYPV Length = 1884 Score = 69.3 bits (168), Expect = 1e-10 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS+ S PPPPPPPPPPPPPPPPPPP PPP P Sbjct: 1538 PSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPP 1571 Score = 68.9 bits (167), Expect = 2e-10 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -3 Query: 165 TSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +S PPPPPPPPPPPPPPPPPP PPP PP +P Sbjct: 1542 SSAPPPPPPPPPPPPPPPPPPPSPPPSPPPSP 1573 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +S S PPPPPPPPPPPPPPPPPPP PPP P Sbjct: 1537 PPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPP 1570 Score = 65.1 bits (157), Expect = 2e-09 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 P +S S PPPPPPPPPPPPPPPPPPPPP +P + Sbjct: 1172 PPSSGSFTPPPPPPPPPPPPPPPPPPPPPSYTSPSN 1207 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -3 Query: 171 PSTSISPPP------PPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 P + PPP PPPPPPPPPPPPPPPPPPPPP N + Sbjct: 1165 PPSPPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPPPSYTSPSNGI 1209 Score = 64.7 bits (156), Expect = 3e-09 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 5/41 (12%) Frame = -3 Query: 156 SPPPPPPP-----PPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 SPP PPP PPPPPPPPPPPPPPPPPP P + S N Sbjct: 1167 SPPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPPPSYTSPSN 1207 Score = 64.3 bits (155), Expect = 4e-09 Identities = 25/34 (73%), Positives = 26/34 (76%), Gaps = 6/34 (17%) Frame = -3 Query: 153 PPP------PPPPPPPPPPPPPPPPPPPPPPLAP 70 PPP PPPPPPPPPPPPPPPPPPP PP +P Sbjct: 1536 PPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSP 1569 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 S S +PPPPP PPPPPPPPPP PP PPP P + L N Sbjct: 1415 SGSSAPPPPPHSPPPPPPPPPPSSPPSPPPSPPPYTPLSN 1454 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 5/44 (11%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPP-----PPPPPPPLAPKHNSL 55 PS+ S PPPPP PPPPPPPPPP PPP PPP P N + Sbjct: 1413 PSSGSSAPPPPPHSPPPPPPPPPPSSPPSPPPSPPPYTPLSNRI 1456 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 6/44 (13%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPP------PPPPPPPPPPPPPPPPPLAP 70 TN P P PP PPP PPPPPPPPPPPPPPPPP P Sbjct: 1156 TNIGPFGQRPPSPPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPP 1199 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEED 31 P SPPPPPPPPPP PP PPP PPP PL+ + S ++++ +E+ Sbjct: 1421 PPPPHSPPPPPPPPPPSSPPSPPPSPPPYTPLSNRIPSHISTQKDEN 1467 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 ++ P PPPPPPPPPPPPP PPP PPP P Sbjct: 1542 SSAPPPPPPPPPPPPPPPPPPPSPPPSPPPSP 1573 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 PPPPPPPPPPPPPPPPPP P P H Sbjct: 1183 PPPPPPPPPPPPPPPPPPSYTSPSNGIPSH 1212 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 6/44 (13%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPP------PPPPPPPPPPPPPPPPPLAP 70 TN P P PP PPP PPPPP PPPPPPPPPP +P Sbjct: 1396 TNIGPFGQRPPSPPHPPPSSGSSAPPPPPHSPPPPPPPPPPSSP 1439 [199][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 69.3 bits (168), Expect = 1e-10 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDT 28 P + PPPPPP PPPPPPPPPPPPPP PP P ++ S + DT Sbjct: 312 PPPPLPSPPPPPPTPPPPPPPPPPPPPPNPPFIPPAEPVIPSFADFDT 359 Score = 67.4 bits (163), Expect = 5e-10 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -3 Query: 156 SPPPPPPPPP---PPPPPPPPPPPPPPPPLAPKHN 61 SPPPPPPPPP PPPPPP PPPPPPPPP P N Sbjct: 306 SPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPPPN 340 Score = 65.1 bits (157), Expect = 2e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPPPP P PPPPPP PPPPPPPP P Sbjct: 303 PPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPPP 336 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 10/44 (22%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP----------PPPPPPPPPPPPPPLAP 70 P + P PPPPPPPPP PPPPPPPPPPPPPP P Sbjct: 299 PPATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPPPNPP 342 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 10/44 (22%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPP----------PPPPPPPPPPLAP 70 PST PPP PPPPPPPPP PPPPPPPPPP P Sbjct: 295 PSTRPPATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPP 338 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/51 (49%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPP--PPPPPLAPKHNSLLNSKLEEDT 28 +PS PP PPPPPPPPPPPPPP PP PP P+ P + + D+ Sbjct: 316 LPSPPPPPPTPPPPPPPPPPPPPPNPPFIPPAEPVIPSFADFDTYEFDHDS 366 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPP---PPPPPPLAP 70 P S PP PPP PPPPPPPPP PPPPPP P Sbjct: 291 PQIRPSTRPPATPPPSPPPPPPPPPLPSPPPPPPTPP 327 [200][TOP] >UniRef100_A5DRR5 Putative uncharacterized protein n=1 Tax=Lodderomyces elongisporus RepID=A5DRR5_LODEL Length = 996 Score = 69.3 bits (168), Expect = 1e-10 Identities = 30/54 (55%), Positives = 33/54 (61%), Gaps = 9/54 (16%) Frame = -3 Query: 156 SPPPPPPPPPP---------PPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQF 22 SPPPPPPPPPP PPPPPPPPPPPPPPP +P S +S T + Sbjct: 942 SPPPPPPPPPPSLIPFGASPPPPPPPPPPPPPPPPHSPSSPSSTSSSATFTTAY 995 Score = 66.2 bits (160), Expect = 1e-09 Identities = 28/52 (53%), Positives = 29/52 (55%), Gaps = 8/52 (15%) Frame = -3 Query: 153 PPPPPPPPPPPPP--------PPPPPPPPPPPPLAPKHNSLLNSKLEEDTQF 22 PP PPPPPPPPPP PPPPPPPPPPPP P H+ S F Sbjct: 940 PPSPPPPPPPPPPSLIPFGASPPPPPPPPPPPPPPPPHSPSSPSSTSSSATF 991 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 8/46 (17%) Frame = -3 Query: 171 PSTSISPPPPPP--------PPPPPPPPPPPPPPPPPPPLAPKHNS 58 PS PPPPPP PPPPPPPPPPPPPPPP P +P S Sbjct: 941 PSPPPPPPPPPPSLIPFGASPPPPPPPPPPPPPPPPHSPSSPSSTS 986 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 8/36 (22%) Frame = -3 Query: 153 PPPPPPPPPPPPPPP--------PPPPPPPPPPLAP 70 P PP PPPPPPPPPP PPPPPPPPPP P Sbjct: 938 PQPPSPPPPPPPPPPSLIPFGASPPPPPPPPPPPPP 973 [201][TOP] >UniRef100_UPI0001795F40 PREDICTED: leiomodin 2 (cardiac) n=1 Tax=Equus caballus RepID=UPI0001795F40 Length = 549 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 4/39 (10%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPP----PPPPPPPPPPLAPK 67 P + + PP PPPPPPPPPPPP PPPPPPPPPPL K Sbjct: 416 PQSPVVPPAPPPPPPPPPPPPPQRLPPPPPPPPPPLPEK 454 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 +P PPPPPPPPPP PPPPPPPPPP P Sbjct: 421 VPPAPPPPPPPPPPPPPQRLPPPPPPPPPPLP 452 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/46 (56%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -3 Query: 153 PPPPPPPPPPP---PPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 PPPPPPPPPPP PPPPPPPPPP P N K +E Q Sbjct: 427 PPPPPPPPPPPQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQ 472 [202][TOP] >UniRef100_UPI0000DA3EC9 PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor n=1 Tax=Rattus norvegicus RepID=UPI0000DA3EC9 Length = 604 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 5/58 (8%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPP-----PPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 + T+ +P+T + PPPPP PPPPP P PPPPPPPPPPPP P +++ E Sbjct: 359 LTTSTSPVPTTPLPPPPPPLPPPPPRPVPPPAPPPPPPPPPPPPRPPPPPAIVRPPAE 416 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P PPPP PPP PPPPPPPPPPPPPPPP Sbjct: 467 PEKKEKPPPPVPPPTPPPPPPPPPPPPPPPP 497 Score = 65.9 bits (159), Expect = 1e-09 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PP PPP PPPPPPPPPPPPPPPPPP+ Sbjct: 475 PPVPPPTPPPPPPPPPPPPPPPPPPV 500 Score = 65.5 bits (158), Expect = 2e-09 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 PPP PPP PPPPPPPPPPPPPPPPP Sbjct: 474 PPPVPPPTPPPPPPPPPPPPPPPPP 498 Score = 65.5 bits (158), Expect = 2e-09 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPP PPPPPPPPPPPPPPPPPP AP Sbjct: 476 PVPPPTPPPPPPPPPPPPPPPPPPVKAP 503 Score = 63.9 bits (154), Expect = 5e-09 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPP PPP PPPPPPPPPPPPPPP P Sbjct: 473 PPPPVPPPTPPPPPPPPPPPPPPPPPP 499 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P + PP PPPPPPPPPPPPPPPPPP P Sbjct: 473 PPPPVPPPTPPPPPPPPPPPPPPPPPPVKAP 503 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/28 (82%), Positives = 24/28 (85%), Gaps = 3/28 (10%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPP---PPL 76 PPP PPPPPPPPPPPPPPPPPP PP+ Sbjct: 478 PPPTPPPPPPPPPPPPPPPPPPVKAPPI 505 Score = 57.4 bits (137), Expect = 5e-07 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPP 85 +PPPPPPPPPPPPPPPPPP PP Sbjct: 481 TPPPPPPPPPPPPPPPPPPVKAPP 504 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 13/52 (25%) Frame = -3 Query: 183 TNNIPST---SISPPPP---PPPPPPPPPPPP-------PPPPPPPPPLAPK 67 T+ +P+T S SP P PPPPPP PPPPP PPPPPPPPP P+ Sbjct: 352 TSTLPTTLTTSTSPVPTTPLPPPPPPLPPPPPRPVPPPAPPPPPPPPPPPPR 403 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 PPPPPPPPPPPP PPPPP PP P LL++ Sbjct: 391 PPPPPPPPPPPPRPPPPPAIVRPPAEPSKEVLLST 425 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S S+ P PPPP PPP PPPPPPPPPP P Sbjct: 462 SHSLYPEKKEKPPPPVPPPTPPPPPPPPPPPPP 494 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPP 91 +P + PPPPPPPPPPPPPPPP PP Sbjct: 477 VPPPTPPPPPPPPPPPPPPPPPPVKAPP 504 [203][TOP] >UniRef100_UPI0000D9A916 PREDICTED: similar to leiomodin 2 (cardiac) isoform 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9A916 Length = 552 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 5/40 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPP-----PPPPPPPPPPLAPK 67 P + ++ PPPPPPPPPPPPPP PPPPPPPPPPL K Sbjct: 413 PLSPVATPPPPPPPPPPPPPPSSQRLPPPPPPPPPPLPEK 452 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/53 (50%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = -3 Query: 168 STSISPPPPPPPPPPP-----PPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 +T PPPPPPPPPPP PPPPPPPPPP P N K +E Q Sbjct: 418 ATPPPPPPPPPPPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQ 470 [204][TOP] >UniRef100_UPI0000D9A914 PREDICTED: similar to leiomodin 2 (cardiac) isoform 3 n=1 Tax=Macaca mulatta RepID=UPI0000D9A914 Length = 547 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/40 (67%), Positives = 30/40 (75%), Gaps = 5/40 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPP-----PPPPPPPPPPLAPK 67 P + ++ PPPPPPPPPPPPPP PPPPPPPPPPL K Sbjct: 413 PLSPVATPPPPPPPPPPPPPPSSQRLPPPPPPPPPPLPEK 452 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/53 (50%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = -3 Query: 168 STSISPPPPPPPPPPP-----PPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 +T PPPPPPPPPPP PPPPPPPPPP P N K +E Q Sbjct: 418 ATPPPPPPPPPPPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQ 470 [205][TOP] >UniRef100_UPI000184A345 DMRT-like family B with proline-rich C-terminal, 1 n=1 Tax=Canis lupus familiaris RepID=UPI000184A345 Length = 346 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPPPPPPPPPPPPPPPPP P P Sbjct: 256 PSYYPLPPPPPPPPPPPPPPPPPPPPPPQPQFLP 289 Score = 66.6 bits (161), Expect = 8e-10 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 + PPPPPPPPPPPPPPPPPPPPP P L P S L+ Sbjct: 261 LPPPPPPPPPPPPPPPPPPPPPPQPQFLPPGFLSALH 297 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 147 PPPPPPPPPPPPPPPPPPPPPPPLAPK 67 P PPPPPPPPPPPPPPPPPPPPP P+ Sbjct: 260 PLPPPPPPPPPPPPPPPPPPPPPPQPQ 286 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 P P P PPPPPPPPPPPPPPPPPPP P+ Sbjct: 250 PVGDFQPSYYPLPPPPPPPPPPPPPPPPPPPPPPQ 284 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 16/48 (33%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPP----------------PPPPPPPPP 79 +P PPPPPPPPPPPPPPPP PP PPPPPP Sbjct: 261 LPPPPPPPPPPPPPPPPPPPPPPQPQFLPPGFLSALHFLPPLPPPPPP 308 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -3 Query: 138 PPPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 P PPPPPPPPPPPPPPPPPP P L Sbjct: 260 PLPPPPPPPPPPPPPPPPPPPPPPQPQFL 288 [206][TOP] >UniRef100_B4W5S8 OmpA family protein n=1 Tax=Brevundimonas sp. BAL3 RepID=B4W5S8_9CAUL Length = 385 Score = 68.9 bits (167), Expect = 2e-10 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPP P+ P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPAPVKP 274 Score = 66.6 bits (161), Expect = 8e-10 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPP 82 +PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 247 APPPPPPPPPPPPPPPPPPPPPPAP 271 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 144 PPPPPPPPPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPPPPP K Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPAPVK 273 Score = 63.5 bits (153), Expect = 7e-09 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPPP P P A Sbjct: 250 PPPPPPPPPPPPPPPPPPPPAPVKPAA 276 [207][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPP PPPPPPPPPPP P P Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPPPPPP PPPPPPPPPPP PPP P Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPP PPPPPPPPPPP PPPPP P Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPPPPP PPPPPPPPPPP P P Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPPPPPP PPPPPPPPPPP PPP P Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPPPPP PPPPPPPPPPP PPPPP P Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 68.6 bits (166), Expect = 2e-10 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + P PPPPPPPPPPP PPPPPPPPPPP P Sbjct: 201 VEPQPPPPPPPPPPPSPPPPPPPPPPPSPP 230 Score = 68.2 bits (165), Expect = 3e-10 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = -3 Query: 195 ILVDTNNIPSTSISPPPPPPPPPPPPPPP-PPPPPPPPPPLAP 70 I+V+ P PPP PPPPPPPPPPP PPPPPPPPPP +P Sbjct: 199 IVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 67.8 bits (164), Expect = 4e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPP PPPPPPPPPPP PPPP P Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 67.8 bits (164), Expect = 4e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPP PPPPPPPPPPP PPPP P Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPPPP PPPPPPP +P Sbjct: 235 PPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPP PPPPPPPPPPP PP P Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 67.4 bits (163), Expect = 5e-10 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPPPPP PPPPPPPPPPP PP P Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 67.4 bits (163), Expect = 5e-10 Identities = 27/37 (72%), Positives = 28/37 (75%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPP---PPPPPLAP 70 P SPPPPPPPPPPP PPPPPPPP PPPPP +P Sbjct: 235 PPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSP 271 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + P PPPPPPPPPPP PPPPPPPPPP +P Sbjct: 196 PQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSP 229 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S SPPPPPP P PPPPPPPP PPP PPP P Sbjct: 258 PPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFVP 291 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPP---PPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPP PPPPPP P PPPPPPPP P Sbjct: 247 PPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPP 283 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPP P PPPPPP +P Sbjct: 246 PPPPPPSPPPPPPPPSPSPPPPPPSPSP 273 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP---PPPPPPPPPPPPLAP 70 PS PPPP P PPPPPP PPPPPPPP PPP P Sbjct: 251 PSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPP 287 [208][TOP] >UniRef100_A7R244 Chromosome undetermined scaffold_398, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R244_VITVI Length = 822 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNS 46 +S PPPPPPP PPPPPPPPPPPPPPP L N ++ S Sbjct: 332 VSAPPPPPPPRPPPPPPPPPPPPPPPALKNVENPMIPS 369 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 I S + P PPPPPPP PPPPPPPPPPPPP Sbjct: 324 ISSAFLKPVSAPPPPPPPRPPPPPPPPPPPPP 355 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPP 88 S PPPPPP PPPPPPPPPPPPPPP Sbjct: 333 SAPPPPPPPRPPPPPPPPPPPPPPP 357 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/42 (57%), Positives = 27/42 (64%), Gaps = 10/42 (23%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP----------PPPPL 76 P ++ PPPPP PPPPPPPPPPPPPPP P PP+ Sbjct: 331 PVSAPPPPPPPRPPPPPPPPPPPPPPPALKNVENPMIPSPPI 372 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 S++ P PPPPPPP PPPPPPPPPPPP P ++ N Sbjct: 325 SSAFLKPVSAPPPPPPPRPPPPPPPPPPPPPPPALKNVEN 364 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/42 (52%), Positives = 25/42 (59%), Gaps = 8/42 (19%) Frame = -3 Query: 171 PSTSISPPP--------PPPPPPPPPPPPPPPPPPPPPPLAP 70 P +++ PP P PPPPPPP PPPPPPPPPP P Sbjct: 314 PMSTVESPPKISSAFLKPVSAPPPPPPPRPPPPPPPPPPPPP 355 [209][TOP] >UniRef100_Q86BM9 CG33003, isoform A n=1 Tax=Drosophila melanogaster RepID=Q86BM9_DROME Length = 579 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPP--PPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPP PPPPPPPP P+ Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEPR 493 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPPPPPP PPPPPPPPP P K++ Sbjct: 468 PPPPPPPPPPPPTEPPPPPPPPPEPRVKKYS 498 [210][TOP] >UniRef100_Q4CLZ3 Putative uncharacterized protein (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CLZ3_TRYCR Length = 624 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQF 22 PPPPPPPP PPPPPPPPPPPPPPP + SL+ S ++ Q+ Sbjct: 335 PPPPPPPPSPPPPPPPPPPPPPPPPSSFAASLVASLQQQKQQY 377 Score = 68.9 bits (167), Expect = 2e-10 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPP PPPPPPPPPPPPPPPP Sbjct: 335 PPPPPPPPSPPPPPPPPPPPPPPPP 359 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPP 82 +I PPPPPPP PPPPPPPPPPPPPPPP Sbjct: 333 TIPPPPPPPPSPPPPPPPPPPPPPPPP 359 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/43 (60%), Positives = 27/43 (62%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 25 PPPPP PPPPPPPPPPPPPPPP A SL K + Q Sbjct: 338 PPPPPSPPPPPPPPPPPPPPPPSSFAASLVASLQQQKQQYQPQ 380 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPP 97 L IP PP PPPPPPPPPPPPPPPP Sbjct: 328 LFTNGTIPPPPPPPPSPPPPPPPPPPPPPPPP 359 [211][TOP] >UniRef100_B7Z017 CG33003, isoform B n=1 Tax=Drosophila melanogaster RepID=B7Z017_DROME Length = 604 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPP--PPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPP PPPPPPPP P+ Sbjct: 488 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEPR 518 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPPPPPP PPPPPPPPP P K++ Sbjct: 493 PPPPPPPPPPPPTEPPPPPPPPPEPRVKKYS 523 [212][TOP] >UniRef100_B4NYJ9 GE18286 n=1 Tax=Drosophila yakuba RepID=B4NYJ9_DROYA Length = 622 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPP--PPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPP PPPPPPPP P+ Sbjct: 506 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEPR 536 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPP--PPPPPPLAPK 67 PPPPPPPPPPPPPPPPPPP PPPPPP P+ Sbjct: 504 PPPPPPPPPPPPPPPPPPPTEPPPPPPPPPE 534 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPPPPPP PPPPPPPPP P K++ Sbjct: 511 PPPPPPPPPPPPTEPPPPPPPPPEPRVKKYS 541 [213][TOP] >UniRef100_B4ND74 GK24962 n=1 Tax=Drosophila willistoni RepID=B4ND74_DROWI Length = 282 Score = 68.9 bits (167), Expect = 2e-10 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + + +P T P PPPPPPP PPPPPPPPPPPPP P P Sbjct: 71 EESKLPETIAPPAPPPPPPPTPPPPPPPPPPPPPTPPTP 109 Score = 65.5 bits (158), Expect = 2e-09 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPP PPPPPPPPPPPPP PP P+ P Sbjct: 85 PPPPPPTPPPPPPPPPPPPPTPPTPVLP 112 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 7/46 (15%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPP-------PPPPPPPPL 76 L +T P+ PPP PPPPPPPPPPPPP PPPPPPPP+ Sbjct: 75 LPETIAPPAPPPPPPPTPPPPPPPPPPPPPTPPTPVLPPPPPPPPV 120 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPP PPPPPPPPPPPPP PP P L P Sbjct: 86 PPPPPTPPPPPPPPPPPPPTPPTPVLPP 113 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/40 (62%), Positives = 28/40 (70%), Gaps = 5/40 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPP-----PPPPPPPPPPLAPK 67 P +PPPPPPPPPPPPP P PPPPPPPP +AP+ Sbjct: 86 PPPPPTPPPPPPPPPPPPPTPPTPVLPPPPPPPPVVIAPQ 125 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/46 (56%), Positives = 26/46 (56%), Gaps = 12/46 (26%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP-------PPPPPPP-----PPPPPPLAP 70 P PPPPPPPPPPPP PPPPPPP P PPP AP Sbjct: 87 PPPPTPPPPPPPPPPPPPTPPTPVLPPPPPPPPVVIAPQIPPPGAP 132 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/44 (52%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -3 Query: 198 VILVDT-NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + L+D + S P PP PPPPPPP PPPPPPPPP P Sbjct: 60 ITLLDAWREVEEESKLPETIAPPAPPPPPPPTPPPPPPPPPPPP 103 [214][TOP] >UniRef100_B4LT77 GJ19953 n=1 Tax=Drosophila virilis RepID=B4LT77_DROVI Length = 609 Score = 68.9 bits (167), Expect = 2e-10 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 + PPPPPPPPPPPPPPP PPPPPPPP P+ Sbjct: 494 VEPPPPPPPPPPPPPPPTEPPPPPPPPPEPR 524 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPPPPPP PPPPPPPPP P K++ Sbjct: 499 PPPPPPPPPPPPTEPPPPPPPPPEPRVKKYS 529 [215][TOP] >UniRef100_B3N3R7 GG25000 n=1 Tax=Drosophila erecta RepID=B3N3R7_DROER Length = 613 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPP--PPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPP PPPPPPPP P+ Sbjct: 497 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEPR 527 Score = 65.9 bits (159), Expect = 1e-09 Identities = 25/30 (83%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPP--PPPPPPLAPK 67 PPPPPPPPPPPPPPPPPP PPPPPP P+ Sbjct: 496 PPPPPPPPPPPPPPPPPPTEPPPPPPPPPE 525 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPPPPPP PPPPPPPPP P K++ Sbjct: 502 PPPPPPPPPPPPTEPPPPPPPPPEPRVKKYS 532 [216][TOP] >UniRef100_B3MU38 GF21178 n=1 Tax=Drosophila ananassae RepID=B3MU38_DROAN Length = 608 Score = 68.9 bits (167), Expect = 2e-10 Identities = 26/31 (83%), Positives = 27/31 (87%), Gaps = 2/31 (6%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPP--PPPPPPPPLAPK 67 PPPPPPPPPPPPPPPPP PPPPPPPP P+ Sbjct: 491 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEPR 521 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPPPPPP PPPPPPPPP P K++ Sbjct: 496 PPPPPPPPPPPPTEPPPPPPPPPEPRVKKYS 526 [217][TOP] >UniRef100_A4H5Q3 Cleavage and polyadenylation specificity factor 30 kDa subunit, putative n=1 Tax=Leishmania braziliensis RepID=A4H5Q3_LEIBR Length = 354 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +2 Query: 50 LRRELCLGANGGGGGGGGGGGGGGGGGGGGGGGGG 154 LRRE G GGGGGGGGGGGGGGGGGGGGGGGGG Sbjct: 299 LRREGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333 Score = 65.1 bits (157), Expect = 2e-09 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = +2 Query: 71 GANGGGGGGGGGGGGGGGGGGGGGGGGGEIDVEG 172 G GGGGGGGGGGGGGGGGGGGGGGGGG G Sbjct: 311 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGFGAGG 344 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = +2 Query: 23 NWVSSSNLLLRRELCLGANGGGGGGGGGGGGGGGGGGGGGGGGG 154 N SS+ + RR L GGGGGGGGGGGGGGGGGGGGGGGG Sbjct: 286 NSASSAAMGNRRRLRREGGAGGGGGGGGGGGGGGGGGGGGGGGG 329 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +2 Query: 71 GANGGGGGGGGGGGGGGGGGGGGGGGGG 154 G GGGGGGGGGGGGGGGGGGGGGGGGG Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +2 Query: 71 GANGGGGGGGGGGGGGGGGGGGGGGGGG 154 G GGGGGGGGGGGGGGGGGGGGGGGGG Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 335 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +2 Query: 71 GANGGGGGGGGGGGGGGGGGGGGGGGGG 154 G GGGGGGGGGGGGGGGGGGGGGGGGG Sbjct: 309 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 336 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +2 Query: 71 GANGGGGGGGGGGGGGGGGGGGGGGGGG 154 G GGGGGGGGGGGGGGGGGGGGGGGGG Sbjct: 310 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 337 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = +2 Query: 71 GANGGGGGGGGGGGGGGGGGGGGGGGGG 154 G GGGGGGGGGGGGGGGGGGG G GGG Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGFGAGGG 345 [218][TOP] >UniRef100_Q5AL52 Putative uncharacterized protein n=1 Tax=Candida albicans RepID=Q5AL52_CANAL Length = 1732 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 13/49 (26%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPP-------------PPPPPPPPPPP 79 +T N ++S +PPPPPPPPPPPPPP PPPPPPPPPPP Sbjct: 1040 ETGNSTTSSAAPPPPPPPPPPPPPPLPPILGGNNSSAAPPPPPPPPPPP 1088 [219][TOP] >UniRef100_Q2U9G0 Rho GTPase effector BNI1 and related formins n=1 Tax=Aspergillus oryzae RepID=Q2U9G0_ASPOR Length = 1813 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 6/41 (14%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPP------PPPPPPPPPPPLAP 70 + ST+++ PPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 1023 VNSTAVAGPPPPPPPPPPPPPGMGVGVPPPPPPPPPPPPPP 1063 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/33 (75%), Positives = 26/33 (78%), Gaps = 6/33 (18%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPP------PPPPPPPPPPP 79 + PPPPPPPPPPPPPP PPPPPPPPPPP Sbjct: 1049 VPPPPPPPPPPPPPPPGSATGVPPPPPPPPPPP 1081 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 6/37 (16%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPP------PPPPPPPPP 79 P + PPPPPPPPPPPPPPP PPPPPPPPP Sbjct: 1043 PGMGVGVPPPPPPPPPPPPPPPGSATGVPPPPPPPPP 1079 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 12/45 (26%) Frame = -3 Query: 168 STSISPPPPPPPPPP------PPPPPPPPPP------PPPPPLAP 70 +T + PPPPPPPPPP PPPPPPPPPP PPPPP P Sbjct: 1067 ATGVPPPPPPPPPPPGMGAGIPPPPPPPPPPGAAGKMPPPPPPPP 1111 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 6/32 (18%) Frame = -3 Query: 147 PPPPPPPPPPPPPPP------PPPPPPPPLAP 70 PPPPPPPPPPPPPPP PPPPPPPP P Sbjct: 1050 PPPPPPPPPPPPPPPGSATGVPPPPPPPPPPP 1081 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/29 (79%), Positives = 23/29 (79%), Gaps = 6/29 (20%) Frame = -3 Query: 153 PPPPPPPP------PPPPPPPPPPPPPPP 85 PPPPPPPP PPPPPPPPPPPPPPP Sbjct: 1036 PPPPPPPPGMGVGVPPPPPPPPPPPPPPP 1064 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 12/40 (30%) Frame = -3 Query: 153 PPPPPPPPPPP------PPPPPPPPPPP------PPPLAP 70 PPPPPPPPPPP PPPPPPPPPPP PPP P Sbjct: 1054 PPPPPPPPPPPGSATGVPPPPPPPPPPPGMGAGIPPPPPP 1093 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 12/46 (26%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP------PPPPPPPPPP------PPPLAP 70 P ++ PPPPPPPPPPP PPPPPPPPPP PPP P Sbjct: 1064 PGSATGVPPPPPPPPPPPGMGAGIPPPPPPPPPPGAAGKMPPPPPP 1109 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 13/38 (34%) Frame = -3 Query: 153 PPPPPPPPPP------PPPPPPPP-------PPPPPPP 79 PPPPPPPPPP PPPPPPPP PPPPPPP Sbjct: 1088 PPPPPPPPPPGAAGKMPPPPPPPPSGASFGAPPPPPPP 1125 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPP-----PPPPPPPPPPPLAPK 67 P S + PPPPPPPPPPP PPPPPPPPPP A K Sbjct: 1063 PPGSATGVPPPPPPPPPPPGMGAGIPPPPPPPPPPGAAGK 1102 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 13/44 (29%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP------PPPPPPPP-------PPPPPP 79 P PPPPPPPPPP PPPPPPPP PPPPPP Sbjct: 1081 PGMGAGIPPPPPPPPPPGAAGKMPPPPPPPPSGASFGAPPPPPP 1124 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 14/39 (35%) Frame = -3 Query: 159 ISPPPPPPPPP-------PPPPPPP-------PPPPPPP 85 I PPPPPPPPP PPPPPPP PPPPPPP Sbjct: 1087 IPPPPPPPPPPGAAGKMPPPPPPPPSGASFGAPPPPPPP 1125 [220][TOP] >UniRef100_C5P8S7 Pherophorin-dz1 protein, putative n=2 Tax=Coccidioides posadasii RepID=C5P8S7_COCP7 Length = 281 Score = 68.9 bits (167), Expect = 2e-10 Identities = 28/44 (63%), Positives = 30/44 (68%), Gaps = 10/44 (22%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPP----------PPPPPPPPPLAP 70 P+T+ PPPPPPPPPPPPPPP PPPPPPPPP AP Sbjct: 92 PTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAP 135 Score = 66.6 bits (161), Expect = 8e-10 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 8/37 (21%) Frame = -3 Query: 153 PPPPPPPPPP--------PPPPPPPPPPPPPPPLAPK 67 PPPPPPPPPP PPPPPPPPPPPPP P APK Sbjct: 124 PPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPK 160 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 8/42 (19%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP--------PPPPPPPPPPPPLAP 70 P+T+ +P PPPPPPPPPP PPPPPPPPPPPP AP Sbjct: 115 PTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAP 156 Score = 61.6 bits (148), Expect = 3e-08 Identities = 25/41 (60%), Positives = 27/41 (65%), Gaps = 6/41 (14%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPP------PPPPPPPPPPPPPPLAP 70 +P+T PPPP PP P PPPPPPPPPPPPPP AP Sbjct: 75 VPTTMYKAPPPPQSPPAPTTTAQAPPPPPPPPPPPPPPPAP 115 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 8/37 (21%) Frame = -3 Query: 153 PPPPPPPPPPPPP--------PPPPPPPPPPPPLAPK 67 PPPPPPPPPPP P PPPPPPPPPP P K Sbjct: 103 PPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSK 139 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/37 (64%), Positives = 26/37 (70%), Gaps = 6/37 (16%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPP------PPPPPPPP 79 P+TS + PPPPPPPPPPPPP PP P PPP PP Sbjct: 135 PTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPPQPP 171 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/56 (50%), Positives = 28/56 (50%), Gaps = 18/56 (32%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPP----------PPPPPPPPPP--------PPPPPPLAP 70 T P PPPPPPPPP PPPPPPPPPP PPPPPP P Sbjct: 95 TAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPP 150 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/66 (42%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPP----------PPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEE 34 T P PPPPPPP PPPPPPPPPPP PP P P P ++L + Sbjct: 117 TTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPPQPPTELPD 176 Query: 33 DTQFVF 16 ++ VF Sbjct: 177 PSKQVF 182 [221][TOP] >UniRef100_C4YG32 Putative uncharacterized protein n=1 Tax=Candida albicans RepID=C4YG32_CANAL Length = 1734 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/52 (55%), Positives = 33/52 (63%), Gaps = 14/52 (26%) Frame = -3 Query: 186 DTNNIPSTSISPPPPPPPPPPPPPP--------------PPPPPPPPPPPLA 73 +T N ++S +PPPPPPPPPPPPPP PPPPPPPPPPP A Sbjct: 1040 ETGNSTTSSAAPPPPPPPPPPPPPPLPPILGGNNSSAASPPPPPPPPPPPPA 1091 [222][TOP] >UniRef100_B8ND33 Cytokinesis protein SepA n=1 Tax=Aspergillus flavus NRRL3357 RepID=B8ND33_ASPFN Length = 1813 Score = 68.9 bits (167), Expect = 2e-10 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 6/41 (14%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPP------PPPPPPPPPPPLAP 70 + ST+++ PPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 1023 VNSTAVAGPPPPPPPPPPPPPGMGVGVPPPPPPPPPPPPPP 1063 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/33 (75%), Positives = 26/33 (78%), Gaps = 6/33 (18%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPP------PPPPPPPPPPP 79 + PPPPPPPPPPPPPP PPPPPPPPPPP Sbjct: 1049 VPPPPPPPPPPPPPPPGSATGVPPPPPPPPPPP 1081 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 6/37 (16%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPP------PPPPPPPPP 79 P + PPPPPPPPPPPPPPP PPPPPPPPP Sbjct: 1043 PGMGVGVPPPPPPPPPPPPPPPGSATGVPPPPPPPPP 1079 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 12/45 (26%) Frame = -3 Query: 168 STSISPPPPPPPPPP------PPPPPPPPPP------PPPPPLAP 70 +T + PPPPPPPPPP PPPPPPPPPP PPPPP P Sbjct: 1067 ATGVPPPPPPPPPPPGMGAGIPPPPPPPPPPGAAGKMPPPPPPPP 1111 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 6/32 (18%) Frame = -3 Query: 147 PPPPPPPPPPPPPPP------PPPPPPPPLAP 70 PPPPPPPPPPPPPPP PPPPPPPP P Sbjct: 1050 PPPPPPPPPPPPPPPGSATGVPPPPPPPPPPP 1081 Score = 60.1 bits (144), Expect = 8e-08 Identities = 23/29 (79%), Positives = 23/29 (79%), Gaps = 6/29 (20%) Frame = -3 Query: 153 PPPPPPPP------PPPPPPPPPPPPPPP 85 PPPPPPPP PPPPPPPPPPPPPPP Sbjct: 1036 PPPPPPPPGMGVGVPPPPPPPPPPPPPPP 1064 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 12/40 (30%) Frame = -3 Query: 153 PPPPPPPPPPP------PPPPPPPPPPP------PPPLAP 70 PPPPPPPPPPP PPPPPPPPPPP PPP P Sbjct: 1054 PPPPPPPPPPPGSATGVPPPPPPPPPPPGMGAGIPPPPPP 1093 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 12/46 (26%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP------PPPPPPPPPP------PPPLAP 70 P ++ PPPPPPPPPPP PPPPPPPPPP PPP P Sbjct: 1064 PGSATGVPPPPPPPPPPPGMGAGIPPPPPPPPPPGAAGKMPPPPPP 1109 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 13/38 (34%) Frame = -3 Query: 153 PPPPPPPPPP------PPPPPPPP-------PPPPPPP 79 PPPPPPPPPP PPPPPPPP PPPPPPP Sbjct: 1088 PPPPPPPPPPGAAGKMPPPPPPPPSGASFGAPPPPPPP 1125 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPP-----PPPPPPPPPPPLAPK 67 P S + PPPPPPPPPPP PPPPPPPPPP A K Sbjct: 1063 PPGSATGVPPPPPPPPPPPGMGAGIPPPPPPPPPPGAAGK 1102 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 13/44 (29%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP------PPPPPPPP-------PPPPPP 79 P PPPPPPPPPP PPPPPPPP PPPPPP Sbjct: 1081 PGMGAGIPPPPPPPPPPGAAGKMPPPPPPPPSGASFGAPPPPPP 1124 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 14/39 (35%) Frame = -3 Query: 159 ISPPPPPPPPP-------PPPPPPP-------PPPPPPP 85 I PPPPPPPPP PPPPPPP PPPPPPP Sbjct: 1087 IPPPPPPPPPPGAAGKMPPPPPPPPSGASFGAPPPPPPP 1125 [223][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 68.6 bits (166), Expect = 2e-10 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 N P T PPPPPPPPPPPPPPPPPPPPP P P A Sbjct: 253 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAA 287 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++PP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 256 VTPPMPPPPPPPPPPPPPPPPPPPPPLPGP 285 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 13/41 (31%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPP-------------PPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PP PPPPPP AP Sbjct: 264 PPPPPPPPPPPPPPPPPPLPGPAADTVPAPPLPPPPPPSAP 304 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = -3 Query: 183 TNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +++ P + P PP PPPPPPPPPPPPPPPPPP P Sbjct: 244 SSDAPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 281 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/55 (45%), Positives = 27/55 (49%), Gaps = 20/55 (36%) Frame = -3 Query: 174 IPSTSISPPPPPPPPP--------------------PPPPPPPPPPPPPPPPLAP 70 + + S P PPPPPP PPPPPPPPPPPPPPPP P Sbjct: 225 VSGAASSGPLPPPPPPLPLSSDAPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPP 279 [224][TOP] >UniRef100_UPI0001796908 PREDICTED: zinc finger homeobox 4 n=1 Tax=Equus caballus RepID=UPI0001796908 Length = 3574 Score = 68.6 bits (166), Expect = 2e-10 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 3/39 (7%) Frame = -3 Query: 174 IPSTSISP---PPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +PST +P PPP PPPPPPPPPPPPPPPPPPP P+ Sbjct: 1986 LPSTVSAPLQAPPPTPPPPPPPPPPPPPPPPPPPSAPPQ 2024 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 V L T + P + P PPPPPPPPPPPPPPPPPPP PP Sbjct: 1984 VKLPSTVSAPLQAPPPTPPPPPPPPPPPPPPPPPPPSAPP 2023 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +PPPPPPPPPPPPPPPPPPP PP P Sbjct: 2000 TPPPPPPPPPPPPPPPPPPPSAPPQVQLP 2028 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/64 (45%), Positives = 29/64 (45%), Gaps = 30/64 (46%) Frame = -3 Query: 171 PSTSISPPPPPP------------------------------PPPPPPPPPPPPPPPPPP 82 P T PPPPPP PPPPPPPPPPPPPPPPPP Sbjct: 1959 PETPPPPPPPPPLPPAPPQPSSMGPVKLPSTVSAPLQAPPPTPPPPPPPPPPPPPPPPPP 2018 Query: 81 PLAP 70 P AP Sbjct: 2019 PSAP 2022 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P T PPPPPPPPPPPPPPPP PP P++ Sbjct: 1998 PPTPPPPPPPPPPPPPPPPPPPSAPPQVQLPVS 2030 [225][TOP] >UniRef100_UPI0000F2AE0C PREDICTED: similar to hCG1781691 n=1 Tax=Monodelphis domestica RepID=UPI0000F2AE0C Length = 358 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 S PP PPPPPPPPPPPPPPPPPPPPP +P Sbjct: 13 STQPPQPPPPPPPPPPPPPPPPPPPPPKDSP 43 Score = 67.0 bits (162), Expect = 6e-10 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 PST PP PPPPPPPPPPPPPPPPPPPPP Sbjct: 12 PSTQ---PPQPPPPPPPPPPPPPPPPPPPPP 39 Score = 66.2 bits (160), Expect = 1e-09 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P ++ S PP PPPPPPPPPPPPPPPPPPPP Sbjct: 8 PCSNPSTQPPQPPPPPPPPPPPPPPPPPPPP 38 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +P PP PPPPPPPPPPPPPPPPPP PK Sbjct: 11 NPSTQPPQPPPPPPPPPPPPPPPPPPPPPK 40 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSK 43 S P PP PPPPPPPPPPPPPPPPP P +S + K Sbjct: 10 SNPSTQPPQPPPPPPPPPPPPPPPPPPPPPKDSPFSIK 47 [226][TOP] >UniRef100_UPI00005A063C PREDICTED: similar to junction-mediating and regulatory protein n=1 Tax=Canis lupus familiaris RepID=UPI00005A063C Length = 851 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPL-APKHNSL 55 S +I+P PPP PP PPPPPPPPPPPPPPPPL K NSL Sbjct: 659 SVTIAPLPPPLPPTPPPPPPPPPPPPPPPPLPVAKDNSL 697 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 L++ ++ S++ P PPP PP PPPPPPPPPPPPPP Sbjct: 649 LLNNIDLEPGSVTIAPLPPPLPPTPPPPPPPPPPPPPP 686 [227][TOP] >UniRef100_UPI00016E4781 UPI00016E4781 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4781 Length = 906 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 SPP P PPPPPPPPPPPPPPPPPPPP P+ Sbjct: 602 SPPTPRPPPPPPPPPPPPPPPPPPPPQHPE 631 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 P+ PP P PPPPPPPPPPPPPPPPPPP P+H Sbjct: 596 PTIPNQSPPTPRPPPPPPPPPPPPPPPPPPP--PQH 629 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 IP+ S P PPPPPPPPPPPPPPPPPPPP Sbjct: 598 IPNQSPPTPRPPPPPPPPPPPPPPPPPPPP 627 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -3 Query: 180 NNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 N P T PPPPPPPPPPPPPPPPPPP P P Sbjct: 600 NQSPPTPRPPPPPPPPPPPPPPPPPPPPQHPEGKATP 636 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISP--PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS ++P P PP P PPPPPPPPPPPPPPP P Sbjct: 590 PSPRLNPTIPNQSPPTPRPPPPPPPPPPPPPPPPPP 625 [228][TOP] >UniRef100_UPI000195128A junction-mediating and regulatory protein n=1 Tax=Canis lupus familiaris RepID=UPI000195128A Length = 991 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPPL-APKHNSL 55 S +I+P PPP PP PPPPPPPPPPPPPPPPL K NSL Sbjct: 799 SVTIAPLPPPLPPTPPPPPPPPPPPPPPPPLPVAKDNSL 837 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 L++ ++ S++ P PPP PP PPPPPPPPPPPPPP Sbjct: 789 LLNNIDLEPGSVTIAPLPPPLPPTPPPPPPPPPPPPPP 826 [229][TOP] >UniRef100_UPI0001951250 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Canis lupus familiaris RepID=UPI0001951250 Length = 1052 Score = 68.6 bits (166), Expect = 2e-10 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 N P T PPPPPPPPPPPPPPPPPPPPP P P A Sbjct: 504 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAA 538 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++PP PPPPPPPPPPPPPPPPPPPPP P Sbjct: 507 VTPPMPPPPPPPPPPPPPPPPPPPPPLPGP 536 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 13/41 (31%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPP-------------PPPPPPPPPLAP 70 PPPPPPPPPPPPPPPP PP PPPPPP AP Sbjct: 515 PPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLPPPPPPSAP 555 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 L ++ P + P PP PPPPPPPPPPPPPPPPPP P Sbjct: 492 LPPSSETPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 532 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/55 (45%), Positives = 27/55 (49%), Gaps = 20/55 (36%) Frame = -3 Query: 174 IPSTSISPPPPPPPPP--------------------PPPPPPPPPPPPPPPPLAP 70 + + S P PPPPPP PPPPPPPPPPPPPPPP P Sbjct: 476 VTGVASSGPLPPPPPPLPPSSETPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPP 530 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/54 (44%), Positives = 26/54 (48%), Gaps = 20/54 (37%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP--------------------PPPPPPPPPPPPPPLAP 70 P T ++ P PPPPPP PPPPPPPPPPPPPP P Sbjct: 475 PVTGVASSGPLPPPPPPLPPSSETPEAVQNGPVTPPMPPPPPPPPPPPPPPPPP 528 [230][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 68.6 bits (166), Expect = 2e-10 Identities = 29/48 (60%), Positives = 29/48 (60%), Gaps = 14/48 (29%) Frame = -3 Query: 171 PSTSISPPPPPP--------------PPPPPPPPPPPPPPPPPPPLAP 70 P T PPPPPP PPPPPPPPPPPPPPPPPPP AP Sbjct: 782 PETPPPPPPPPPLPPAPPQPAPAPTPPPPPPPPPPPPPPPPPPPPSAP 829 Score = 65.5 bits (158), Expect = 2e-09 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 P+ + +PPPPPPPPPPPPPPPPPPPP PP Sbjct: 801 PAPAPTPPPPPPPPPPPPPPPPPPPPSAPP 830 Score = 65.5 bits (158), Expect = 2e-09 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +P P PPPPPPPPPPPPPPPPPPPP P+ Sbjct: 802 APAPTPPPPPPPPPPPPPPPPPPPPSAPPQ 831 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPP PP P Sbjct: 808 PPPPPPPPPPPPPPPPPPPSAPPQVQLP 835 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 13/47 (27%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP-------------PPPPPPPPPPPPPLAP 70 P + SP PPPPPPPPP PPPPPPPPPPPPP P Sbjct: 776 PISPSSPETPPPPPPPPPLPPAPPQPAPAPTPPPPPPPPPPPPPPPP 822 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P+ PPPPPPPPPPPPPPPP PP P++ Sbjct: 805 PTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVS 837 [231][TOP] >UniRef100_C5CX67 FHA domain containing protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CX67_VARPS Length = 645 Score = 68.6 bits (166), Expect = 2e-10 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 S + PPP PPPPPPPPPPPPPPPPPPPP Sbjct: 370 SAQVEPPPSAPPPPPPPPPPPPPPPPPPPP 399 Score = 67.0 bits (162), Expect = 6e-10 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +PPPPPPPPPPPPPPPPPPPP P P AP+ Sbjct: 379 APPPPPPPPPPPPPPPPPPPPAPVPVAAPR 408 Score = 66.2 bits (160), Expect = 1e-09 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPP PPPPPPPPPPPPPPPPPPP AP Sbjct: 375 PPPSAPPPPPPPPPPPPPPPPPPPPAP 401 Score = 65.9 bits (159), Expect = 1e-09 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 S PPPPPPPPPPPPPPPPPPPP P P+A Sbjct: 378 SAPPPPPPPPPPPPPPPPPPPPAPVPVA 405 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 12/47 (25%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP------------PPPPLAPK 67 P S PPPPPPPPPPPPPPPPPPP P PP P PK Sbjct: 375 PPPSAPPPPPPPPPPPPPPPPPPPPAPVPVAAPRVENVAPPAPQQPK 421 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P S PPP PPPPPPPPPPPPPPPPPP Sbjct: 367 PRVSAQVEPPPSAPPPPPPPPPPPPPPPPPP 397 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +S PPP PPPPPPPPPPPPPPPP P Sbjct: 369 VSAQVEPPPSAPPPPPPPPPPPPPPPPPPP 398 [232][TOP] >UniRef100_A4TEZ3 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4TEZ3_MYCGI Length = 177 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 2/30 (6%) Frame = -3 Query: 162 SISPPPPPPPPPPPPP--PPPPPPPPPPPP 79 +++PPPPPPPPPPPPP PPPPPPPPPPPP Sbjct: 120 ALAPPPPPPPPPPPPPGAPPPPPPPPPPPP 149 Score = 67.0 bits (162), Expect = 6e-10 Identities = 25/27 (92%), Positives = 25/27 (92%), Gaps = 2/27 (7%) Frame = -3 Query: 153 PPPPPPPPPPPP--PPPPPPPPPPPPP 79 PPPPPPPPPPPP PPPPPPPPPPPPP Sbjct: 124 PPPPPPPPPPPPGAPPPPPPPPPPPPP 150 Score = 65.5 bits (158), Expect = 2e-09 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 2/29 (6%) Frame = -3 Query: 150 PPPPPPPPPPPPP--PPPPPPPPPPPLAP 70 PPPPPPPPPPPPP PPPPPPPPPPP P Sbjct: 123 PPPPPPPPPPPPPGAPPPPPPPPPPPPPP 151 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 5/49 (10%) Frame = -3 Query: 192 LVDTNNIPSTSISPPPPPPPPP--PPPPPPPPPPPPPP---PPLAPKHN 61 L + N+ + PPPPPPPPP PPPPPPPPPPPPPP PP P N Sbjct: 114 LYELNDALAPPPPPPPPPPPPPGAPPPPPPPPPPPPPPVYIPPPLPNVN 162 [233][TOP] >UniRef100_B4YB55 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB55_BURPS Length = 369 Score = 68.6 bits (166), Expect = 2e-10 Identities = 27/37 (72%), Positives = 28/37 (75%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPP---PPPPPPPLAP 70 PST+ PPPPPPPPPPPPPPPPPP P PPPP P Sbjct: 91 PSTTTPPPPPPPPPPPPPPPPPPPSTTPSPPPPTTTP 127 Score = 68.2 bits (165), Expect = 3e-10 Identities = 27/41 (65%), Positives = 29/41 (70%), Gaps = 4/41 (9%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPP----PPPPPPPPPPPPPPPPPPP 79 V +P+ PPPPPP PPPPPPPPPPPPPPPPPPP Sbjct: 74 VGDRTLPNKVPPPPPPPPSTTTPPPPPPPPPPPPPPPPPPP 114 Score = 66.6 bits (161), Expect = 8e-10 Identities = 25/34 (73%), Positives = 28/34 (82%), Gaps = 3/34 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPP---PPPPPP 79 P ++ +PPPPPPPPPPPPPPPPPPP P PPPP Sbjct: 90 PPSTTTPPPPPPPPPPPPPPPPPPPSTTPSPPPP 123 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/31 (80%), Positives = 25/31 (80%), Gaps = 4/31 (12%) Frame = -3 Query: 150 PPPPPPPP----PPPPPPPPPPPPPPPPLAP 70 PPPPPPPP PPPPPPPPPPPPPPPP P Sbjct: 84 PPPPPPPPSTTTPPPPPPPPPPPPPPPPPPP 114 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 + PPPPPPP PPPPPPPPPPPPPP P Sbjct: 83 VPPPPPPPPSTTTPPPPPPPPPPPPPPPPP 112 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPP P PPPP P Sbjct: 101 PPPPPPPPPPPPPPSTTPSPPPPTTTPP 128 [234][TOP] >UniRef100_Q00ZZ2 Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins (ISS) n=1 Tax=Ostreococcus tauri RepID=Q00ZZ2_OSTTA Length = 685 Score = 68.6 bits (166), Expect = 2e-10 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPPPPP 85 + S +PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 519 AASTTPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 67.4 bits (163), Expect = 5e-10 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPP 79 S PPPPPPPPPPPPPPPPPPPPPPP Sbjct: 521 STTPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/63 (47%), Positives = 33/63 (52%), Gaps = 12/63 (19%) Frame = -3 Query: 198 VILVDTNNIPSTSISPPPPPPPPPPPPPPPPPPPP------------PPPPPLAPKHNSL 55 V L +T PPPPPPPPPPPPPPPPPPPP PPPPP + L Sbjct: 512 VTLASARAASTTPPPPPPPPPPPPPPPPPPPPPPPTTTGGVRSPPSHPPPPPSDDPRSML 571 Query: 54 LNS 46 + S Sbjct: 572 MAS 574 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/48 (56%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPP---PPPLAPKHNSL 55 V +++ PS SP PPPPP PPPPPPPPP P P PPLAP S+ Sbjct: 597 VVSDSEPSLPPSPSPPPPPSPPPPPPPPPRSPSPAIGKPPLAPPTRSM 644 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P T S PPPPPPPPPPPPPPPPPP P Sbjct: 511 PVTLASARAASTTPPPPPPPPPPPPPPPPPPPPP 544 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/38 (57%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -3 Query: 180 NNIPSTSISPPPPP-PPPPPPPPPPPPPPPPPPPPLAP 70 ++ PS+ +S P PP P PPPPP PPPPPPPPP +P Sbjct: 591 SSAPSSVVSDSEPSLPPSPSPPPPPSPPPPPPPPPRSP 628 [235][TOP] >UniRef100_C5YU09 Putative uncharacterized protein Sb08g008380 n=1 Tax=Sorghum bicolor RepID=C5YU09_SORBI Length = 149 Score = 68.6 bits (166), Expect = 2e-10 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 144 PPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPPPPPPPPPPPPPPPPPL+P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPLSP 33 Score = 65.1 bits (157), Expect = 2e-09 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPP 79 PPPPPPPPPPPPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPLSP 33 Score = 63.5 bits (153), Expect = 7e-09 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPL 76 PPPPPPPPPPPPPPPPPPPPP P L Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPLSPSL 35 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 135 PPPPPPPPPPPPPPPPPPPLAPKHNSL 55 PPPPPPPPPPPPPPPPPPP P SL Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPLSPSL 35 [236][TOP] >UniRef100_B9FZD5 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FZD5_ORYSJ Length = 2255 Score = 68.6 bits (166), Expect = 2e-10 Identities = 31/52 (59%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -3 Query: 183 TNNIPSTSISPPPP-PPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEED 31 T I T + PPPP PPPPPPPPPPPPP PP PPPL P LN ED Sbjct: 416 TETIQYTELPPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEPELNGAPAED 467 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/43 (55%), Positives = 27/43 (62%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 + +P PPPPPPPPPPPPP PP PPP PPP P+ N Sbjct: 419 IQYTELPPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEPELN 461 [237][TOP] >UniRef100_B8BBD3 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8BBD3_ORYSI Length = 2000 Score = 68.6 bits (166), Expect = 2e-10 Identities = 31/52 (59%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -3 Query: 183 TNNIPSTSISPPPP-PPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEED 31 T I T + PPPP PPPPPPPPPPPPP PP PPPL P LN ED Sbjct: 281 TETIQYTELPPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEPELNGAPAED 332 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/43 (55%), Positives = 27/43 (62%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 + +P PPPPPPPPPPPPP PP PPP PPP P+ N Sbjct: 284 IQYTELPPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEPELN 326 [238][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 68.6 bits (166), Expect = 2e-10 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS SPPPPPPPP PPPPPP PPPPPP PP +P Sbjct: 1558 PSPPPSPPPPPPPPSPPPPPPSPPPPPPSPPPSP 1591 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS SPPP PPPP PPP PPPPPPPP PPP P Sbjct: 1545 PSPPPSPPPSPPPPSPPPSPPPPPPPPSPPPPPP 1578 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS SPPPP PPP PPPPPPPP PPPPPP P Sbjct: 1549 PSPPPSPPPPSPPPSPPPPPPPPSPPPPPPSPPP 1582 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PP PPPPPPPP PPPPPP PPPPPP P Sbjct: 1555 PPPPSPPPSPPPPPPPPSPPPPPPSPPPPPPSPP 1588 Score = 64.3 bits (155), Expect = 4e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PPPPPPP PPPPPP PPPPPP PPP P Sbjct: 1565 PPPPPPPSPPPPPPSPPPPPPSPPPSPP 1592 Score = 63.5 bits (153), Expect = 7e-09 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = -3 Query: 189 VDTNNIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 V T + P + PPPP PPP PPPPPPPP PPPPPP P Sbjct: 1542 VPTPSPPPSPPPSPPPPSPPPSPPPPPPPPSPPPPPPSPP 1581 Score = 63.2 bits (152), Expect = 9e-09 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPPP PPPPPP PPPPPP PPP PP P Sbjct: 1562 PSPPPPPPPPSPPPPPPSPPPPPPSPPPSPPSPP 1595 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PP PPP PPPPPPPP PPPPPP PP P Sbjct: 1551 PPPSPPPPSPPPSPPPPPPPPSPPPPPPSPPPPP 1584 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S P PPPPPPPP PPPPPP PPPPPP P Sbjct: 1556 PPPSPPPSPPPPPPPPSPPPPPPSPPPPPPSPPP 1589 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 IPS SPPPPP PPPPP PPPPPPP PPP Sbjct: 1771 IPSPPPSPPPPPSPPPPPSPPPPPPPSPPP 1800 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P SPPPPPP PPPPPP PPP PP PPPP Sbjct: 1567 PPPPPSPPPPPPSPPPPPPSPPPSPPSPPPP 1597 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P S PPPP PPPPPP PPP PP PPPPPP Sbjct: 1569 PPPSPPPPPPSPPPPPPSPPPSPPSPPPPPP 1599 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSL 55 P + PPP PPPPPP PPP PP PPPPPP A + NS+ Sbjct: 1570 PPSPPPPPPSPPPPPPSPPPSPPSPPPPPPAKAIRGNSV 1608 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 159 ISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 I PPP PPPPP PPPPP PPPPPPP P H Sbjct: 1771 IPSPPPSPPPPPSPPPPPSPPPPPPPSPPPLH 1802 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P PPPPP PPPPPP PPP PP PPPPP A Sbjct: 1568 PPPPSPPPPPPSPPPPPPSPPPSPPSPPPPPPA 1600 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLE 37 P PPPPPP PPPPPP PPP PP PP P ++ + ++ Sbjct: 1571 PSPPPPPPSPPPPPPSPPPSPPSPPPPPPAKAIRGNSVD 1609 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -3 Query: 162 SISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++ P PPP PPP PPPP PPP PPPPP P Sbjct: 1541 TVPTPSPPPSPPPSPPPPSPPPSPPPPPPPP 1571 [239][TOP] >UniRef100_Q5CKJ5 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CKJ5_CRYHO Length = 996 Score = 68.6 bits (166), Expect = 2e-10 Identities = 31/58 (53%), Positives = 35/58 (60%), Gaps = 5/58 (8%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPP-----PPPPPLAPKHNSLLNSKLEEDTQFVF 16 I S PPPPPPPPPPPPPPPPP PP PPPPPL +S ++ +ED F Sbjct: 404 IDKNSPPPPPPPPPPPPPPPPPPPLPPSQHLLPPPPPLPLSGDSKVSDMQKEDPTLSF 461 [240][TOP] >UniRef100_B4QT65 GD21099 n=1 Tax=Drosophila simulans RepID=B4QT65_DROSI Length = 360 Score = 68.6 bits (166), Expect = 2e-10 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPPPPPPPPPPPPPPPP P P Sbjct: 136 PKAKLPPPPPPPPPPPPPPPPPPPPPPPGVPGNP 169 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 IP P PPPPPPPPPPPPPPPPPPPP P Sbjct: 129 IPRHVGKPKAKLPPPPPPPPPPPPPPPPPPPPPPP 163 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLA 73 PPPPPPPPPPPPPPPPPPP P P++ Sbjct: 145 PPPPPPPPPPPPPPPPPPPGVPGNPVS 171 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/57 (43%), Positives = 31/57 (54%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQFVFLLPR 4 +P PPPPPPPPPPPPPPPPP P P L P+ + + + F F P+ Sbjct: 140 LPPPPPPPPPPPPPPPPPPPPPPPGVPGNPVSLPPQPVIVPLNPADPIQSFYFAYPQ 196 [241][TOP] >UniRef100_B4MZM3 GK24347 n=1 Tax=Drosophila willistoni RepID=B4MZM3_DROWI Length = 608 Score = 68.6 bits (166), Expect = 2e-10 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAPK 67 +PPPPPPPPPPPPPPP PPPPPPPP P+ Sbjct: 493 APPPPPPPPPPPPPPPTEPPPPPPPPQEPR 522 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKHN 61 PPPPPPPPPPPP PPPPPPPP P K++ Sbjct: 497 PPPPPPPPPPPPTEPPPPPPPPQEPRVKKYS 527 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPP 85 P + PPPPPPPPPPPPP PPPPPPPP Sbjct: 490 PHPAPPPPPPPPPPPPPPPTEPPPPPPPP 518 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/30 (76%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = -3 Query: 150 PPPPPPPPPPPPPPPPPPP--PPPPPLAPK 67 P P PPPPPPPPPPPPPPP PPPPP P+ Sbjct: 490 PHPAPPPPPPPPPPPPPPPTEPPPPPPPPQ 519 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 P+ PPPPPPPPPPP PPPPPPPP P Sbjct: 492 PAPPPPPPPPPPPPPPPTEPPPPPPPPQEP 521 [242][TOP] >UniRef100_A8NTE1 Formin Homology 2 Domain containing protein n=1 Tax=Brugia malayi RepID=A8NTE1_BRUMA Length = 1113 Score = 68.6 bits (166), Expect = 2e-10 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 12/44 (27%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP------------PPPPPPPPPPPPPL 76 P I+PPPPPPPPPPPP PPPPPPPPPPPPPL Sbjct: 513 PGHQIAPPPPPPPPPPPPPLPPSLPPSGSCPPPPPPPPPPPPPL 556 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 18/47 (38%) Frame = -3 Query: 156 SPPP-------PPPPPPPPPPPPP-----------PPPPPPPPPLAP 70 SPPP PPPPPPPPPPPPP PPPPPPPPP P Sbjct: 508 SPPPAPGHQIAPPPPPPPPPPPPPLPPSLPPSGSCPPPPPPPPPPPP 554 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/55 (49%), Positives = 27/55 (49%), Gaps = 21/55 (38%) Frame = -3 Query: 171 PSTSISPPP----------------PPPPP-----PPPPPPPPPPPPPPPPPLAP 70 P TS PPP PPP P PPPPPPPPPPPPP PP L P Sbjct: 484 PPTSRLPPPDTYAEVLDKLNVVTGSPPPAPGHQIAPPPPPPPPPPPPPLPPSLPP 538 [243][TOP] >UniRef100_A8NM82 Formin Homology 2 Domain containing protein (Fragment) n=1 Tax=Brugia malayi RepID=A8NM82_BRUMA Length = 1023 Score = 68.6 bits (166), Expect = 2e-10 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 12/44 (27%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP------------PPPPPPPPPPPPPL 76 P I+PPPPPPPPPPPP PPPPPPPPPPPPPL Sbjct: 568 PGHQIAPPPPPPPPPPPPPLPPSLPPSGSCPPPPPPPPPPPPPL 611 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/47 (57%), Positives = 27/47 (57%), Gaps = 18/47 (38%) Frame = -3 Query: 156 SPPP-------PPPPPPPPPPPPP-----------PPPPPPPPPLAP 70 SPPP PPPPPPPPPPPPP PPPPPPPPP P Sbjct: 563 SPPPAPGHQIAPPPPPPPPPPPPPLPPSLPPSGSCPPPPPPPPPPPP 609 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/55 (49%), Positives = 27/55 (49%), Gaps = 21/55 (38%) Frame = -3 Query: 171 PSTSISPPP----------------PPPPP-----PPPPPPPPPPPPPPPPPLAP 70 P TS PPP PPP P PPPPPPPPPPPPP PP L P Sbjct: 539 PPTSRLPPPDTYAEVLDKLNVVTGSPPPAPGHQIAPPPPPPPPPPPPPLPPSLPP 593 [244][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 68.6 bits (166), Expect = 2e-10 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = -3 Query: 162 SISPPPPPPPPPPP---PPPPPPPPPPPPPPLAPKHNSL 55 S PPPPPPPPPPP PPPPPPPPPPPPPP P L Sbjct: 362 SAPPPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQL 400 Score = 61.6 bits (148), Expect = 3e-08 Identities = 29/55 (52%), Positives = 31/55 (56%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQFVFLLP 7 P +PPPPPPPPPPPPPP PPPP PPP A LL+ L D L P Sbjct: 373 PPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAGARAKLLDD-LNTDNPLARLKP 426 Score = 60.5 bits (145), Expect = 6e-08 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 11/39 (28%) Frame = -3 Query: 153 PPP--------PPPPPPPPPPPP---PPPPPPPPPPLAP 70 PPP PPPPPPPPPPPP PPPPPPPPPP P Sbjct: 353 PPPQQQQNKSAPPPPPPPPPPPPKGAPPPPPPPPPPPPP 391 [245][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 68.6 bits (166), Expect = 2e-10 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPPP-PPPPPPPPPPPPPPPPPPPLAP 70 P +SPPPPPP PPPPPPP PPPPPP PPPPL P Sbjct: 137 PPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPP 171 Score = 66.6 bits (161), Expect = 8e-10 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 PS + PPPPPPP PPPPPPP PPPP PPPP Sbjct: 220 PSPPLPPPPPPPPSPPPPPPPSPPPPSPPPP 250 Score = 66.2 bits (160), Expect = 1e-09 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P +S PPPPP PPPPPP PPPPPPP PP PL P Sbjct: 13 PPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPP 46 Score = 66.2 bits (160), Expect = 1e-09 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP---PPPPPPPPPPPPPLAP 70 P +SPPPPPP PPPPP PPPPPP PPPPPP +P Sbjct: 122 PPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSP 158 Score = 65.1 bits (157), Expect = 2e-09 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P SPPPPPPP PPPPPP PPPPPPP PP Sbjct: 11 PPPPSSPPPPPPPSPPPPPPSPPPPPPPSPP 41 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPP---PPPPPPL 76 P +S PPPPPP PPPPPPP PPPP PPPPPPL Sbjct: 67 PPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPL 101 Score = 64.7 bits (156), Expect = 3e-09 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPP PPPPPP PPPP PPP PL P Sbjct: 144 PPPPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPP 177 Score = 64.3 bits (155), Expect = 4e-09 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = -3 Query: 171 PSTSISPPPPPP--PPPPPPPPPPPPPPPPPPPLAPKHNSLL 52 P S PPPPPP PPPPPPP PPPPPP PPPP P S L Sbjct: 3 PPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPL 44 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 171 PSTSISPPPP--PPPPPPPPPPPPPPPPPPPPPL 76 P S PPPP PPPPPPPP PPPPPPP PPPPL Sbjct: 59 PPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPL 92 Score = 64.3 bits (155), Expect = 4e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + PPPPPPPP PPPPPPP PPPP PPP P Sbjct: 219 PPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPPPP 252 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP--PPPPPPPPPPPPPLAP 70 P SPPPPPP PPPPP PPPPPP PPPPP L+P Sbjct: 108 PPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSP 143 Score = 63.5 bits (153), Expect = 7e-09 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 4/38 (10%) Frame = -3 Query: 171 PSTSISPPPPP----PPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPP PPPPP PPPPPPP PPPPPP P Sbjct: 129 PPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPP 166 Score = 63.5 bits (153), Expect = 7e-09 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 Query: 156 SPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 SPPPPPPP PPPPPPP PPPPP P P AP Sbjct: 189 SPPPPPPPSPPPPPPPSPPPPPLPSPPAP 217 Score = 63.2 bits (152), Expect = 9e-09 Identities = 26/39 (66%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPP---PPPPLAPKH 64 P S PPPPP PPPPPP PPPP PPP PPPP +P H Sbjct: 146 PPPSPPPPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPH 184 Score = 63.2 bits (152), Expect = 9e-09 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P+ S PP PPPPPPPP PPPPPPP PPPP P Sbjct: 215 PAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPP 248 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P SPPPPPPPP PPPPPPP PPPPPP P Sbjct: 1 PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPP 34 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = -3 Query: 171 PSTSISPPPPP--PPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPP PPPPPPPP PPPPPPP PPP P Sbjct: 58 PPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLP 93 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 5/39 (12%) Frame = -3 Query: 171 PSTSISPPPPPP--PPPP---PPPPPPPPPPPPPPPLAP 70 P SPPPPPP PPPP PPPPPPPP PPPPPP +P Sbjct: 50 PPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSP 88 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 4/38 (10%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPP----PPPPPPPPPPPPLAP 70 P S PPPP P PPPPPP PPPPPP PPPPPL+P Sbjct: 91 PLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSP 128 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 PS PP PPPPPPP PPPPPPP PPPPPL Sbjct: 180 PSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPL 211 Score = 62.4 bits (150), Expect = 2e-08 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS P PPPPPPPP PPPPPPP PPPP P P Sbjct: 217 PSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPPP 250 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P + P PPPPPPP PPPPPPP PPPPP P P Sbjct: 182 PPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPP 215 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 9/44 (20%) Frame = -3 Query: 174 IPSTSISPPPPP---------PPPPPPPPPPPPPPPPPPPPLAP 70 +P S PPPPP PPPPPPP PPPPPPP PPPP P Sbjct: 169 LPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLP 212 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P PPPPPPP PPPPPPP PPPPPP P P Sbjct: 2 PPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPP 35 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 9/43 (20%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPP---------PPPPPPPPPPPLAP 70 P SPPPPPP PPPPPPP PPPPPPP PPP P Sbjct: 19 PPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPP 61 Score = 61.2 bits (147), Expect = 3e-08 Identities = 26/44 (59%), Positives = 26/44 (59%), Gaps = 10/44 (22%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP----------PPPPPPPPPPPPPLAP 70 P S PPPP PPPPPPP PPPPPP PPPPPP P Sbjct: 21 PPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQP 64 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/37 (64%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPP--PPPPPPPPPPPPPPLAP 70 +P + PPPP PPPPPP PPPPP PPPPPPP +P Sbjct: 44 LPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSP 80 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -3 Query: 171 PSTSISPPPPP-PPPPPPPPPPPPPPPPPPPPLAP 70 PS+ PPPPP PPPPPPP PPPP P PPPPP P Sbjct: 68 PSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLP 102 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 4/40 (10%) Frame = -3 Query: 156 SPPPPPP----PPPPPPPPPPPPPPPPPPPLAPKHNSLLN 49 SPPPPPP PPPPPP PPPPP PPPPP +P LL+ Sbjct: 103 SPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLS 142 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PP PPPPPPP PPPPPP PPPPP +P Sbjct: 38 PSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSP 71 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPP---PPPLAP 70 P S PPPPPPPP PPPPPPP PPPP PPP P Sbjct: 64 PPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPP 100 Score = 60.5 bits (145), Expect = 6e-08 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 +PS PP PP PPPPPPPP PPPPPPP P P Sbjct: 211 LPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPP 245 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 3/35 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPP---PPPPPPPPPPPPPPPL 76 P S PPPPP PPPP PPPPPP P PPPPPPL Sbjct: 76 PPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPL 110 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 4/38 (10%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPP--PPPPP--PPPPLAP 70 P + + P PPPPPPP PPPPPP PPPPP PPPP P Sbjct: 40 PPSPLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPP 77 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 P S PPPPP PPPPPPPP PPPPPPP P Sbjct: 57 PPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPP 90 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 11/45 (24%) Frame = -3 Query: 171 PSTSISPPPPP--PPPPPP---------PPPPPPPPPPPPPPLAP 70 P SPPPPP PPPPPP PPPPPP PPPPPPP P Sbjct: 115 PPPPPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPP 159 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 14/49 (28%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPP--------------PPPPPPPLAP 70 +P + PPPP PPPPPPP PPPPP PPPPPPP +P Sbjct: 186 LPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSP 234 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/48 (54%), Positives = 26/48 (54%), Gaps = 14/48 (29%) Frame = -3 Query: 171 PSTSISPPPPPPPPP--------------PPPPPPPPPPPPPPPPLAP 70 PS PPP PPPPP PPPPPPPP PPPPPPP P Sbjct: 196 PSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPPPPPSPP 243 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPP---PPPPPPPPPPLAP 70 P SPPPPPP PPPP PPP PPPPP PP PL P Sbjct: 152 PPPPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPP 188 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 PS PPP PPPP P PPPPPP P PPPPP P Sbjct: 78 PSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLP 111 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%), Gaps = 4/38 (10%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPP----PPPPPLAP 70 P S PP P PPPPPP P PPPPPP PPPPP +P Sbjct: 84 PPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSP 121 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/50 (52%), Positives = 26/50 (52%), Gaps = 16/50 (32%) Frame = -3 Query: 171 PSTSISPPPPPPPPP-------PPPPP---------PPPPPPPPPPPLAP 70 P S PPPP PPPP PPPPP PPPPPPP PPP P Sbjct: 154 PPPSPPPPPPSPPPPLPPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPP 203 [246][TOP] >UniRef100_UPI00017C3792 PREDICTED: similar to additional sex combs like 3 isoform 3 n=1 Tax=Bos taurus RepID=UPI00017C3792 Length = 2356 Score = 68.2 bits (165), Expect = 3e-10 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 PPPPPPPP PPPPPPPPPPPPPPL P H Sbjct: 2124 PPPPPPPPLALPPPPPPPPPPPPPPLPPSH 2153 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P ++ PPPPPPPPPPPPP PP P P PP Sbjct: 2130 PPLALPPPPPPPPPPPPPPLPPSHPNPEVPP 2160 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = -3 Query: 177 NIPSTSISPP---PPPPPPPPPPPPPPPPPPPPPPPLAPK 67 ++P PP PPPPPPPPPPPPPP PP P P + P+ Sbjct: 2122 HLPPPPPPPPLALPPPPPPPPPPPPPPLPPSHPNPEVPPE 2161 [247][TOP] >UniRef100_UPI0000F53460 enabled homolog isoform 2 n=2 Tax=Mus musculus RepID=UPI0000F53460 Length = 789 Score = 68.2 bits (165), Expect = 3e-10 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 6/36 (16%) Frame = -3 Query: 159 ISPPP------PPPPPPPPPPPPPPPPPPPPPPLAP 70 +SPPP PPPPPPPPPPPPPPPPP PPPPL P Sbjct: 416 VSPPPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPP 451 Score = 68.2 bits (165), Expect = 3e-10 Identities = 28/35 (80%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 171 PSTS--ISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P TS +PPPPPPPPPPPPPPPPP PPPP PPLA Sbjct: 419 PPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPPLA 453 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 PPPPPPPPPPPPPPPP PPPP PP + H Sbjct: 428 PPPPPPPPPPPPPPPPLPPPPLPPLASLSH 457 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEED 31 P S PPPPPPPPPP P PPPPPPPP P P S E++ Sbjct: 559 PLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPPLPASGIFSGSTSEDN 605 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 12/45 (26%) Frame = -3 Query: 168 STSISPPPPPPPPPP-----PPPPPPPP-------PPPPPPPLAP 70 ++++ PPP PPPPPP PPPPPPPP PPPPPPP AP Sbjct: 545 ASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAP 589 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 10/37 (27%) Frame = -3 Query: 150 PPPPPP-----PPPPPPPPPP-----PPPPPPPPLAP 70 PPPPPP PPPPPPPPPP PPPPPPPP P Sbjct: 554 PPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPP 590 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 +PST PPPPPPPP P PPPPPPPP PP Sbjct: 560 LPSTGPPPPPPPPPPLPNQAPPPPPPPPAPP 590 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 27/39 (69%), Gaps = 5/39 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP-----PPPPPPPPPPPPPLAP 70 P+ + + PPPP PPPPPP PPPPPPPPPP P AP Sbjct: 542 PAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAP 580 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 16/46 (34%) Frame = -3 Query: 150 PPPPPP-----------PPPPPPPPPPP-----PPPPPPPLAPKHN 61 PPPPPP PPPP PPPPPP PPPPPPP P N Sbjct: 532 PPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPN 577 [248][TOP] >UniRef100_UPI000047625B enabled homolog isoform 3 n=1 Tax=Mus musculus RepID=UPI000047625B Length = 785 Score = 68.2 bits (165), Expect = 3e-10 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 6/36 (16%) Frame = -3 Query: 159 ISPPP------PPPPPPPPPPPPPPPPPPPPPPLAP 70 +SPPP PPPPPPPPPPPPPPPPP PPPPL P Sbjct: 412 VSPPPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPP 447 Score = 68.2 bits (165), Expect = 3e-10 Identities = 28/35 (80%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 171 PSTS--ISPPPPPPPPPPPPPPPPPPPPPPPPPLA 73 P TS +PPPPPPPPPPPPPPPPP PPPP PPLA Sbjct: 415 PPTSGPAAPPPPPPPPPPPPPPPPPLPPPPLPPLA 449 Score = 62.4 bits (150), Expect = 2e-08 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -3 Query: 153 PPPPPPPPPPPPPPPPPPPPPPPPPLAPKH 64 PPPPPPPPPPPPPPPP PPPP PP + H Sbjct: 424 PPPPPPPPPPPPPPPPLPPPPLPPLASLSH 453 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/47 (53%), Positives = 27/47 (57%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAPKHNSLLNSKLEED 31 P S PPPPPPPPPP P PPPPPPPP P P S E++ Sbjct: 555 PLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPPLPASGIFSGSTSEDN 601 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 12/45 (26%) Frame = -3 Query: 168 STSISPPPPPPPPPP-----PPPPPPPP-------PPPPPPPLAP 70 ++++ PPP PPPPPP PPPPPPPP PPPPPPP AP Sbjct: 541 ASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAP 585 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/37 (67%), Positives = 25/37 (67%), Gaps = 10/37 (27%) Frame = -3 Query: 150 PPPPPP-----PPPPPPPPPP-----PPPPPPPPLAP 70 PPPPPP PPPPPPPPPP PPPPPPPP P Sbjct: 550 PPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPP 586 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 +PST PPPPPPPP P PPPPPPPP PP Sbjct: 556 LPSTGPPPPPPPPPPLPNQAPPPPPPPPAPP 586 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/39 (61%), Positives = 27/39 (69%), Gaps = 5/39 (12%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP-----PPPPPPPPPPPPPLAP 70 P+ + + PPPP PPPPPP PPPPPPPPPP P AP Sbjct: 538 PAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAP 576 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 16/46 (34%) Frame = -3 Query: 150 PPPPPP-----------PPPPPPPPPPP-----PPPPPPPLAPKHN 61 PPPPPP PPPP PPPPPP PPPPPPP P N Sbjct: 528 PPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPN 573 [249][TOP] >UniRef100_UPI00006A0DA0 zinc finger homeodomain 4 n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A0DA0 Length = 1612 Score = 68.2 bits (165), Expect = 3e-10 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 17/51 (33%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPP-----------------PPPPPPPPPPPPPLAP 70 PS+ +PPPPPPPPPPPP PPPPPPPPPPPPP AP Sbjct: 25 PSSPETPPPPPPPPPPPPPPTSLPAQALPPAPPPTPPPPPPPPPPPPPSAP 75 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/50 (54%), Positives = 28/50 (56%), Gaps = 15/50 (30%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPP---------------PPPPPPPPPPPPPPLAPK 67 P T PPPPPPPPPPP PPPPPPPPPPPPP P+ Sbjct: 28 PETPPPPPPPPPPPPPPTSLPAQALPPAPPPTPPPPPPPPPPPPPSAPPQ 77 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 177 NIPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPLAP 70 ++P+ ++ P PPP PPPPPPPPPPPPP PP P Sbjct: 46 SLPAQALPPAPPPTPPPPPPPPPPPPPSAPPQVQLP 81 [250][TOP] >UniRef100_UPI000069F105 Formin-like protein 3 (Formin homology 2 domain-containing protein 3). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069F105 Length = 1108 Score = 68.2 bits (165), Expect = 3e-10 Identities = 28/45 (62%), Positives = 30/45 (66%), Gaps = 6/45 (13%) Frame = -3 Query: 168 STSISPPPPPPPPPPPPPPPPPPPP------PPPPPLAPKHNSLL 52 S PPPPPPPPPPPPPPPPPPPP PPPPPL S++ Sbjct: 606 SVPAPPPPPPPPPPPPPPPPPPPPPMPTGKCPPPPPLPSSSPSVI 650 Score = 67.8 bits (164), Expect = 4e-10 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPP 82 P S S P PPPPPPPPPPPPPPPPPPPPP Sbjct: 601 PPASASVPAPPPPPPPPPPPPPPPPPPPPP 630 Score = 67.8 bits (164), Expect = 4e-10 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 171 PSTSISPPPPPPPPPPPPPPPPPPPPPPPPP 79 P+++ P PPPPPPPPPPPPPPPPPPPPP P Sbjct: 602 PASASVPAPPPPPPPPPPPPPPPPPPPPPMP 632 Score = 65.9 bits (159), Expect = 1e-09 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -3 Query: 174 IPSTSISPPPPPPPPPPPPPPPPPPPPPPPPPL 76 +P + + P PPPPPPPPPPPPPPPPPPPPP+ Sbjct: 599 LPPPASASVPAPPPPPPPPPPPPPPPPPPPPPM 631 Score = 65.5 bits (158), Expect = 2e-09 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 5/38 (13%) Frame = -3 Query: 168 STSISPPP-----PPPPPPPPPPPPPPPPPPPPPPLAP 70 S + PPP P PPPPPPPPPPPPPPPPPPPP P Sbjct: 595 SAELLPPPASASVPAPPPPPPPPPPPPPPPPPPPPPMP 632