[UP]
[1][TOP] >UniRef100_C3PP34 Actin polymerization protein RickA n=1 Tax=Rickettsia africae ESF-5 RepID=C3PP34_RICAE Length = 500 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/48 (56%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPP-PPPPPPPPPLAPKHNSLLNSKLEEDT 151 N IP +P PPPP PP PPP PPPPPPPPP+AP L+ +E T Sbjct: 329 NNIPPSPPPPPPPPPPPPPPPSPPPPPPPPPMAPAQAETLSKPVESTT 376 [2][TOP] >UniRef100_B2AWS3 Actin cytoskeleton-regulatory complex protein PAN1 n=1 Tax=Podospora anserina RepID=PAN1_PODAN Length = 1441 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +G P+AP PPPP P G PPPPPPPPPPP AP Sbjct: 1365 PGSGAPAAPPPPPPPAPGGAPPPPPPPPPPPGGAP 1399 [3][TOP] >UniRef100_Q2NNS2 1629capsid n=1 Tax=Hyphantria cunea nucleopolyhedrovirus RepID=Q2NNS2_NPVHC Length = 539 Score = 60.5 bits (145), Expect = 6e-08 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLA--PKHNSLLNSKLEE 145 P P P++PPPP PP PPPPPPPPPPPL+ P N LLN+ + E Sbjct: 242 PPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPPLSLPPIDNLLLNAIVSE 290 [4][TOP] >UniRef100_C3XUG5 Putative uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae RepID=C3XUG5_BRAFL Length = 1305 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 2/37 (5%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPP--PPPPPPPLAPKHNSL 124 P P PPPP PPGGPPPPP PPPPPPP AP + L Sbjct: 690 PGIPGAPPPPPPPGGPPPPPGAPPPPPPPKAPGSSHL 726 [5][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/49 (48%), Positives = 31/49 (63%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQFVFL 166 P P PPPP PP PPPPPPPPPPPPL P +++ + + F+F+ Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIPLRTQFFLLFLFI 119 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 LPPRPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [6][TOP] >UniRef100_C5FYD5 DUF1720 domain-containing protein n=1 Tax=Microsporum canis CBS 113480 RepID=C5FYD5_NANOT Length = 1455 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/35 (74%), Positives = 26/35 (74%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P G PSAP PPPP PPGG PPPPPPPPPP AP Sbjct: 1379 PNMGAPSAPP-PPPPPPPGGAPPPPPPPPPPGPAP 1412 [7][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P +PS PPPP PP PPPPPPPPPPPP +P Sbjct: 77 PQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P P PPPP PP PPPPPPPPPPPP +P Sbjct: 91 PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSP 125 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 97 PPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 111 PPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P+ P P +PPPP PP PPPPP PPPPPP P Sbjct: 84 SPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHN 118 P PS PPPP PP PPP PPPPPPPP P N Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPN 138 [8][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 59.3 bits (142), Expect = 1e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLN 130 SAP PPPPRPP PPPPPPPPPPPP P ++ N Sbjct: 333 SAPPPPPPPRPPPPPPPPPPPPPPPPPPPALKNVEN 368 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNS 133 SAP PPPPRPP PPPPPPPPPPP L N ++ S Sbjct: 780 SAPPPPPPPRPPPPPPPPPPPPPPPALKNVENPMIPS 816 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNS 133 P + P P PPP PP PPPPPPPPPPP L N ++ S Sbjct: 331 PVSAPPPPPPPRPPPPPPPPPPPPPPPPPPPALKNVENPMIPS 373 [9][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 154 P P PPPP PP PPPPPPPPPPPP H S+ L E+ Q Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQ 545 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S P PPPP PP PPPPPPPPPPPP P Sbjct: 487 SPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 [10][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA P AP PPPP PP PPPPP PPPPPP AP Sbjct: 616 PAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAP 650 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA P AP PP P PP PPPPPPPPP PP P Sbjct: 648 PAPPPPPAPPPPPAPAPPPAPPPPPPPPPAPPPPP 682 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA P P PP P PP PPPPPPP PPPP AP Sbjct: 622 PAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPPPAP 656 [11][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLA 106 PA P+ P PPPP PP PPPPPPPPPPPP A Sbjct: 57 PAQARPTPPPPPPPPPPPPPPPPPPPPPPPPPAA 90 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/38 (60%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Frame = +2 Query: 2 NPANGIPSA--PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 NP + P+ P+ PPPP PP PPPPPPPPPPPP P Sbjct: 51 NPQSAAPAQARPTPPPPPPPPPPPPPPPPPPPPPPPPP 88 [12][TOP] >UniRef100_A7Z068 LMOD2 protein n=1 Tax=Bos taurus RepID=A7Z068_BOVIN Length = 553 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P +P+ PPPP PP PPPPPPPPPPPPLAP+ Sbjct: 414 PPSPAAPPPPPPP--PPPPPPPPPPPPLAPQ 442 [13][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA +P+ S PPPP PP PPPPPPPPPPPP P Sbjct: 975 PAEEVPNGLSPPPPPPPPPPPPPPPPPPPPPPPPP 1009 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 NG+ P PPPP PP PPPPPPPPPPPP P Sbjct: 981 NGLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1013 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P PPPP PP PPPPPPPPPPPP Sbjct: 988 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1014 [14][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 3/54 (5%) Frame = +2 Query: 2 NPANGIPSAPSIP---PPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 154 +PA + SAPS P PP PP PPPPPPPPPPPP P +SL + E+ + Sbjct: 3051 SPALSLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPPSSSLSGQQTEQQNK 3104 [15][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P PPPP PP PPPPPPPPPPPPL P Sbjct: 424 LPPPPPPPPPPPPPPPPPPPPPPPPPPPLLP 454 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAPKHNSLL 127 PPPP PP PPPPPPPPPPPP PK +L Sbjct: 148 PPPPPPPPPPPPPPPPPPPPPKPPKTQHVL 177 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPP L P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPLLPP 455 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLE 142 S+ + PPPP PP PPPPPPPPPPPP P + K++ Sbjct: 142 SSQTPPPPPPPPPPPPPPPPPPPPPPPKPPKTQHVLKKVQ 181 [16][TOP] >UniRef100_C6XK60 OmpA/MotB domain protein n=1 Tax=Hirschia baltica ATCC 49814 RepID=C6XK60_HIRBI Length = 386 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 G P+AP PPPP PP PPPPPPPPPPPP Sbjct: 229 GAPAAPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 N + AP+ PPPP PP PPPPPPPPPPPP P Sbjct: 225 NFLLGAPAAPPPPPPPPPPPPPPPPPPPPPPPP 257 [17][TOP] >UniRef100_A5P9Z0 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. SD-21 RepID=A5P9Z0_9SPHN Length = 359 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 G P P PPPP PP PPPPPPPPPPPP AP Sbjct: 211 GAPVPPPPPPPPPPPPPPPPPPPPPPPPPPAP 242 [18][TOP] >UniRef100_Q33AC7 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa Japonica Group RepID=Q33AC7_ORYSJ Length = 1874 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPP-PPLAPKHNS 121 PA P+APS PPPP P PPPPPPPPPP PP PK S Sbjct: 1491 PAPPSPTAPSPPPPPAAPSPPPPPPPPPPPCPPAPPKTRS 1530 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P +P+ P PP PP P PPPPPPPPPP P Sbjct: 1488 PSPPAPPSPTAPSPPPPPAAPSPPPPPPPPPPPCP 1522 [19][TOP] >UniRef100_A7R244 Chromosome undetermined scaffold_398, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R244_VITVI Length = 822 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNS 133 SAP PPPPRPP PPPPPPPPPPP L N ++ S Sbjct: 333 SAPPPPPPPRPPPPPPPPPPPPPPPALKNVENPMIPS 369 [20][TOP] >UniRef100_C3XX60 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3XX60_BRAFL Length = 908 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPP---PPPPLAP 109 A GIP+ IPPPP PPGG PPPPPPP PPPP P Sbjct: 482 AGGIPAGTGIPPPPPPPGGIPPPPPPPGGIPPPPPPP 518 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 7/42 (16%) Frame = +2 Query: 5 PANGIPSAP----SIPPPPRPPGGPPPPPPPPP---PPPLAP 109 P GIP P IPPPP PPGG PPPPPPPP PPP P Sbjct: 497 PPGGIPPPPPPPGGIPPPPPPPGGGPPPPPPPPGGGPPPPPP 538 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%), Gaps = 7/39 (17%) Frame = +2 Query: 14 GIPSAP----SIPPPPRPPGGPPPPPPPP---PPPPLAP 109 GIP P IPPPP PPGG PPPPPPP PPPP P Sbjct: 490 GIPPPPPPPGGIPPPPPPPGGIPPPPPPPGGGPPPPPPP 528 [21][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/35 (62%), Positives = 25/35 (71%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 P P PPPP PP PPPPPPPPPPPP P++N + Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEV 37 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 P P PPPP PP PPPPPPPPPPPP P N+ Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPENN 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 [22][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P+ P +PPPP PP PPPPPPPPPPPPL Sbjct: 543 PATPPMPPPPPPPPPPPPPPPPPPPPPL 570 [23][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 NPA P P PPPP PP PPPPPPPPPPPP+ Sbjct: 42 NPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 75 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNS 133 P+ P PPPP PP PPPPPPPPPPPP P L+ S Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVKLIAS 80 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 N P P PPPP PP PPPPPPPPPPPP P Sbjct: 42 NPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [24][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P P PPPP PP PPPPPPPPPPPP P LL S + Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNM 56 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLL 127 P P PPPP PP PPPPPPPPPPPPL + S + Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYM 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [25][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/39 (56%), Positives = 25/39 (64%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSK 136 P P PPPP PP PPPPPPPPPPPP P H ++ + Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRR 48 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSK 136 P P PPPP PP PPPPPPPPPPPP P + L S+ Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSR 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [26][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPPRPP PPPPPPPPPPPP P Sbjct: 16 PPLPPPPPPPRPPPPPPPPPPPPPPPPPPP 45 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 N I P +PPPP PP PPPPPPPPPPPP P Sbjct: 10 NEIYLPPPLPPPPPPPRPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPRPPPPPPPPPPPPPPPPPPPPPPPLP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P PPPP PP PPPPPPPPPPPP Sbjct: 21 PPPPPRPPPPPPPPPPPPPPPPPPPPP 47 [27][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPPL P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P PPPP PP PPPPPPPPPPPP P Sbjct: 233 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 273 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 P P PPPP PP PP PPPPPPPPPL P SL Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSL 289 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +PPPP PP PPPPPPPPPPPP P Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P PPPP PP PPPPPPPPPPPP P Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 [28][TOP] >UniRef100_B4RDQ2 OmpA family protein n=1 Tax=Phenylobacterium zucineum HLK1 RepID=B4RDQ2_PHEZH Length = 410 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 +AP PPPP PP PPPPPPPPPPPP AP + + Sbjct: 269 AAPPPPPPPPPPPPPPPPPPPPPPPPPAPAYEA 301 [29][TOP] >UniRef100_A4TEZ3 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4TEZ3_MYCGI Length = 177 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P PPPP PPG PPPPPPPPPPPP Sbjct: 123 PPPPPPPPPPPPPGAPPPPPPPPPPPP 149 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PPPP PP G PPPPPPPPPPP P Sbjct: 125 PPPPPPPPPPPGAPPPPPPPPPPPPPP 151 [30][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPPL P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P +P PPPP PP PPPPPPPPPPPP P Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P +P P PPPP PP PPPPPPPPPPPP P Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPPPPPPP P Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPP 259 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P P PPPP PP PPPPPPPPPPPP P Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKH 115 P PS PPPP PP PPPPPPPPPPPP P H Sbjct: 674 PLPPSPPPPPPPP--PPPPPPPPPPPPPPPPH 703 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P P PPPP PP PPPPPPPPPPPP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P PS PPP PP PPPPPPPPPPPP P Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P +PP P PP PPPPPPPPPPPP P Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ PS P PP P PP PPPPPPPPPPPP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPPPPPPPPP P Sbjct: 677 PSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 [31][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLL 127 P P PPPP PP PPPPPPPPPPPP P N+++ Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 73 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [32][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLL 127 P P PPPP PP PPPPPPPPPPPP P N+++ Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 73 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P +PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPLPPPPPPPPPPPPPPPPPPP 50 [33][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLL 127 P P PPPP PP PPPPPPPPPPPP P N+++ Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIV 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 [34][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P + +P +P PPPP PP PPPPPPPPPPPP Sbjct: 251 PPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPP 282 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/40 (60%), Positives = 25/40 (62%), Gaps = 4/40 (10%) Frame = +2 Query: 2 NPANGIPSAPS----IPPPPRPPGGPPPPPPPPPPPPLAP 109 +PA P PS PPPP PP PPPPPPPPPPPP P Sbjct: 243 SPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPP 282 [35][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P AP PPPP PP PPPPPPPPPPPP P Sbjct: 58 LPPAPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPPL P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA P P PPPP PP PPPPPPPPPPPP P Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPPPPPPP P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLE 142 P P PPPP PP PPPPPPPPPPP P S N LE Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLHLE 116 [36][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/42 (57%), Positives = 28/42 (66%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 G PS+ PPPP PP PPPPPPPPPPPP P +L + K+ Sbjct: 492 GGPSSTPPPPPPPPPPPPPPPPPPPPPPPPPPPSVTLSSQKM 533 [37][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKH 115 P P PPPP PP PPPPPPPPPPPP P H Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPH 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 [38][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 PA P P PPPP PP PPPPPPPPPPPP + K Sbjct: 347 PAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPPASTK 382 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P A PPPP PP PPPPPPPPPPPP P Sbjct: 346 PPAAQAPPPPPPPPPPPPPPPPPPPPPPPP 375 [39][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P PS PPPP PP PPPPPPPPPPPP P Sbjct: 164 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 198 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPPPPPPPPPP P Sbjct: 172 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P +P PPPP PP PPPPPPPPPPPP P Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P P PPPP PP PPPPPPPPPPPP P Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P PPPP PP PPPPPPPPPPPP P Sbjct: 171 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLE 142 P P PPPP PP PPPPPPPPPPPP N+ L L+ Sbjct: 174 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNARLKIALK 214 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P + P P PPPP PP PPPPPPPPPPPP+ Sbjct: 171 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 203 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P PS PPPP PP PPP PPPPPPPP P Sbjct: 150 PSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPP 184 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PS PPPP P PPPPPPPPPPPP P Sbjct: 156 PPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 190 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P P PPPP PP PPPPPPPPPPPP Sbjct: 170 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPP PPPPPPP P Sbjct: 132 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPP 161 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPP PPPPPPP P Sbjct: 146 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPP 175 [40][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPPPPPP PPPL P Sbjct: 33 PSPPPPPPPPPPPSPPPPPPPPPSPPPLPP 62 [41][TOP] >UniRef100_UPI000024DCC5 zinc finger homeodomain 4 n=1 Tax=Mus musculus RepID=UPI000024DCC5 Length = 3581 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 + + P PPPP PP PPPPPPPPPPPP AP+ L Sbjct: 2005 LQAPPPTPPPPPPPPPPPPPPPPPPPPPSAPQQVQL 2040 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 SAP PPP PP PPPPPPPPPPPP P Sbjct: 2002 SAPLQAPPPTPPPPPPPPPPPPPPPPPPP 2030 [42][TOP] >UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus RepID=Q9DVW0_9BBAC Length = 158 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA P+AP PPPP PP PPPPPPPPP PP P Sbjct: 85 PAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTP 119 [43][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P IP P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPPPPPPP P Sbjct: 63 PPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 104 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPPRP PPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 [44][TOP] >UniRef100_A1UCC3 Putative uncharacterized protein n=2 Tax=Mycobacterium RepID=A1UCC3_MYCSK Length = 135 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P PPPP PPG PPPPPPPPPPP P Sbjct: 82 LPPPPPPPPPPPPPGAPPPPPPPPPPPVYVP 112 [45][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKH 115 PS P PPPP PP PPPPPPPPPPPP P + Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S PS PPPP PP PPPPPPPPPPPP P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P PPPP PP PPPPPPPPPPPP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 +P + P P PPPP PP PPPPPPPPPPPP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 [46][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLL 127 P P PPPP PP PPPPPPPPPPPP P+ + +L Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEIL 50 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 P P PPPP PP PPPPPPPPPPPP P S Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [47][TOP] >UniRef100_C5XBT9 Putative uncharacterized protein Sb02g005130 n=1 Tax=Sorghum bicolor RepID=C5XBT9_SORBI Length = 984 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/42 (57%), Positives = 27/42 (64%), Gaps = 5/42 (11%) Frame = +2 Query: 5 PANGIPSAPSIPPP--PRP---PGGPPPPPPPPPPPPLAPKH 115 P + +P P +PPP PRP P PPPPPPPPPPPP P H Sbjct: 6 PGDSVPPPPPLPPPQPPRPSRHPAPPPPPPPPPPPPPPPPSH 47 [48][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 +P+ P PPPP PP PPPPPPPPPPPP P+ Sbjct: 50 VPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 26 APSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 AP PPPP PP PPPPPPPPPPPP P L Sbjct: 52 APPPPPPPPPPPPPPPPPPPPPPPPPPPPQQPL 84 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPQQP 83 [49][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 57.4 bits (137), Expect = 5e-07 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P PPPP P PPPPPPPPPPPP++P Sbjct: 151 LPQPPPPPPPPPPASAPPPPPPPPPPPPISP 181 [50][TOP] >UniRef100_B2WP65 Predicted protein n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2WP65_PYRTR Length = 332 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/48 (52%), Positives = 27/48 (56%), Gaps = 13/48 (27%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGG-------------PPPPPPPPPPPPLAP 109 P + P P +PPPP PPGG PPPPPPPPPPPP AP Sbjct: 30 PDSQAPPLPHLPPPPPPPGGVPTWVAAYGAIPPPPPPPPPPPPPPQAP 77 [51][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PPPP PP PPPPPPPPPPPP P Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPPPPPPPPPP P Sbjct: 378 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P P PPPP PP PPPPPPPPPPPP P Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCP 411 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 NP P P PPPP PP PPPPPP PPPPP P Sbjct: 352 NPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 387 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 369 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P P PPPP PP PPPPPPPPPPPP Sbjct: 376 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P P PPPP PP PPPPPPPPPPP P Sbjct: 348 PPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPP 382 [52][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P P +PPPP PP PPPPPPPPPPPPL Sbjct: 255 PVTPPMPPPPPPPPPPPPPPPPPPPPPL 282 [53][TOP] >UniRef100_UPI0001796DF5 PREDICTED: similar to jumonji domain containing 3, histone lysine demethylase n=1 Tax=Equus caballus RepID=UPI0001796DF5 Length = 1785 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 G+P +PPPP PP PPPPPPPPPPPPL Sbjct: 239 GLPPGLPLPPPPLPPPPPPPPPPPPPPPPL 268 [54][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 + + + P PPPP PP PPPPPPPPPPPP P +S+ Sbjct: 2795 SAVATPPPPPPPPTPPPPPPPPPPPPPPPPPPPPQHSI 2832 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 A I + + PPPP PP PPPPPPPPPPPP P Sbjct: 2791 AAAISAVATPPPPPPPPTPPPPPPPPPPPPPPPP 2824 [55][TOP] >UniRef100_UPI0000E1F764 PREDICTED: formin-like 2 isoform 6 n=1 Tax=Pan troglodytes RepID=UPI0000E1F764 Length = 1032 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPL-APKHNSLLNSKLEEDTQFVFLLP 172 NG + P PPPP PP PPPPPPPPPPPPL P + + K+++ + F +P Sbjct: 513 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETGPSVKIKKPIKTKFRMP 567 [56][TOP] >UniRef100_UPI0001B798A6 UPI0001B798A6 related cluster n=1 Tax=Homo sapiens RepID=UPI0001B798A6 Length = 625 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P P +PPPP PP PPPPPPPPPPPPL Sbjct: 85 PVTPPMPPPPPPPPPPPPPPPPPPPPPL 112 [57][TOP] >UniRef100_UPI0001951250 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Canis lupus familiaris RepID=UPI0001951250 Length = 1052 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P P +PPPP PP PPPPPPPPPPPPL Sbjct: 506 PVTPPMPPPPPPPPPPPPPPPPPPPPPL 533 [58][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 G P P PPPP PP PPPPPPPPPPPP P Sbjct: 650 GAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 681 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 655 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 + + P PPPP PP PPPPPPPPPPPP P Sbjct: 649 VGAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 679 [59][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 N A P P PPPP PP PPPPPPP PPPP PK Sbjct: 38 NKAEAAPPPPPPPPPPPPPPPPPPPPPPTPPPPPLPK 74 [60][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 N A P P PPPP PP PPPPPPP PPPP PK Sbjct: 38 NKAEAAPPPPPPPPPPPPPPPPPPPPPPTPPPPPLPK 74 [61][TOP] >UniRef100_Q7XRW4 OSJNBb0062H02.5 protein n=2 Tax=Oryza sativa RepID=Q7XRW4_ORYSJ Length = 577 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA P+ P PP P PP PPPPPPPPPPPP P Sbjct: 257 PAPSPPAPPPPPPAPSPPAPPPPPPPPPPPPPCPP 291 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P PS P+ PPPP P P PPPPPPPPPP P Sbjct: 253 SPRPPAPSPPAPPPPPPAPSPPAPPPPPPPPPPPPP 288 [62][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PPPP PP PPPPPPPPPPPP P Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 PS P PPPP PP PPPPPPPPPPPP Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPP-PPLAP 109 P + +P +P PPPP PP PPPPPPPPPP PP +P Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSP 253 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS PPPP PP PPPPPPPPPPPP +P Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + PS P PPPP PP PPPPPPPPPP P P Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 P PPPP PP PPPPPPPPPPPP+ P S+ Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPVYPDQCSV 310 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P +P PPPP PP PP PPPPPPPPP P Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPP 264 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PP P PP PPPPPPPPPPPP P Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/36 (58%), Positives = 22/36 (61%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P P PPP PP PPPPPPPPPPPP P Sbjct: 233 SPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P +P PPPP PP PPPPPPPPPPP P Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 [63][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSK 136 P P PPPP PP PPPPPPPPPPPP P L+ S+ Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSR 104 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 [64][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPL-APK 112 P P PPPP PP PPPPPPPPPPPPL APK Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPK 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [65][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP PK Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPK 45 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPKTPR 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 [66][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 57.0 bits (136), Expect = 6e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP AP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPAP 68 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P PPPP PP PPPPPPPPPPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PPPP PP PPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [67][TOP] >UniRef100_Q96PY5-3 Isoform 2 of Formin-like protein 2 n=1 Tax=Homo sapiens RepID=Q96PY5-3 Length = 1092 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P P +PPPP PP PPPPPPPPPPPPL Sbjct: 547 PVTPPMPPPPPPPPPPPPPPPPPPPPPL 574 [68][TOP] >UniRef100_Q96PY5 Formin-like protein 2 n=1 Tax=Homo sapiens RepID=FMNL2_HUMAN Length = 1086 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P P +PPPP PP PPPPPPPPPPPPL Sbjct: 547 PVTPPMPPPPPPPPPPPPPPPPPPPPPL 574 [69][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 256 PCPPPCPPPPPPPPPPPPPPPPPPPPPCPP 285 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPPPCP 319 [70][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA + P+ PPPP PP PPPPPPPPPPPP P Sbjct: 843 PAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPP 877 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP AP Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P PPPP PP PPPPPPPPPPPP P Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPP 880 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPPPPPPP P Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 [71][TOP] >UniRef100_UPI0001861057 hypothetical protein BRAFLDRAFT_119668 n=1 Tax=Branchiostoma floridae RepID=UPI0001861057 Length = 1593 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 3/35 (8%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPP---PPPPLAP 109 GIP+ +PPPP PPGG PPPPPPP PPPP P Sbjct: 865 GIPAGTGVPPPPPPPGGIPPPPPPPGGIPPPPPPP 899 [72][TOP] >UniRef100_UPI0000E1F761 PREDICTED: formin-like 2 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E1F761 Length = 1087 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P +PPPP PP PPPPPPPPPPPP P Sbjct: 547 PVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 576 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 NG + P PPPP PP PPPPPPPPPPPPL Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPL 575 [73][TOP] >UniRef100_UPI0000E1F760 PREDICTED: formin-like 2 isoform 8 n=1 Tax=Pan troglodytes RepID=UPI0000E1F760 Length = 1093 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P +PPPP PP PPPPPPPPPPPP P Sbjct: 547 PVTPPMPPPPPPPPPPPPPPPPPPPPPPLP 576 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 NG + P PPPP PP PPPPPPPPPPPPL Sbjct: 545 NGPVTPPMPPPPPPPPPPPPPPPPPPPPPPL 575 [74][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPPPPPPP P Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTP 1441 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPP PP AP Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 [75][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P P PPPP PP PPPPPPPPPPPP P Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PPPP P PPPPPPPPPPPP P Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/34 (58%), Positives = 22/34 (64%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 + G+ P PPPP PP PPPP PPPPPPP P Sbjct: 481 SGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPP 514 [76][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P+AP PPPP PP PPPPPPPPPPPP Sbjct: 242 PAAPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ PPPP PP PPPPPPPPPPPP P Sbjct: 242 PAAPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PPPP PP PPPPPPPPPPPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPAKP 273 [77][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P+ P P PPPP PP PPPPPPPPPPPP P Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PPPP PP PPPPPPPP PPP +P Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 [78][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 IP P PPPP PP PPPPPPPPPPPP P Sbjct: 76 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPPPTCP 118 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [79][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 NP P P PPPP PP PPPPPPPPPPPP+ Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPI 75 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNS 133 P P PPPP PP PPPPPPPPPPPP P L+ S Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIKLIAS 80 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 N P P PPPP PP PPPPPPPPPPPP P Sbjct: 42 NPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [80][TOP] >UniRef100_C4QFT9 Diaphanous, putative n=1 Tax=Schistosoma mansoni RepID=C4QFT9_SCHMA Length = 1068 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 ++ IP P IPPPP G PPPPPPPPPPPP P Sbjct: 487 SSSIPPPPGIPPPPPMEGVPPPPPPPPPPPPPPP 520 [81][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 P P PPPP PP PPPPPPPPPPPP P+ L Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHL 111 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 [82][TOP] >UniRef100_B7PET5 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PET5_IXOSC Length = 954 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/44 (54%), Positives = 27/44 (61%), Gaps = 9/44 (20%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPP---------PPPLAP 109 PA+G SAP+ PPPP P PPPPPPPPP PPP+ P Sbjct: 406 PASGASSAPAPPPPPMPASAPPPPPPPPPMPGCNAIPVPPPMVP 449 [83][TOP] >UniRef100_A9URA4 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9URA4_MONBE Length = 1593 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRP--PGGPPP-PPPPPPPPPLAP 109 P GIP AP PPPP P PG PPP PPPPPPPPP P Sbjct: 1026 PLPGIPGAPPPPPPPPPGIPGAPPPLPPPPPPPPPGIP 1063 [84][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P+ P P PPPP PP PPPPPPPPPPPP P Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P +PS PPPP PP PPPPPPP PPPP P Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P PS P PPPP PP PPPP PPPPPPP P Sbjct: 252 SPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P P PPPP PP PP PPPPPPPPP P Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P P PPPP PP P PPPPPPPPPP P Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 [85][TOP] >UniRef100_UPI00017EFCA0 PREDICTED: dishevelled associated activator of morphogenesis 1 n=1 Tax=Sus scrofa RepID=UPI00017EFCA0 Length = 833 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPP-----PPPLAPKHNSLLNSKLEEDT 151 P +P P PPPP PPGGPPPPP PPP PPP AP +L + + T Sbjct: 549 PPPPLPGMPPPPPPPLPPGGPPPPPGPPPLGGIMPPPGAPLGLALKKKNIPQPT 602 [86][TOP] >UniRef100_UPI000175F433 PREDICTED: similar to formin-like 1 n=1 Tax=Danio rerio RepID=UPI000175F433 Length = 1102 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPP-----PPPPPLAP 109 P +G AP PPPP PPGG PPPPPP PPPPP AP Sbjct: 601 PPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAP 640 [87][TOP] >UniRef100_UPI000155EC14 PREDICTED: similar to SET binding protein 1 n=1 Tax=Equus caballus RepID=UPI000155EC14 Length = 1597 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +2 Query: 26 APSIPPPPRPPGGPPPPPPPPPPPPL 103 AP +PPPP PP PPPPPPPPPPPPL Sbjct: 1519 APPLPPPPPPPLPPPPPPPPPPPPPL 1544 [88][TOP] >UniRef100_UPI0001A2D69A UPI0001A2D69A related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D69A Length = 1058 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPP-----PPPPPLAP 109 P +G AP PPPP PPGG PPPPPP PPPPP AP Sbjct: 548 PPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAP 587 [89][TOP] >UniRef100_UPI0001B7AE60 UPI0001B7AE60 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7AE60 Length = 1992 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 8/54 (14%) Frame = +2 Query: 20 PSAPSI--------PPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQF 157 PSAP PP P PP PPPPPPPPPPP + PK +S+ + +ED+ F Sbjct: 1513 PSAPPARSCVPMTRPPVPIPPPPPPPPPPPPPPPVIKPKTSSVKQERWDEDSFF 1566 [90][TOP] >UniRef100_UPI0001B7AE51 UPI0001B7AE51 related cluster n=1 Tax=Rattus norvegicus RepID=UPI0001B7AE51 Length = 1377 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 8/54 (14%) Frame = +2 Query: 20 PSAPSI--------PPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQF 157 PSAP PP P PP PPPPPPPPPPP + PK +S+ + +ED+ F Sbjct: 762 PSAPPARSCVPMTRPPVPIPPPPPPPPPPPPPPPVIKPKTSSVKQERWDEDSFF 815 [91][TOP] >UniRef100_UPI00016E72E1 UPI00016E72E1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72E1 Length = 951 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/45 (55%), Positives = 28/45 (62%), Gaps = 10/45 (22%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPP----------PPPPPPLAP 109 P++ P+AP PPPP PP PPPPPP PPPPPPLAP Sbjct: 446 PSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 490 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLA 106 ANG PS+PS PP PP PPPPPPPPPPP LA Sbjct: 443 ANG-PSSPSPAAPPPPPPPPPPPPPPPPPPGLA 474 [92][TOP] >UniRef100_UPI00016E72E0 UPI00016E72E0 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72E0 Length = 1054 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/45 (55%), Positives = 28/45 (62%), Gaps = 10/45 (22%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPP----------PPPPPPLAP 109 P++ P+AP PPPP PP PPPPPP PPPPPPLAP Sbjct: 520 PSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 564 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLA 106 ANG PS+PS PP PP PPPPPPPPPPP LA Sbjct: 517 ANG-PSSPSPAAPPPPPPPPPPPPPPPPPPGLA 548 [93][TOP] >UniRef100_UPI00016E72DE UPI00016E72DE related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72DE Length = 1032 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/45 (55%), Positives = 28/45 (62%), Gaps = 10/45 (22%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPP----------PPPPPPLAP 109 P++ P+AP PPPP PP PPPPPP PPPPPPLAP Sbjct: 508 PSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 552 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLA 106 ANG PS+PS PP PP PPPPPPPPPPP LA Sbjct: 505 ANG-PSSPSPAAPPPPPPPPPPPPPPPPPPGLA 536 [94][TOP] >UniRef100_UPI00016E72DD UPI00016E72DD related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72DD Length = 1092 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/45 (55%), Positives = 28/45 (62%), Gaps = 10/45 (22%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPP----------PPPPPPLAP 109 P++ P+AP PPPP PP PPPPPP PPPPPPLAP Sbjct: 552 PSSPSPAAPPPPPPPPPPPPPPPPPPGLASEISVPLPPPPPPLAP 596 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLA 106 ANG PS+PS PP PP PPPPPPPPPPP LA Sbjct: 549 ANG-PSSPSPAAPPPPPPPPPPPPPPPPPPGLA 580 [95][TOP] >UniRef100_UPI000179D41E UPI000179D41E related cluster n=1 Tax=Bos taurus RepID=UPI000179D41E Length = 1416 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +2 Query: 26 APSIPPPPRPPGGPPPPPPPPPPPPL 103 AP +PPPP PP PPPPPPPPPPPPL Sbjct: 1338 APPLPPPPPPPLPPPPPPPPPPPPPL 1363 [96][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPFQP 264 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 A G P PPPP PP PPPPPPPPPPPP P Sbjct: 227 AAGFAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 261 [97][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPPTTP 251 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +AP PPPP PP PPPPPPPPPPPP P Sbjct: 220 AAPPPPPPPPPPPPPPPPPPPPPPPPPPP 248 [98][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 P P PPPP PP PPPPPPPPPPPP P N+ Sbjct: 224 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNT 257 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 26 APSIPPPPRPPGGPPPPPPPPPPPPLAP 109 AP PPPP PP PPPPPPPPPPPP P Sbjct: 223 APPPPPPPPPPPPPPPPPPPPPPPPPPP 250 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 G + P PPPP PP PPPPPPPPPPPP P Sbjct: 220 GGEAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 251 [99][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 G + P PPPP PP PPPPPPPPPPPP AP+ Sbjct: 227 GQDAPPPPPPPPPPPPPPPPPPPPPPPPPPAPE 259 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 G AP PPPP PP PPPPPPPPPPPP Sbjct: 226 GGQDAPPPPPPPPPPPPPPPPPPPPPPPP 254 [100][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/37 (59%), Positives = 24/37 (64%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKH 115 P P PS PPPP PP P PPPPP PPPP +P+H Sbjct: 551 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRH 587 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS PS PPPP PP P PPPPP PPPP +P Sbjct: 520 PSPPSPPPPPSPPPPPSPPPPPSPPPPPSP 549 [101][TOP] >UniRef100_B9RYC5 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RYC5_RICCO Length = 510 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 96 PPPPKHPPPPPPPSPPPPPPPPPPPPPPRP 125 [102][TOP] >UniRef100_A8J9H7 Mastigoneme-like flagellar protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8J9H7_CHLRE Length = 1987 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/45 (55%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPP---PPLAPKHNSLLN 130 P + PS P PPPPRPP PPPPP PPPP PP P +S +N Sbjct: 1894 PTSPPPSPPPSPPPPRPPPPPPPPPSPPPPNRSPPPPPPASSAIN 1938 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPP--PPPPPPPPLAPKHN 118 +PA P+ P PPP PP PPPP PPPPPPPP P N Sbjct: 1884 SPAPPSPNPPPTSPPPSPPPSPPPPRPPPPPPPPPSPPPPN 1924 [103][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ PS P PPPP PP PPPPPP PPPPP +P Sbjct: 1553 PSPPPPSPPPSPPPPPPPPSPPPPPPSPPPPPPSP 1587 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPPPPPP PPP P Sbjct: 1549 PSPPPSPPPPSPPPSPPPPPPPPSPPPPPP 1578 [104][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P S+PS PPPP PP PPPPPPPPPPPP Sbjct: 1529 PPPSSSSSPSPPPPPPPPPPPPPPPPPPPPPP 1560 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS+ S P PP PP PPPPPPPPPPPP P Sbjct: 1531 PSSSSSPSPPPPPPPPPPPPPPPPPPPPPP 1560 [105][TOP] >UniRef100_C4LVH1 Diaphanous protein, homolog 2, putative n=1 Tax=Entamoeba histolytica HM-1:IMSS RepID=C4LVH1_ENTHI Length = 986 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/47 (55%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPG--GPPPPPPP-----PPPPPLAPKHNSL 124 P G+P A +PPPP PPG G PPPPPP PPPP LAP L Sbjct: 518 PPPGVPGATGVPPPPPPPGMPGAPPPPPPMGKGMPPPPGLAPAQTKL 564 [106][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 P P PPPP PP PPPPPPPPPPPP P L Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDL 35 [107][TOP] >UniRef100_B7PLD9 Circumsporozoite protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PLD9_IXOSC Length = 188 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLL 127 P + + PPPP PP PPPPPPPPPPPP P +++ Sbjct: 22 PRSETPPPPPPPPPPPPPPPPPPPPPPAPPSETTII 57 [108][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [109][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLN 130 P P PPPP PP PPPPPPPPPPPP P L N Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCN 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [110][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPR 150 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P PPPP PP PPPPPPPPPPPP P Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPP 147 [111][TOP] >UniRef100_B4ND74 GK24962 n=1 Tax=Drosophila willistoni RepID=B4ND74_DROWI Length = 282 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 26 APSIPPPPRPPGGPPPPPPPPPPPPLAP 109 AP PPPP PP PPPPPPPPPPPP P Sbjct: 80 APPAPPPPPPPTPPPPPPPPPPPPPTPP 107 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P AP PPPP PP PPPPPPPPP PP Sbjct: 76 PETIAPPAPPPPPPPTPPPPPPPPPPPPPTPP 107 [112][TOP] >UniRef100_A7S4U2 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S4U2_NEMVE Length = 448 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPP 100 SAP+ PPPP P G PPPPPPPPPPPP Sbjct: 268 SAPAPPPPPPPGGAPPPPPPPPPPPP 293 [113][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/33 (66%), Positives = 23/33 (69%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P + P PS PPPP PP PPPPPPP PPPPL Sbjct: 60 PPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPL 92 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P +P +PPPP PP PPPPPPP PPPP P Sbjct: 213 SPPAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPP 248 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PPPP PP PPPPP PPPPPP +P Sbjct: 11 PPPPSSPPPPPPPSPPPPPPSPPPPPPPSP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PPPP P PPPPPP PPPPPL+P Sbjct: 99 PPLPSPPPPPPLPSSPPPPPPSPPPPPLSP 128 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPP-PPPPPLAP 109 P PS PPPP PP PPPPPPP PPPPP +P Sbjct: 2 PPPPSPPPPPPPPSSPPPPPPPSPPPPPPSP 32 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA PS P PPPP PP PPPPPP PPPP P Sbjct: 215 PAPSPPSPPLPPPPPPPPSPPPPPPPSPPPPSPPP 249 [114][TOP] >UniRef100_C5MBX8 Putative uncharacterized protein n=1 Tax=Candida tropicalis MYA-3404 RepID=C5MBX8_CANTT Length = 1780 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/54 (48%), Positives = 27/54 (50%), Gaps = 13/54 (24%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPP-------------GGPPPPPPPPPPPPLAPKHNSLLN 130 + G P P PPPP PP GGPPPPPPPPPPPP P LN Sbjct: 1098 SGGAPPPPPPPPPPPPPPPMPGMLGGSGATGGPPPPPPPPPPPPPPPPPPGFLN 1151 [115][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ ++PPPP PP PPPPPPPPPPPP P Sbjct: 1027 PAVTAVPPPPPPPPPPPPPPPPPPPPPPPP 1056 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLA 106 +P P PPPP PP PPPPPPPPPPPP++ Sbjct: 1032 VPPPPPPPPPPPPPPPPPPPPPPPPPPPMS 1061 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 + + P PPPP PP PPPPPPPPPPPP P Sbjct: 1029 VTAVPPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 5/35 (14%) Frame = +2 Query: 20 PSAPSIPPPPRPP---GG--PPPPPPPPPPPPLAP 109 P P PPPP PP GG PPPPPPPPPPPP++P Sbjct: 1047 PPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMSP 1081 [116][TOP] >UniRef100_B6Q311 Actin associated protein Wsp1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q311_PENMQ Length = 627 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P++G P P PPPP P G PPPPPPPPPPP Sbjct: 468 PSSGAPPPPPPPPPPPPSSGIPPPPPPPPPPP 499 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPP 97 P++GIP P PPPP G PPPPPPPPPPP Sbjct: 484 PSSGIPPPPPPPPPPPSSGAPPPPPPPPPPP 514 [117][TOP] >UniRef100_P0CB49 YLP motif-containing protein 1 n=1 Tax=Rattus norvegicus RepID=YLPM1_RAT Length = 1376 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 8/54 (14%) Frame = +2 Query: 20 PSAPSI--------PPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQF 157 PSAP PP P PP PPPPPPPPPPP + PK +S+ + +ED+ F Sbjct: 761 PSAPPARSCVPMTRPPVPIPPPPPPPPPPPPPPPVIKPKTSSVKQERWDEDSFF 814 [118][TOP] >UniRef100_Q9Z0G8-2 Isoform 2 of WAS/WASL-interacting protein family member 3 n=2 Tax=Rattus norvegicus RepID=Q9Z0G8-2 Length = 451 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = +2 Query: 8 ANGIPSAPSIP--PPPRPPGGPPPPPPPPPPPPLAP 109 A +P PS+P PPP P PPPPPPPPPPPPL P Sbjct: 163 ARPVPPRPSVPAPPPPTTPPPPPPPPPPPPPPPLPP 198 [119][TOP] >UniRef100_Q9Z0G8 WAS/WASL-interacting protein family member 3 n=2 Tax=Rattus norvegicus RepID=WIPF3_RAT Length = 485 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/36 (63%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = +2 Query: 8 ANGIPSAPSIP--PPPRPPGGPPPPPPPPPPPPLAP 109 A +P PS+P PPP P PPPPPPPPPPPPL P Sbjct: 163 ARPVPPRPSVPAPPPPTTPPPPPPPPPPPPPPPLPP 198 [120][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 G+P P +PPPP PP PPPPPPPPPPPP P Sbjct: 57 GVP--PPLPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP +P Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSP 90 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PPPP PP PPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPP 91 [121][TOP] >UniRef100_UPI0001797D87 PREDICTED: diaphanous homolog 2 (Drosophila) n=1 Tax=Equus caballus RepID=UPI0001797D87 Length = 1092 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 ++GIP P PPP P GGPPPPPPPPPPPPL Sbjct: 546 SSGIPCPP--PPPVLPGGGPPPPPPPPPPPPL 575 [122][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSL 124 P + PS+PS PPPP PP PPP PPPPPPPP P SL Sbjct: 477 PPSRPPSSPSPPPPPPPP--PPPRPPPPPPPPSQPPPTSL 514 [123][TOP] >UniRef100_UPI000151AF18 hypothetical protein PGUG_03629 n=1 Tax=Pichia guilliermondii ATCC 6260 RepID=UPI000151AF18 Length = 1711 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 12/48 (25%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRP------------PGGPPPPPPPPPPPPLAP 109 N G+P AP PPPP P GGPPPPPPPPPPPP P Sbjct: 1058 NGTKGLPPAPPPPPPPPPLPPLLGGTVPKAAGGPPPPPPPPPPPPPPP 1105 [124][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S P PPPP PP PPPPPPPPPPPP P Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPP 29 [125][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 1476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPR 1506 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 A P P PPPP PP PPPPPPPPPPPP P Sbjct: 1468 ARETPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 1501 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1502 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/45 (46%), Positives = 26/45 (57%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 154 P P PPPP PP PPPPPPPPPP P P+ + + ++ Q Sbjct: 1479 PPPPPPPPPPPPPPPPPPPPPPPPPLPRTPRGGKRKHKQQQQQQQ 1523 [126][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +AP PPPP PP PPPPPPPPPPPP P Sbjct: 229 AAPPAPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P AP PPPP PP PPPPPPPPPPPP Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P+ P PPPP PP PPPPPPPPPPPP Sbjct: 232 PAPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ PPPP PP PPPPPPPPPPPP P Sbjct: 232 PAPPPPPPPPPPPPPPPPPPPPPPPPP 258 [127][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 P P PPPP PP PPPPPPPPPPPP P S Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVETS 502 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDT 151 P P PPPP PP PPPPPPPPPPPP+ +L D+ Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPVETSPKIVLAGTTANDS 515 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S P PPPP PP PPPPPPPPPPPP P Sbjct: 467 SPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 ++P PPPP PP PPPPPPPPPPPP P Sbjct: 466 ASPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 [128][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 P P PPPP PP PPPPPPPPPPPP P + + Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAYEA 292 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S P PPPP PP PPPPPPPPPPPP P Sbjct: 258 SPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 ++P PPPP PP PPPPPPPPPPPP P Sbjct: 257 ASPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 [129][TOP] >UniRef100_A3PW04 U5 snRNP spliceosome subunit-like protein n=1 Tax=Mycobacterium sp. JLS RepID=A3PW04_MYCSJ Length = 137 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPP 100 P PPPP PPG PPPPPPPPPPPP Sbjct: 85 PPPPPPPPPPGAPPPPPPPPPPPP 108 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PPPP PP G PPPPPPPPPPP P Sbjct: 84 PPPPPPPPPPPGAPPPPPPPPPPPPPP 110 [130][TOP] >UniRef100_Q5W6I0 Putative uncharacterized protein OSJNBb0115F21.14 n=1 Tax=Oryza sativa Japonica Group RepID=Q5W6I0_ORYSJ Length = 1197 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 PA P+ P PP P PP PPPPPPPPP PP PK S Sbjct: 745 PAPSPPAPPPPPPAPSPPAPPPPPPPPPPCPPAPPKTRS 783 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS P+ PPPP P P PPPPPPPPPP P Sbjct: 742 PRPPAPSPPAPPPPPPAPSPPAPPPPPPPPPPCPP 776 [131][TOP] >UniRef100_C7BGM8 Formin 2A n=1 Tax=Physcomitrella patens RepID=C7BGM8_PHYPA Length = 1238 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPP---------GGPPPPPPPPPPPPLAPKHNS 121 P G PS+ ++PPPP PP G P PPPPPPPPPP + NS Sbjct: 582 PFGGRPSSGAVPPPPPPPPPFGGRPASGAPAPPPPPPPPPPFGGRSNS 629 [132][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 A+ P P PPPP PP PPPPPPPPPPPP P Sbjct: 42 AHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +A S PPPP PP PPPPPPPPPPPP P Sbjct: 41 NAHSPPPPPPPPPPPPPPPPPPPPPPPPP 69 [133][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 114 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PA + + P PPPP PP PPPPPPPPPPPP P Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 [134][TOP] >UniRef100_B3M2B3 GF17078 n=1 Tax=Drosophila ananassae RepID=B3M2B3_DROAN Length = 599 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHN 118 P PPPP PP PPPPPPPPPPPP P H+ Sbjct: 158 PPPPPPPPPPPPPPPPPPPPPPPPHHPHHH 187 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAPKHN 118 PPPP PP PPPPPPPPPPPP P H+ Sbjct: 157 PPPPPPPPPPPPPPPPPPPPPPPPPHH 183 [135][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 PPPP PP PPPPPPPPPPPP PK S K+ Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPKKTSDTKKKI 76 [136][TOP] >UniRef100_C6HGV1 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus H143 RepID=C6HGV1_AJECH Length = 1711 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPG--GPPPPPPPPPPP 97 P G P P PPPP PPG GPPPPPPPPPPP Sbjct: 970 PGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPP 1002 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGG----PPPPPPPPPPPP 100 + +P P PPPP PP G PPPPPPPPPPPP Sbjct: 954 DAVPPGPPPPPPPPPPPGVGAPPPPPPPPPPPPP 987 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPP--GGPPPPPPPP----PPPPLAP 109 P GI P PPPP PP GGPPPPPPPP PPPP P Sbjct: 985 PPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPP 1025 [137][TOP] >UniRef100_C0NZQ8 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NZQ8_AJECG Length = 1741 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPG--GPPPPPPPPPPP 97 P G P P PPPP PPG GPPPPPPPPPPP Sbjct: 1000 PGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPP 1032 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGG----PPPPPPPPPPPP 100 + +P P PPPP PP G PPPPPPPPPPPP Sbjct: 984 DAVPPGPPPPPPPPPPPGVGAPPPPPPPPPPPPP 1017 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPP--GGPPPPPPPP----PPPPLAP 109 P GI P PPPP PP GGPPPPPPPP PPPP P Sbjct: 1015 PPPGISGPPPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPP 1055 [138][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 G P+ P PPPP PP PPPPPPPPPPPP Sbjct: 142 GEPAPPPPPPPPPPPPPPPPPPPPPPPPP 170 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ PPPP PP PPPPPPPPPPPP P Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPP 170 [139][TOP] >UniRef100_A5DK28 Putative uncharacterized protein n=1 Tax=Pichia guilliermondii RepID=A5DK28_PICGU Length = 1711 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/48 (52%), Positives = 26/48 (54%), Gaps = 12/48 (25%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRP------------PGGPPPPPPPPPPPPLAP 109 N G+P AP PPPP P GGPPPPPPPPPPPP P Sbjct: 1058 NGTKGLPPAPPPPPPPPPLPPSLGGTVPKAAGGPPPPPPPPPPPPPPP 1105 [140][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P P PPPP PP PPPPPPPPPPPP P + ++ + Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNI 67 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [141][TOP] >UniRef100_Q54PI9 Formin-I n=1 Tax=Dictyostelium discoideum RepID=FORI_DICDI Length = 935 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLN 130 + PS+PPPP P G PPPPPPPPPPPP P LN Sbjct: 453 TTPSVPPPP-PVGAPPPPPPPPPPPPPPPPSTLKLN 487 [142][TOP] >UniRef100_UPI0000F2D6A8 PREDICTED: similar to KIAA1727 protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2D6A8 Length = 1144 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P NG P +PPPP PGGPP PPPPPPPPP P Sbjct: 48 PDNG---CPPVPPPPPLPGGPPAPPPPPPPPPGLP 79 [143][TOP] >UniRef100_UPI0000E7FF28 PREDICTED: similar to zinc-finger homeodomain protein 4 isoform 2 n=1 Tax=Gallus gallus RepID=UPI0000E7FF28 Length = 3618 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = +2 Query: 2 NPANGIPSAPSIP---PPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 154 +PA + SAPS P PP PP PPPPPPPPPPPP P +SL + E+ ++ Sbjct: 3135 SPALSLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPP-PPPSSSLSGQQTEQQSK 3187 [144][TOP] >UniRef100_UPI00005A6092 PREDICTED: similar to multidomain presynaptic cytomatrix protein Piccolo n=1 Tax=Canis lupus familiaris RepID=UPI00005A6092 Length = 5080 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 ++ + ++ PPPP PP PPPPPPPPPPPPL P Sbjct: 2337 SSSVDASAQPPPPPPPPPPPPPPPPPPPPPPLPP 2370 [145][TOP] >UniRef100_UPI0001B7A6BD enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6BD Length = 804 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S P+ PPPP PP PPPPPPPPPPPPL P Sbjct: 440 SGPAAPPPPPPP--PPPPPPPPPPPPLPP 466 [146][TOP] >UniRef100_UPI0001B7A6BC enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6BC Length = 808 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S P+ PPPP PP PPPPPPPPPPPPL P Sbjct: 444 SGPAAPPPPPPP--PPPPPPPPPPPPLPP 470 [147][TOP] >UniRef100_UPI0001B7A6A7 enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6A7 Length = 823 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S P+ PPPP PP PPPPPPPPPPPPL P Sbjct: 459 SGPAAPPPPPPP--PPPPPPPPPPPPLPP 485 [148][TOP] >UniRef100_UPI00016E5327 UPI00016E5327 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E5327 Length = 325 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/29 (75%), Positives = 23/29 (79%), Gaps = 2/29 (6%) Frame = +2 Query: 23 SAPSIPPPPRPPGG--PPPPPPPPPPPPL 103 +AP PPPP PP G PPPPPPPPPPPPL Sbjct: 169 AAPGAPPPPPPPSGSLPPPPPPPPPPPPL 197 [149][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P+ PP P PP PPPPPPPPPPPP AP Sbjct: 1947 PPTPAPPPTPPPPPPPPPPPPPPPPPPSAP 1976 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = +2 Query: 2 NPANGIPSAPSIP---PPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 154 +PA + SAPS P PP PP PPPPPPPPPPPP P +SL + E+ ++ Sbjct: 3049 SPALSLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPP-PPPSSSLSGQQTEQQSK 3101 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS+P PPPP PP PPPPPPPPPP P P Sbjct: 1926 PSSPETPPPPPPP--PPPPPPPPPPTPAPP 1953 [150][TOP] >UniRef100_UPI0000ECD10B Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10B Length = 3578 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = +2 Query: 2 NPANGIPSAPSIP---PPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 154 +PA + SAPS P PP PP PPPPPPPPPPPP P +SL + E+ ++ Sbjct: 3095 SPALSLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPP-PPPSSSLSGQQTEQQSK 3147 [151][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPE 364 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 + P PPPP PP PPPPPPPPPPPP P Sbjct: 318 VEQPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 21/33 (63%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 NG PPPP PP PPPPPPPPPPPP P Sbjct: 312 NGFTPDVEQPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PPPP PP PPPPPPPPPPPP P Sbjct: 316 PDVEQPPPPPPPPPPPPPPPPPPPPPPPPP 345 [152][TOP] >UniRef100_A5V8M1 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V8M1_SPHWW Length = 373 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPP 97 G P+AP PPPP PP PPPPPPPPPPP Sbjct: 231 GSPAAPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 53.9 bits (128), Expect = 5e-06 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +2 Query: 26 APSIPPPPRPPGGPPPPPPPPPPPP 100 +P+ PPPP PP PPPPPPPPPPPP Sbjct: 232 SPAAPPPPPPPPPPPPPPPPPPPPP 256 [153][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P P PS PPPP PP P PPPPPPPPPP +P Sbjct: 216 SPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPPPPPPPP P P Sbjct: 225 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPP PPPP PPL P Sbjct: 237 PSPPPPPPPPPPPSPPPPPSPPPPSPPLPP 266 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P+ P +P PPPP PP PPPPPPPPPPP P Sbjct: 219 PSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P P PPPP PP PPPPPPP PPPP +P Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSP 257 [154][TOP] >UniRef100_C5YU09 Putative uncharacterized protein Sb08g008380 n=1 Tax=Sorghum bicolor RepID=C5YU09_SORBI Length = 149 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL+P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPLSP 33 [155][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKH 115 P P AP PPPP PP PPPPP PPP PP P H Sbjct: 2130 PPPSPPPAPLPPPPPSPPPSPPPPPSPPPSPPAPPPH 2166 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P APS PPP PP PPPP PPPPPPP P Sbjct: 2071 PPAPSPSPPPPPPPWPPPPSPPPPPPPAPP 2100 [156][TOP] >UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLU7_RICCO Length = 1550 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 6/37 (16%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGG------PPPPPPPPPPPPLAP 109 IP+AP PPPP P GG PPPPPPPPPPPP P Sbjct: 820 IPTAPPPPPPPPPMGGTMLPPRPPPPPPPPPPPPSYP 856 [157][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPPPVP 117 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 I + P PPPP PP PPPPPPPPPPPP P Sbjct: 69 ILTPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 [158][TOP] >UniRef100_A2XDP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XDP2_ORYSI Length = 820 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGP-----PPPPPPPPPPPLAPKHNSL 124 P+N P P PPPP PP P P PPPPPPPPP P +N+L Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNL 389 [159][TOP] >UniRef100_A7XYI3 JXC1 n=1 Tax=Monodelphis domestica RepID=A7XYI3_MONDO Length = 918 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEED 148 +P P +PP P PP PPPPPPPPPPPP P S S+ E+ Sbjct: 764 VPPPPLLPPLPLPPPPPPPPPPPPPPPPPPPAPASQKKSQQPEE 807 [160][TOP] >UniRef100_Q4CLZ3 Putative uncharacterized protein (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CLZ3_TRYCR Length = 624 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 3/45 (6%) Frame = +2 Query: 32 SIPPPPRPPGGPPPPPPPPPPPPLAPKHN---SLLNSKLEEDTQF 157 +IPPPP PP PPPPPPPPPPPP P + SL+ S ++ Q+ Sbjct: 333 TIPPPPPPPPSPPPPPPPPPPPPPPPPSSFAASLVASLQQQKQQY 377 [161][TOP] >UniRef100_C0MP97 Formin-homology protein SmDia n=1 Tax=Schistosoma mansoni RepID=C0MP97_SCHMA Length = 1067 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 ++ IP P IPPPP G PPPPPPPPPPPP Sbjct: 487 SSSIPPPPGIPPPPPMEGVPPPPPPPPPPPP 517 [162][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPPP PP PPPPPPPPPPPP P+ Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 83 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 [163][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 P P PPPP PP PPPPPPPPPPPP P S Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 [164][TOP] >UniRef100_A2DC30 Formin Homology 2 Domain containing protein n=1 Tax=Trichomonas vaginalis G3 RepID=A2DC30_TRIVA Length = 1128 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P + AP + PPP P G PPPPPPPPPPPP Sbjct: 585 PPTDLAGAPPVAPPPPPVGAPPPPPPPPPPPP 616 [165][TOP] >UniRef100_B8PFG8 Predicted protein n=1 Tax=Postia placenta Mad-698-R RepID=B8PFG8_POSPM Length = 476 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPP 100 P PPPP P GGPPPPPPPPPPPP Sbjct: 330 PPPPPPPAPSGGPPPPPPPPPPPP 353 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 +G P P PPPP P GG PPPPPPPPPPP Sbjct: 339 SGGPPPPPPPPPPPPAGGAPPPPPPPPPPP 368 [166][TOP] >UniRef100_B2WMY2 Putative uncharacterized protein n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2WMY2_PYRTR Length = 418 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/50 (50%), Positives = 28/50 (56%), Gaps = 12/50 (24%) Frame = +2 Query: 20 PSAPSIPPPPRPPGG------------PPPPPPPPPPPPLAPKHNSLLNS 133 P P PPPP PPGG PPPPPPPPPPPP AP + L++ Sbjct: 122 PPPPPPPPPPPPPGGIPTWVAAYGAIPPPPPPPPPPPPPQAPAQINALST 171 [167][TOP] >UniRef100_B0DQ50 Hypothetical proline-rich protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0DQ50_LACBS Length = 378 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 17 IPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 +P S PPPP PP PPPPPPP PPPPL P +S Sbjct: 329 LPPLDSPPPPPPPPLSPPPPPPPHPPPPLPPSFSS 363 [168][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 G P P PPPP PP PPPPPPPPPPPP Sbjct: 269 GPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 + P PPPP PP PPPPPPPPPPPP P Sbjct: 266 TGPGPPPPPPPPPPPPPPPPPPPPPPPPP 294 [169][TOP] >UniRef100_O73590 Zinc finger homeobox protein 4 n=1 Tax=Gallus gallus RepID=ZFHX4_CHICK Length = 3573 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = +2 Query: 2 NPANGIPSAPSIP---PPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 154 +PA + SAPS P PP PP PPPPPPPPPPPP P +SL + E+ ++ Sbjct: 3090 SPALSLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPP-PPPSSSLSGQQTEQQSK 3142 [170][TOP] >UniRef100_Q92H62 Arp2/3 complex-activating protein rickA n=1 Tax=Rickettsia conorii RepID=RICKA_RICCN Length = 517 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/70 (41%), Positives = 32/70 (45%), Gaps = 21/70 (30%) Frame = +2 Query: 5 PANGIPSAPSIPPP------------PRPP---------GGPPPPPPPPPPPPLAPKHNS 121 P N IPS P PPP P PP PPPPPPPPPPPP+AP Sbjct: 324 PENNIPSPPPPPPPSPLPENNIPSSPPPPPPPPLPENNIPSPPPPPPPPPPPPMAPAQAE 383 Query: 122 LLNSKLEEDT 151 L+ +E T Sbjct: 384 TLSKPIESTT 393 [171][TOP] >UniRef100_Q10Q99 Formin-like protein 8 n=1 Tax=Oryza sativa Japonica Group RepID=FH8_ORYSJ Length = 892 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGP-----PPPPPPPPPPPLAPKHNSL 124 P+N P P PPPP PP P P PPPPPPPPP P +N+L Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNL 389 [172][TOP] >UniRef100_UPI0000F2B170 PREDICTED: similar to hCG2004723, n=1 Tax=Monodelphis domestica RepID=UPI0000F2B170 Length = 803 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/51 (49%), Positives = 31/51 (60%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQ 154 +P + PS PP PP PPPPPPPPPPPPL P +S L + ++D Q Sbjct: 630 DPPHPEPSKELNLPPAPPPPPPPPPPPPPPPPPLPPHLSSHLRTPEKDDDQ 680 [173][TOP] >UniRef100_UPI0000E254CE PREDICTED: piccolo isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E254CE Length = 4865 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P PPPP PP PPPPPPPP PPP +PK L KL Sbjct: 2345 PPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2381 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2344 PPPPPPPPPPPPPPPPPPPPPLPP 2367 [174][TOP] >UniRef100_UPI0000E254CD PREDICTED: piccolo isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E254CD Length = 4019 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P PPPP PP PPPPPPPP PPP +PK L KL Sbjct: 1283 PPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 1319 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 1282 PPPPPPPPPPPPPPPPPPPPPLPP 1305 [175][TOP] >UniRef100_UPI0000E254CC PREDICTED: piccolo isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E254CC Length = 5234 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P PPPP PP PPPPPPPP PPP +PK L KL Sbjct: 2345 PPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2381 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2344 PPPPPPPPPPPPPPPPPPPPPLPP 2367 [176][TOP] >UniRef100_UPI00005E7A0E PREDICTED: similar to HOXD8 n=1 Tax=Monodelphis domestica RepID=UPI00005E7A0E Length = 307 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/33 (63%), Positives = 24/33 (72%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 +PA G P++ P PP PP PPPPPPPPPPPP Sbjct: 107 HPAGGSPASAYQPAPPPPPHPPPPPPPPPPPPP 139 [177][TOP] >UniRef100_UPI00005A3937 PREDICTED: similar to formin-like 2 isoform B n=1 Tax=Canis lupus familiaris RepID=UPI00005A3937 Length = 1119 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPL 103 P +PPPP PP PPPPPPPPPPPPL Sbjct: 576 PPMPPPPPPPPPPPPPPPPPPPPPL 600 [178][TOP] >UniRef100_UPI0001573469 piccolo isoform 1 n=1 Tax=Homo sapiens RepID=UPI0001573469 Length = 5142 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P PPPP PP PPPPPPPP PPP +PK L KL Sbjct: 2407 PPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2443 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2406 PPPPPPPPPPPPPPPPPPPPPLPP 2429 [179][TOP] >UniRef100_UPI000156FA8C piccolo isoform 2 n=1 Tax=Homo sapiens RepID=UPI000156FA8C Length = 4935 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P PPPP PP PPPPPPPP PPP +PK L KL Sbjct: 2407 PPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2443 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2406 PPPPPPPPPPPPPPPPPPPPPLPP 2429 [180][TOP] >UniRef100_UPI00016E532B UPI00016E532B related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E532B Length = 310 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 23 SAPSIPPPPRPPGG--PPPPPPPPPPPPLAP 109 +AP PPPP PP G PPPPPPPPPPPP P Sbjct: 152 AAPGAPPPPPPPSGSLPPPPPPPPPPPPPPP 182 [181][TOP] >UniRef100_UPI00016E5329 UPI00016E5329 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E5329 Length = 312 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 23 SAPSIPPPPRPPGG--PPPPPPPPPPPPLAP 109 +AP PPPP PP G PPPPPPPPPPPP P Sbjct: 148 AAPGAPPPPPPPSGSLPPPPPPPPPPPPPPP 178 [182][TOP] >UniRef100_UPI00016E5326 UPI00016E5326 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E5326 Length = 338 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +2 Query: 23 SAPSIPPPPRPPGG--PPPPPPPPPPPPLAP 109 +AP PPPP PP G PPPPPPPPPPPP P Sbjct: 170 AAPGAPPPPPPPSGSLPPPPPPPPPPPPPPP 200 [183][TOP] >UniRef100_UPI000184A345 DMRT-like family B with proline-rich C-terminal, 1 n=1 Tax=Canis lupus familiaris RepID=UPI000184A345 Length = 346 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 PS +PPPP PP PPPPPPPPPPPP P+ Sbjct: 256 PSYYPLPPPPPPPPPPPPPPPPPPPPPPQPQ 286 [184][TOP] >UniRef100_Q6NRE3 MGC83886 protein n=1 Tax=Xenopus laevis RepID=Q6NRE3_XENLA Length = 512 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 8/43 (18%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPP--------GGPPPPPPPPPPPPLAP 109 P I SAPS PPPP PP PPPPPPPPPPPP P Sbjct: 350 PPGHISSAPSSPPPPPPPPPSSGFGAAAPPPPPPPPPPPPGPP 392 [185][TOP] >UniRef100_Q1G7H2 Dishevelled-associated activator of morphogenesis 1 (Fragment) n=1 Tax=Gallus gallus RepID=Q1G7H2_CHICK Length = 359 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +PA G P PPPP PPGG PPPPPPPPPPP P Sbjct: 187 SPAPGSLLPP--PPPPPPPGGCPPPPPPPPPPPGGP 220 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPP-----PPPLAPKHNSLLNSKLEEDT 151 P G P P PPPP PPGGPPPPP PPP PPP AP +L + + T Sbjct: 202 PPGGCPPPP--PPPPPPPGGPPPPPGPPPLDGVMPPPGAPLGFALKKKSIPQPT 253 [186][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/37 (64%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +2 Query: 2 NPANGIPSA-PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +P PSA PS PPP PP PPPPPPPPPPPP +P Sbjct: 194 SPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSP 230 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHN 118 P + PS P PP P PP PPPPPPPPPPPP P N Sbjct: 199 PPSASPSPP--PPSPPPPSPPPPPPPPPPPPPSPPSPN 234 [187][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 +AP PPPP PP PPPPPPPPPPPP P Sbjct: 214 AAPPPPPPPPPPPPPPPPPPPPPPPPPPP 242 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLA 106 P P PPPP PP PPPPPPPPPPPP A Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPPPA 246 [188][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 S P PPPP PP PPPPPPPPPPPP P Sbjct: 305 SPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLA 106 P P PPPP PP PPPPPPPPPPPP A Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPA 337 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 ++P PPPP PP PPPPPPPPPPPP P Sbjct: 304 ASPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 [189][TOP] >UniRef100_B6INW7 R body protein, putative n=1 Tax=Rhodospirillum centenum SW RepID=B6INW7_RHOCS Length = 157 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P AP PPPP PP PP PPPPPPPPP P Sbjct: 124 PPAPPPPPPPAPPPAPPAPPPPPPPPPPPP 153 [190][TOP] >UniRef100_B1KJL7 Putative lipoprotein n=1 Tax=Shewanella woodyi ATCC 51908 RepID=B1KJL7_SHEWM Length = 508 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P + AP PPPP PP PPPPPPPPPPPP Sbjct: 30 PEEKVEIAPPPPPPPPPPPPPPPPPPPPPPPP 61 [191][TOP] >UniRef100_A5V4K4 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V4K4_SPHWW Length = 373 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 14 GIPSAPSIPPPPRPPGGPPPPPPPPPPP 97 G P+AP PPPP PP PPPPPPPPPPP Sbjct: 230 GEPAAPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPP 100 P+ PPPP PP PPPPPPPPPPPP Sbjct: 232 PAAPPPPPPPPPPPPPPPPPPPPP 255 [192][TOP] >UniRef100_B9GKU7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GKU7_POPTR Length = 107 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -2 Query: 99 GGGGGGGGGGGGPPGGRGGGGIDGADGIPFAG 4 GGGGGGGGGGGG GG GGG I+GAD PF+G Sbjct: 69 GGGGGGGGGGGGGGGGGGGGDINGADERPFSG 100 [193][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P + P +P+ P PP PP PPPPPPPPPPPP P Sbjct: 407 PPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFP 441 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPP----PPPPLAP 109 P + P AP PPPP PP PPPPPPPP PPPP P Sbjct: 412 PPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPP 450 [194][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/37 (59%), Positives = 24/37 (64%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 +G+ S PPPP PP PPPPPPPPPPPP P S Sbjct: 93 DGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPPPPPGS 129 [195][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 [196][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [197][TOP] >UniRef100_B6AF23 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AF23_9CRYT Length = 876 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPKHNS 121 PS P PPP PP PPPPPPPPPPPP P +S Sbjct: 180 PSPPLYPPPLHPPPPPPPPPPPPPPPPPPPPPSS 213 [198][TOP] >UniRef100_B4NYZ4 GE18300 n=1 Tax=Drosophila yakuba RepID=B4NYZ4_DROYA Length = 688 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P AP PPP PP P PPPPPPPPPP APK Sbjct: 219 PPAPKPKPPPPPPPKPKPPPPPPPPPPPAPK 249 [199][TOP] >UniRef100_A6NG74 Putative uncharacterized protein PCLO n=2 Tax=Homo sapiens RepID=A6NG74_HUMAN Length = 5073 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P PPPP PP PPPPPPPP PPP +PK L KL Sbjct: 2338 PPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPP 2360 [200][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P+ PPPP PP PPPPPPPPPPPP Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPP P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPP 67 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPP PP PPPPPPPPPPPP P+ Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPE 76 [201][TOP] >UniRef100_Q5KAA5 Cytokinesis protein sepa (Fh1/2 protein), putative n=1 Tax=Filobasidiella neoformans RepID=Q5KAA5_CRYNE Length = 1776 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%), Gaps = 6/39 (15%) Frame = +2 Query: 20 PSAPSIPPPPRPPGG------PPPPPPPPPPPPLAPKHN 118 P P PPPP PPG PPPPPPPPPPPPL H+ Sbjct: 1095 PPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPPLTTLHH 1133 [202][TOP] >UniRef100_C5JYR8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JYR8_AJEDS Length = 1704 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P G+ + P PPPP GGPPPPPPPPPPPP Sbjct: 937 PPPGVGAPPPPPPPPPGIGGPPPPPPPPPPPP 968 [203][TOP] >UniRef100_C5GLX8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GLX8_AJEDR Length = 1750 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P G+ + P PPPP GGPPPPPPPPPPPP Sbjct: 1009 PPPGVGAPPPPPPPPPGIGGPPPPPPPPPPPP 1040 [204][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P+ PPPP PP PPPPPPPPPPPP Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPP P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPP 67 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 P P PPP PP PPPPPPPPPPPP P+ Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPE 76 [205][TOP] >UniRef100_A5DRR5 Putative uncharacterized protein n=1 Tax=Lodderomyces elongisporus RepID=A5DRR5_LODEL Length = 996 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/54 (46%), Positives = 26/54 (48%), Gaps = 8/54 (14%) Frame = +2 Query: 20 PSAPSIPPPPRPP--------GGPPPPPPPPPPPPLAPKHNSLLNSKLEEDTQF 157 P PS PPPP PP PPPPPPPPPPPP P H+ S F Sbjct: 938 PQPPSPPPPPPPPPPSLIPFGASPPPPPPPPPPPPPPPPHSPSSPSSTSSSATF 991 [206][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%), Gaps = 4/35 (11%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGP----PPPPPPPPPPP 100 A G+P P PPPP PPGG PPPPPPPPPPP Sbjct: 1042 AIGVPPPPPPPPPPPPPGGKGMGVPPPPPPPPPPP 1076 [207][TOP] >UniRef100_Q8BHE0 Proline-rich protein 11 n=1 Tax=Mus musculus RepID=PRR11_MOUSE Length = 368 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PAN PS P +PPPP PPPPP PPPPPPLAP Sbjct: 180 PANHPPSPPPLPPPP-----PPPPPLPPPPPPLAP 209 [208][TOP] >UniRef100_Q9Y6V0-2 Isoform 2 of Protein piccolo n=1 Tax=Homo sapiens RepID=Q9Y6V0-2 Length = 4866 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P PPPP PP PPPPPPPP PPP +PK L KL Sbjct: 2338 PPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPP 2360 [209][TOP] >UniRef100_Q9Y6V0 Protein piccolo n=1 Tax=Homo sapiens RepID=PCLO_HUMAN Length = 5183 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 24/37 (64%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAPKHNSLLNSKL 139 P PPPP PP PPPPPPPP PPP +PK L KL Sbjct: 2338 PPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKL 2374 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2337 PPPPPPPPPPPPPPPPPPPPPLPP 2360 [210][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 26 APSIPPPPRPPGGPPPPPPPPPPPPLAP 109 AP PPPP PP PPPPPPPPPPPP P Sbjct: 137 APPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPL 103 P P PPPP PP PPPPPPPPPPPP+ Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPPPPV 166 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P PPPP PP PPPPPPPPPPPP Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PPPP PP PPPPPPPPPPPP P Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPPPP 165 [211][TOP] >UniRef100_UPI000180CA59 PREDICTED: similar to formin, inverted n=1 Tax=Ciona intestinalis RepID=UPI000180CA59 Length = 1334 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/51 (50%), Positives = 29/51 (56%), Gaps = 10/51 (19%) Frame = +2 Query: 5 PANGIPSAP-----SIPPPPRPPGGPPPPPP-----PPPPPPLAPKHNSLL 127 P GIP P IPPPP PPGG PPPPP PPPPP L P + ++ Sbjct: 428 PPGGIPPPPPPPSGGIPPPPPPPGGIPPPPPPPGGVPPPPPGLPPVYGGIV 478 [212][TOP] >UniRef100_UPI0001796B35 PREDICTED: formin-like 1 n=1 Tax=Equus caballus RepID=UPI0001796B35 Length = 1136 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 PA +P +P PPPP PG PPPPPPPPPPP Sbjct: 604 PAPPLPGSPEPPPPPPLPGDLPPPPPPPPPPP 635 [213][TOP] >UniRef100_UPI000179366E PREDICTED: similar to CG32138 CG32138-PB n=1 Tax=Acyrthosiphon pisum RepID=UPI000179366E Length = 1072 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/44 (52%), Positives = 28/44 (63%), Gaps = 9/44 (20%) Frame = +2 Query: 8 ANGIPSAPSIPPPPRPPGGPPP---------PPPPPPPPPLAPK 112 +N I ++P PPPP PP PPP PPPPPPPPP++PK Sbjct: 513 SNSISASPPPPPPPPPPPPPPPSTTASSIAMPPPPPPPPPISPK 556 [214][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2336 PPPPPPPPPPPPPPPPPPPPPLPP 2359 [215][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2336 PPPPPPPPPPPPPPPPPPPPPLPP 2359 [216][TOP] >UniRef100_UPI0001553827 PREDICTED: additional sex combs like 3 n=1 Tax=Mus musculus RepID=UPI0001553827 Length = 1791 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/38 (60%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPP---PPPPPPPPPLAP 109 P+ + AP PPPP PP PPP PPPPPPPPPL P Sbjct: 1547 PSKAVVHAPLPPPPPPPPPPPPPLALPPPPPPPPPLPP 1584 [217][TOP] >UniRef100_UPI0000F2E472 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2E472 Length = 551 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 6/37 (16%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPP------PPPPPPPPPLAPK 112 P+APS PPPP PP PPP PPPPPPPPPL K Sbjct: 420 PAAPSPPPPPPPPPPPPPHMSPLPPPPPPPPPPLPEK 456 [218][TOP] >UniRef100_UPI0000E23E7D PREDICTED: WAS protein homology region 2 domain containing 1 n=1 Tax=Pan troglodytes RepID=UPI0000E23E7D Length = 813 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 23 SAPSIPPPPRPPGGPPPPPPPPPPPPL 103 S P PPPP PP PPPPPPPPPPPPL Sbjct: 637 SLPPPPPPPPPPPPPPPPPPPPPPPPL 663 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +2 Query: 32 SIPPPPRPPGGPPPPPPPPPPPPLAP 109 S+PPPP PP PPPPPPPPPPPP P Sbjct: 637 SLPPPPPPPPPPPPPPPPPPPPPPPP 662 [219][TOP] >UniRef100_UPI0000E1F767 PREDICTED: formin-like 2 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F767 Length = 994 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +PPPP PP PPPPPPPPPPPP P Sbjct: 451 PPMPPPPPPPPPPPPPPPPPPPPPPLP 477 [220][TOP] >UniRef100_UPI0000E1F766 PREDICTED: formin-like 2 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E1F766 Length = 1026 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +PPPP PP PPPPPPPPPPPP P Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPLP 528 [221][TOP] >UniRef100_UPI0000E1F765 PREDICTED: formin-like 2 isoform 7 n=1 Tax=Pan troglodytes RepID=UPI0000E1F765 Length = 1045 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +PPPP PP PPPPPPPPPPPP P Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPLP 528 [222][TOP] >UniRef100_UPI0000E1F763 PREDICTED: formin-like 2 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F763 Length = 1037 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +PPPP PP PPPPPPPPPPPP P Sbjct: 502 PPMPPPPPPPPPPPPPPPPPPPPPPLP 528 [223][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 17 IPSA-PSIPPPPRPPGGPPPPPPPPPPPPLAP 109 IP A S+PPPP PP PPPPPPPPPPPP P Sbjct: 452 IPHAGASLPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P G P PPPP PP PPPPPPPPPPPP Sbjct: 453 PHAGASLPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +2 Query: 29 PSIPPPPRPPGGPPPPPPPPPPPPL 103 P PPPP PP PPPPPPPPPPPPL Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPL 486 [224][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 NG SAPS PPPP PP PPPPPPPPP P P Sbjct: 545 NGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEP 577 [225][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 NG SAPS PPPP PP PPPPPPPPP P P Sbjct: 557 NGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEP 589 [226][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 NG SAPS PPPP PP PPPPPPPPP P P Sbjct: 444 NGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEP 476 [227][TOP] >UniRef100_UPI00004D6F7D Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7D Length = 1054 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +2 Query: 11 NGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 NG SAPS PPPP PP PPPPPPPPP P P Sbjct: 526 NGPVSAPSPPPPPPPPPPPPPPPPPPPLPSAEP 558 [228][TOP] >UniRef100_UPI0001B7C13A Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C13A Length = 4226 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 1494 PPPPPPPPPPPPPPPPPPPPPLPP 1517 [229][TOP] >UniRef100_UPI0001B7C139 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C139 Length = 4330 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 1490 PPPPPPPPPPPPPPPPPPPPPLPP 1513 [230][TOP] >UniRef100_UPI0001B7C138 Protein piccolo (Aczonin) (Multidomain presynaptic cytomatrix protein). n=1 Tax=Rattus norvegicus RepID=UPI0001B7C138 Length = 4129 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 1490 PPPPPPPPPPPPPPPPPPPPPLPP 1513 [231][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2306 PPPPPPPPPPPPPPPPPPPPPLPP 2329 [232][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2336 PPPPPPPPPPPPPPPPPPPPPLPP 2359 [233][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 38 PPPPRPPGGPPPPPPPPPPPPLAP 109 PPPP PP PPPPPPPPPPPPL P Sbjct: 2306 PPPPPPPPPPPPPPPPPPPPPLPP 2329 [234][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 26 APSIPPPPRPPGGPPPPPPPPPPPPLAP 109 AP+ PPP PP PPPPPPPPPPPP AP Sbjct: 802 APAPTPPPPPPPPPPPPPPPPPPPPSAP 829 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAPK 112 PA P+ PPPP PP PPPPPPPPPPP P+ Sbjct: 796 PAPPQPAPAPTPPPPPPPPPPPPPPPPPPPPSAPPQ 831 [235][TOP] >UniRef100_UPI0000ECC7C5 enabled homolog n=1 Tax=Gallus gallus RepID=UPI0000ECC7C5 Length = 784 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP GPPPPPPPPP P AP Sbjct: 551 PPGPPPPPPPLPPSGPPPPPPPPPLPSQAP 580 [236][TOP] >UniRef100_UPI0000ECC7C4 enabled homolog n=1 Tax=Gallus gallus RepID=UPI0000ECC7C4 Length = 515 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP GPPPPPPPPP P AP Sbjct: 282 PPGPPPPPPPLPPSGPPPPPPPPPLPSQAP 311 [237][TOP] >UniRef100_UPI0000ECC7C3 enabled homolog n=1 Tax=Gallus gallus RepID=UPI0000ECC7C3 Length = 552 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP GPPPPPPPPP P AP Sbjct: 319 PPGPPPPPPPLPPSGPPPPPPPPPLPSQAP 348 [238][TOP] >UniRef100_UPI00003ACBF3 enabled homolog n=1 Tax=Gallus gallus RepID=UPI00003ACBF3 Length = 420 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP GPPPPPPPPP P AP Sbjct: 167 PPGPPPPPPPLPPSGPPPPPPPPPLPSQAP 196 [239][TOP] >UniRef100_Q9DEG2 AvenaII n=1 Tax=Gallus gallus RepID=Q9DEG2_CHICK Length = 513 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP GPPPPPPPPP P AP Sbjct: 280 PPGPPPPPPPLPPSGPPPPPPPPPLPSQAP 309 [240][TOP] >UniRef100_Q9DEG1 AvenaIII n=1 Tax=Gallus gallus RepID=Q9DEG1_CHICK Length = 420 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP GPPPPPPPPP P AP Sbjct: 167 PPGPPPPPPPLPPSGPPPPPPPPPLPSQAP 196 [241][TOP] >UniRef100_Q90YB5 AvEna neural variant n=1 Tax=Gallus gallus RepID=Q90YB5_CHICK Length = 784 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP GPPPPPPPPP P AP Sbjct: 551 PPGPPPPPPPLPPSGPPPPPPPPPLPSQAP 580 [242][TOP] >UniRef100_Q4RLQ7 Chromosome 10 SCAF15019, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RLQ7_TETNG Length = 579 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRP-PGGPPPPPPPPPPPPLAP 109 P G AP PPPP P PGG PPPPPPPPPPP P Sbjct: 381 PLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLP 416 [243][TOP] >UniRef100_O93263 Avena n=1 Tax=Gallus gallus RepID=O93263_CHICK Length = 550 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP GPPPPPPPPP P AP Sbjct: 317 PPGPPPPPPPLPPSGPPPPPPPPPLPSQAP 346 [244][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS P +PPPP PP PPP PPPP PPP +P Sbjct: 2126 PPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSP 2160 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPPP--PPPPLAP 109 +P PS P PPPP PP PPPP PPP PPPPL P Sbjct: 684 SPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPLPP 721 [245][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PPPP PP P PPPPPPPPPP +P Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPPPPPPPP P P Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PPPP PP P PPPPPPPPPP +P Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS P PPPP PP PPPPPPPPPP P P Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P PPPP PP PPPPPPPPPPP P Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P PPPP PP PPPPPPPPPPP P Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPP P P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPP 232 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPP---PPPPPLAP 109 PS P PPPP PP PPPPPPP PPPPP +P Sbjct: 239 PSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSP 271 [246][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P PPPP PP PPPPPPPPPPPP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPP 100 P P PPPP PP PPPPPPPPPPPP Sbjct: 252 PPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P PPPP PP PPPPPPPPPPPPL P Sbjct: 255 PPPPPPPPPPSPP--PPPPPPPPPPPPLLP 282 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 4/35 (11%) Frame = +2 Query: 8 ANGIPSAPSI----PPPPRPPGGPPPPPPPPPPPP 100 A+ PS+PS PPPP PP PPPPPPPPPPPP Sbjct: 228 ASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPP 262 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P P +PPPP PP PPPPPPPPP PP P Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPP 270 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P +P P PPPP PP PPP PPPPPPPP P Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 [247][TOP] >UniRef100_Q2R0D0 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2R0D0_ORYSJ Length = 957 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = +2 Query: 5 PANGIPSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 P PS PS PPPP P P PPPPPPPPPP P Sbjct: 493 PRPPAPSPPSPPPPPLAPSPPAPPPPPPPPPPCPP 527 [248][TOP] >UniRef100_C5XK05 Putative uncharacterized protein Sb03g034303 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XK05_SORBI Length = 115 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/40 (57%), Positives = 26/40 (65%), Gaps = 5/40 (12%) Frame = +2 Query: 11 NGIPSAPSIPPP--PRP---PGGPPPPPPPPPPPPLAPKH 115 + +P P +PPP PRP P PPPPPPPPPPPP P H Sbjct: 8 DSVPPPPPLPPPQPPRPSRHPAPPPPPPPPPPPPPPPPSH 47 [249][TOP] >UniRef100_C1EC93 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC93_9CHLO Length = 402 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +2 Query: 2 NPANGIPSAPSIPPPPRPPGGPPPPPPP-PPPPPLAPKH 115 +P + PS P+ PPPPRPP PP PPPP P PPP +P H Sbjct: 292 SPPSPPPSPPAPPPPPRPPPSPPNPPPPLPSPPPPSPPH 330 [250][TOP] >UniRef100_C1E017 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E017_9CHLO Length = 322 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = +2 Query: 20 PSAPSIPPPPRPPGGPPPPPPPPPPPPLAP 109 PS PS PPPP PP PP PPP P PPP+AP Sbjct: 181 PSPPSPPPPPSPPPSPPSPPPSPSPPPMAP 210