[UP]
[1][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P+ PPPPP++ PPPPPP++ PPPPPP PPPPP P S PPP Sbjct: 277 PVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPP 321 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPP---PPPPPVPGRSLDPPPM 149 P V PPPPP++ PPPPPP PPPPPPP PPPPP P PPP+ Sbjct: 286 PPVYSPPPPPPVYSPPPPPPS--PPPPPPPVYSPPPPPSPPPPSPPPPV 332 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPP-PPVPGRSLDPPP 152 PPPPP PPPPPP++ PPPPP PPPP PP P S PPP Sbjct: 300 PPPPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPP 339 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/52 (55%), Positives = 33/52 (63%), Gaps = 7/52 (13%) Frame = -3 Query: 286 PLVLERPPPPPLW*PP-----PPPPLW*PPPPPPP--PPPPPVPGRSLDPPP 152 P V PPPPP++ PP PPPP++ PPPPPPP PPPP P S PPP Sbjct: 253 PPVYSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPP 304 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 10/59 (16%) Frame = -3 Query: 286 PLVLERPP---PPPLW*PPPPPPLW*PPPPPP-------PPPPPPVPGRSLDPPPMMAS 140 P+ + PP PPP++ PPPPPP++ PPPPPP PPPPP P S PPP + S Sbjct: 241 PMPVPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPPPPPPVYS 299 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPP 152 PPPP PPPPPP++ PPPPPP PPPPPP P PPP Sbjct: 274 PPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSP-----PPP 310 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 8/49 (16%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPP--------PPPPPVPGRSLDPPPMMA 143 PPPP++ PPPPPP PP PPPP PPPPP P PPP+ + Sbjct: 328 PPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFS 376 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPP 152 P + PPPPP PPPPPPL+ PPPP P PPPP P S PPP Sbjct: 354 PPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPP 401 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/42 (59%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPP 152 PPPPP++ PPPPP P PPPP PPPPPP P PPP Sbjct: 309 PPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPP 350 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/49 (51%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPP----PPPPVPGRSLDPPP 152 P + PPP P++ PPPPP++ PPPPP PP PPPP P PPP Sbjct: 426 PYLSPPPPPHPVY-SPPPPPVYSPPPPPSPPPCIEPPPPPPCAEYSPPP 473 Score = 55.5 bits (132), Expect = 9e-06 Identities = 28/49 (57%), Positives = 30/49 (61%), Gaps = 10/49 (20%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW--*PPPP-----PPPP---PPPPVPGRSLDPPP 152 PPPPPL+ PPPP P + PPPP PPPP PPPP P S PPP Sbjct: 369 PPPPPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPP 417 [2][TOP] >UniRef100_Q4SUB2 Chromosome 3 SCAF13974, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SUB2_TETNG Length = 692 Score = 70.5 bits (171), Expect = 3e-10 Identities = 35/70 (50%), Positives = 39/70 (55%), Gaps = 4/70 (5%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPL----W*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARRE 119 P+ L PPPPP PPPPPPL PPPPPPPPPPPP+P PPP + + Sbjct: 109 PVFLPLPPPPP---PPPPPPLPSFTLSPPPPPPPPPPPPLPPSPRPPPPPYSYAIKHAGH 165 Query: 118 PGAESYLVSP 89 P A L SP Sbjct: 166 PAAAPPLSSP 175 [3][TOP] >UniRef100_UPI00016E10B6 UPI00016E10B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B6 Length = 1270 Score = 69.7 bits (169), Expect = 5e-10 Identities = 34/61 (55%), Positives = 37/61 (60%), Gaps = 3/61 (4%) Frame = -3 Query: 325 VSILVPNSCSLGDPLVLERPPPPPLW*PPPPPP---LW*PPPPPPPPPPPPVPGRSLDPP 155 + +L +S LG P PPPPP PPPPPP L PPPPPPPPPPPP P L PP Sbjct: 667 IDVLDMDSAGLGAPPAPPPPPPPP---PPPPPPPALLASPPPPPPPPPPPPPPPGVLGPP 723 Query: 154 P 152 P Sbjct: 724 P 724 [4][TOP] >UniRef100_UPI00016E10A1 UPI00016E10A1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10A1 Length = 1396 Score = 69.7 bits (169), Expect = 5e-10 Identities = 34/61 (55%), Positives = 37/61 (60%), Gaps = 3/61 (4%) Frame = -3 Query: 325 VSILVPNSCSLGDPLVLERPPPPPLW*PPPPPP---LW*PPPPPPPPPPPPVPGRSLDPP 155 + +L +S LG P PPPPP PPPPPP L PPPPPPPPPPPP P L PP Sbjct: 793 IDVLDMDSAGLGAPPAPPPPPPPP---PPPPPPPALLASPPPPPPPPPPPPPPPGVLGPP 849 Query: 154 P 152 P Sbjct: 850 P 850 [5][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 69.7 bits (169), Expect = 5e-10 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVL---ARREPGAES 104 PPPPP PPPPPP PPPPPPPPPPPP P PPP S +L A R P A S Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPANRAPPAPS 62 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/52 (51%), Positives = 29/52 (55%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPG 113 PPPPP PPPPPP PPPPPPPPPPPP + P P + PG Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPANRAPPAPSTSPG 66 [6][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 69.7 bits (169), Expect = 5e-10 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREP 116 PPPPP PPPPPP PPPPPPPPPPPP P PPP++ S + ++P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKP 62 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 [7][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 68.6 bits (166), Expect = 1e-09 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMM 146 PPPPP PPPPPP PPPPPPPPPPPP PG PPP + Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPAL 972 Score = 66.6 bits (161), Expect = 4e-09 Identities = 32/64 (50%), Positives = 34/64 (53%) Frame = -3 Query: 343 YCLSCHVSILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSL 164 YC+ P C +P PPPPP PPPPPP PPPPPPPPPPPP P Sbjct: 834 YCVGSDNYEPAPMVCE--EPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Query: 163 DPPP 152 PPP Sbjct: 892 PPPP 895 Score = 65.9 bits (159), Expect = 7e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P + PPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPP 969 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP--PPPPPPPVPGRSLDPPPMM 146 PPPPP PPPPPP PPPPP PPPPPP +P + PPP + Sbjct: 941 PPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPPPPPAL 983 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPP--PPVPGRSLDP--PP 152 PPPPP PPPPPP PPPPPPPPPP PP P +L P PP Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPPPPALPPGAPP 978 [8][TOP] >UniRef100_A0R4Q4 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis str. MC2 155 RepID=A0R4Q4_MYCS2 Length = 93 Score = 68.6 bits (166), Expect = 1e-09 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 4/35 (11%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPP----PPPPPVP 176 PPPPP W PPPPPP+W PPPPPPP PPPPP P Sbjct: 54 PPPPPFWRPPPPPPIWLPPPPPPPPFWGPPPPPRP 88 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 7/46 (15%) Frame = -3 Query: 268 PPPPPLW----*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPP 152 PPPPP W PPPPPP W PPPPPP PPPPPP P PPP Sbjct: 41 PPPPPFWGPPPPPPPPPPFWRPPPPPPIWLPPPPPPPPFWGPPPPP 86 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 4/41 (9%) Frame = -3 Query: 262 PPPLW*PPPPPPLW*PPPPPPPPP----PPPVPGRSLDPPP 152 PPP PPPPPP W PPPPPPPPP PPP P L PPP Sbjct: 37 PPP---PPPPPPFWGPPPPPPPPPPFWRPPPPPPIWLPPPP 74 [9][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 68.6 bits (166), Expect = 1e-09 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESY---L 98 PPPPP PPPPPP PPPPPPPPPPPP P PPP RR P + Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCEKCRRGPCCHHFCMPT 136 Query: 97 VSPVCSI 77 V P C + Sbjct: 137 VPPYCPV 143 [10][TOP] >UniRef100_A0CZ14 Chromosome undetermined scaffold_31, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CZ14_PARTE Length = 417 Score = 68.6 bits (166), Expect = 1e-09 Identities = 33/57 (57%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = -3 Query: 313 VPNSCSLGDPLVLERPPPPPLW*PPPPPPL---W*PPPPPPPPPPPPVPGRSLDPPP 152 +PNS S + PPPPP PPPPPPL PPPPPPPPPPPP+PG+ PPP Sbjct: 299 LPNSTSN-----VTAPPPPP---PPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPP 347 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 6/47 (12%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPL------W*PPPPPPPPPPPPVPGRSLDPPP 152 + PPPPP PPPPPPL PPPPPPPPPPP+P PPP Sbjct: 286 QSPPPPP---PPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPP 329 Score = 58.9 bits (141), Expect = 8e-07 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 11/50 (22%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL---W*PPPPPPPP--------PPPPVPGRSLDPPP 152 PPPPP PPPPPP+ PPPPPPPP PPPP+PG + PPP Sbjct: 327 PPPPP---PPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPP 373 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 12/51 (23%) Frame = -3 Query: 268 PPPPPL---W*PPPPPPL----W*PPPPPPP-----PPPPPVPGRSLDPPP 152 PPPPPL PPPPPPL PPPPPPP PPPPP PG + PP Sbjct: 347 PPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPP 397 [11][TOP] >UniRef100_UPI00016E10B5 UPI00016E10B5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B5 Length = 1246 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/57 (57%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = -3 Query: 313 VPNSCSLGDPLVLERPPPPPLW*PPPPPP---LW*PPPPPPPPPPPPVPGRSLDPPP 152 +P LG P PPPPP PPPPPP L PPPPPPPPPPPP P L PPP Sbjct: 647 LPPGAGLGAPPAPPPPPPPP---PPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPP 700 [12][TOP] >UniRef100_UPI00016E10B4 UPI00016E10B4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E10B4 Length = 1323 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/57 (57%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = -3 Query: 313 VPNSCSLGDPLVLERPPPPPLW*PPPPPP---LW*PPPPPPPPPPPPVPGRSLDPPP 152 +P LG P PPPPP PPPPPP L PPPPPPPPPPPP P L PPP Sbjct: 724 LPPGAGLGAPPAPPPPPPPP---PPPPPPPALLASPPPPPPPPPPPPPPPGVLGPPP 777 [13][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P R PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P R PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 109 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -3 Query: 280 VLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 ++ PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 22 IIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 51 PPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPP 89 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPP 72 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPP 110 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/48 (62%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Frame = -3 Query: 286 PLVLER---PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P+ ER PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PIAPERIIPPPPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPP 60 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/68 (47%), Positives = 35/68 (51%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPPPPPPPP P PPP A P E L P Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPEP 129 Query: 88 VCSISSLS 65 + ++ Sbjct: 130 CPQVEPIA 137 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPP 70 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPP 74 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/53 (52%), Positives = 32/53 (60%) Frame = -3 Query: 313 VPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 VP + + ++ PPPPP PPPPPP PPPPPPPPPPPP P PP Sbjct: 12 VPYTPIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPPPP P PPP Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPPPPPPPPPPP P PPP Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPP P P PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPP 76 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 50 PPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP P PPPPPPPPPP P PPP Sbjct: 49 PPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP P PPPP PPPPPPPPPPPP P PPP Sbjct: 58 PPPPPPPRPCPPPP---PPPPPPPPPPPPPPPPPPPPPP 93 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPP---PPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPP PPP P PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPP 80 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPPP P PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPP 83 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPPPPP P PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPP 84 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPP---PPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPPP P PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPP 85 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPP---PPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPP PPPPPPPPP P PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/54 (53%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPP--PPPVPGRSLDPP 155 P C P PPPPP PPPPPP PPPPPPPP PPP P R PP Sbjct: 64 PRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPARPCPPP 117 [14][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/60 (53%), Positives = 34/60 (56%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPPPPPPPP P PPP S + P Y+V P Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP--PPPPPPPGPSPITPSVRPEIPGYIVKP 554 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P PPP Sbjct: 486 PPPPPPPPPPPPPP---PPPPSPPPPPPPSPPPPPPPPP 521 [15][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP++ PPPPPP++ PPPPPPPPPPPP P S PP Sbjct: 455 PPPPPVYSPPPPPPVYSPPPPPPPPPPPP-PVXSPPPP 491 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/54 (55%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPP--PPPPPVPGRSLDPP 155 P S S P V PPPPP++ PPPPPP PPPPPPP PPPP+ S PP Sbjct: 450 PPSPSPPPPPVYSPPPPPPVYSPPPPPP---PPPPPPPVXSPPPPIIYESPPPP 500 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/54 (53%), Positives = 31/54 (57%), Gaps = 9/54 (16%) Frame = -3 Query: 286 PLVLERPPPP---PLW*PPPPPPLW*PPP------PPPPPPPPPVPGRSLDPPP 152 P VL PPPP P PPPPP++ PPP PPPPPPPPP P PPP Sbjct: 437 PPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPPPPPVXSPPP 490 [16][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/64 (54%), Positives = 37/64 (57%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRILTWQ 332 GGG G GGG GGGGGGGGY GGGGGGY GGGGG G + G R W+ Sbjct: 89 GGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGGGGGGDRPSGAR--GWE 146 Query: 333 DRQY 344 DR Y Sbjct: 147 DRSY 150 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G GGG GGGGGGGGY GGGGGGY GGGGG Sbjct: 88 GGGGGYGGGGGGGGYGGGGGGGGYGGGGGGG 118 [17][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/64 (53%), Positives = 36/64 (56%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPPPPPPPP P PPP S RR E V+P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDAVE---VAP 80 Query: 88 VCSI 77 S+ Sbjct: 81 RSSV 84 Score = 66.2 bits (160), Expect = 5e-09 Identities = 28/41 (68%), Positives = 28/41 (68%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 E PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 ETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 65.5 bits (158), Expect = 9e-09 Identities = 30/53 (56%), Positives = 32/53 (60%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGA 110 PPPPP PPPPPP PPPPPPPPPPPP P PPP + A+R A Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDA 75 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/48 (58%), Positives = 29/48 (60%) Frame = -3 Query: 295 LGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 L P+ R PPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 LDTPVASTRETPPP---PPPPPP---PPPPPPPPPPPPPPPPPPPPPP 47 [18][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P L PPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 66.6 bits (161), Expect = 4e-09 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP PPPPPPPPPPPP+P PPP+ Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPL 282 Score = 65.5 bits (158), Expect = 9e-09 Identities = 31/58 (53%), Positives = 35/58 (60%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 S +P + + P V PPPPP PPPPPP PPPPPPPPPPPP P PPP+ Sbjct: 216 STTLPTAVVVPPPQVQVVPPPPPPPPPPPPPPPP-PPPPPPPPPPPPPPPPPPPPPPL 272 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/76 (44%), Positives = 40/76 (52%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPPL PPPPPPPPP PP P P P ++TV +P Sbjct: 258 PPPPPPPPPPPPPPL--PPPPPPPPPLPPPPPSLPLPLPTTSATVAPPSTSQPTQLSTTP 315 Query: 88 VCSISSLSIPSTSKSI 41 S +S +T+ SI Sbjct: 316 TSSTTSTGTTTTNASI 331 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/74 (48%), Positives = 41/74 (55%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPPPPPPPP P PPP L P L P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLP--LPLP 294 Query: 88 VCSISSLSIPSTSK 47 S ++++ PSTS+ Sbjct: 295 TTS-ATVAPPSTSQ 307 [19][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 +E+PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 318 VEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/50 (60%), Positives = 32/50 (64%) Frame = -3 Query: 301 CSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 C+ P V + PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 311 CNGFTPDVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 66.2 bits (160), Expect = 5e-09 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 PPPPP PPPPPP PPPPPPPPPPPP P +PPP V PG+ S Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPVTT--APGSNS 381 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 62.4 bits (150), Expect = 7e-08 Identities = 30/60 (50%), Positives = 32/60 (53%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPPPP PPP P + P S R G E V+P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPEPPPQPDPPVTTAPGSNSVEGGRPHAGVEGGTVAP 398 [20][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPPL PPPPPP PPPPPPPPPPPP P PPP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P L PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 28 PPPLPPPPPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPP 69 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 62.8 bits (151), Expect = 6e-08 Identities = 29/52 (55%), Positives = 29/52 (55%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 P C P PPPPP PPPPPP PPPPPPPPPPPP P PP Sbjct: 18 PPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/46 (60%), Positives = 28/46 (60%) Frame = -3 Query: 289 DPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 DP PPPPP P PPPP PPPPPPPPPPPP P PPP Sbjct: 15 DPPPPHCPPPPPPPPPLPPPP---PPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSL 164 PPPPP PPPPPP PPPPPPPPPPPP P ++ Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 72 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 R PPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 13 RVDPPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 [21][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P L PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/49 (61%), Positives = 31/49 (63%) Frame = -3 Query: 295 LGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 L PL PPPPP PPPPPP PPPPPPPPPPPP P PPP+ Sbjct: 54 LPPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 102 Score = 66.2 bits (160), Expect = 5e-09 Identities = 28/49 (57%), Positives = 32/49 (65%) Frame = -3 Query: 298 SLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 + + +V+E PPP P PPPPPP PPPPPPPPPPPP P PPP Sbjct: 45 NFNEKMVIELPPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 65.9 bits (159), Expect = 7e-09 Identities = 34/74 (45%), Positives = 38/74 (51%), Gaps = 6/74 (8%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLAR------REPGAE 107 PPPPP PPPPPP PPPPPPPPPPPP P PPP + L EP + Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENLHLELILGGLVNEPQID 129 Query: 106 SYLVSPVCSISSLS 65 + C+I LS Sbjct: 130 PVIEEHECNIIRLS 143 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 [22][TOP] >UniRef100_B4QT65 GD21099 n=1 Tax=Drosophila simulans RepID=B4QT65_DROSI Length = 360 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/69 (47%), Positives = 36/69 (52%) Frame = -3 Query: 295 LGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREP 116 +G P PPPPP PPPPPP PPPPPPPPPPP VPG + PP L +P Sbjct: 133 VGKPKAKLPPPPPP---PPPPPP---PPPPPPPPPPPGVPGNPVSLPPQPVIVPLNPADP 186 Query: 115 GAESYLVSP 89 Y P Sbjct: 187 IQSFYFAYP 195 [23][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P L PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/44 (65%), Positives = 30/44 (68%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 L+ RPPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 22 LLPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P PPP+ Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 98 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDP 158 PPPPP PPPPPP PPPPPPPPPP P P R++ P Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNIIP 107 [24][TOP] >UniRef100_A0DJB7 Chromosome undetermined scaffold_53, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0DJB7_PARTE Length = 1117 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 31/44 (70%), Gaps = 5/44 (11%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL-----W*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPPL PPPPPPPPPPPP+PG+ PPP Sbjct: 542 PPPPP---PPPPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPPP 582 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/50 (58%), Positives = 31/50 (62%), Gaps = 11/50 (22%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL----W*PPPPPP-------PPPPPPVPGRSLDPPP 152 PPPPP PPPPPPL PPPPPP PPPPPP+PG+ PPP Sbjct: 562 PPPPP---PPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPP 608 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 12/51 (23%) Frame = -3 Query: 268 PPPPPL-----W*PPPPPPLW*PPPPPP-------PPPPPPVPGRSLDPPP 152 PPPPPL PPPPPP PPPPPP PPPPPP+PG+ PPP Sbjct: 548 PPPPPLPGQHKQTPPPPPP---PPPPPPLPGQKTGPPPPPPLPGQKAGPPP 595 Score = 55.8 bits (133), Expect = 7e-06 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 17/56 (30%) Frame = -3 Query: 268 PPPPPL----W*PPPPPPL-----W*PPPPP--------PPPPPPPVPGRSLDPPP 152 PPPPPL PPPPPPL PPPPP PPPPPPP+PG+ PP Sbjct: 568 PPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPLPGQKAGAPP 623 [25][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMM 146 RPPPPP+ PPPPPP PPPPPPP PPPP P PPP++ Sbjct: 240 RPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLL 281 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVP 176 P + PPPPP PPPPPP PPPPPPPPPPPP P Sbjct: 243 PPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 59.3 bits (142), Expect = 6e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPV 179 P+ PPPPP PPPPPP PPPPPPPPPPPP+ Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPL 280 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDP----PPM 149 PPPPP PPPPPP PPPPPPPPPPPP L P PPM Sbjct: 250 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPM 293 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = -3 Query: 268 PPPPPLW*PP---------PPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPPP+ PPPPPPPPPPPP P S PPP Sbjct: 223 PPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPP 270 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA 143 PPPPP PPPPPP PPPPPPPPPPP P PP A Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPA 289 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/53 (50%), Positives = 27/53 (50%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P S P PP P P PPPP PPPPPPPPPPPP P PPP Sbjct: 217 PPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 [26][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/48 (62%), Positives = 30/48 (62%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLAR 125 PPPPP PPPPPP PPPPPPPPPPPP P PPP VL R Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRFVLER 64 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [27][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/49 (61%), Positives = 31/49 (63%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARR 122 PPPPP PPPPPP PPPPPPPPPPPP P PPP T+ RR Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRR 49 [28][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/47 (61%), Positives = 30/47 (63%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLA 128 PPPPP PPPPPP PPPPPPPPPPPP P PPP T +A Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVA 52 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/56 (51%), Positives = 32/56 (57%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESY 101 PPPPP PPPPPP PPPPPPPPPPP P ++ PP A P E+Y Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPAPLRRDTASTGPSQETY 72 [29][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 66.6 bits (161), Expect = 4e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPP 327 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP PPP Sbjct: 288 PPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPPPPP 326 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPP P PPPPPP PPPPPPPPPPPP P PPP Sbjct: 254 PPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPP 292 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/53 (52%), Positives = 30/53 (56%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P++ P PPPPP PP PPP PPPPPPPPPPPP P PPP Sbjct: 233 PSAAPCHPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPP-----PPP 280 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P PPP Sbjct: 297 PPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCPPP 335 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/53 (52%), Positives = 28/53 (52%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P C P PPPPP PPP PP PPPPP PPPPPP P PPP Sbjct: 258 PPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPP 310 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/58 (51%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPP-----PPPVPGRSLDPPP 152 P C P PPPPP PPPPPP PPPPPPPPP PPP P PPP Sbjct: 291 PPPCPPPPPPPPPCPPPPP---PPPPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPP 345 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP P PPPP PPPPPPPPP PP P PPP Sbjct: 278 PPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPP 316 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 PPPPP P PPPP PPPP PPPPPP P + PPPM + V + E E+ Sbjct: 341 PPPPP---PCPPPPC--PPPPCPPPPPPCPPACPIPPPPMETTEVETQSETTTET 390 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/54 (53%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPP-PPPPPPVPGRSLDPPP 152 P C P PPPPP PPPPPP PP PPP PPPPPP P PPP Sbjct: 250 PPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPPPPCPPPPPPPPP 303 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPPP PPPPPPP P PPP Sbjct: 273 PPPPPPPPPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPP 311 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP----PPPPPPVPGRSLDPPP 152 PPP P PPPPPP PPPPPP PPPPPP P PPP Sbjct: 280 PPPCPPPCPPPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPP 322 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/45 (57%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP------PPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPP PP PPPPPP P PPP Sbjct: 312 PPPPPPCPPPPPPPPPCPPPCPPPCPPPCPPPPPPCPPPPCPPPP 356 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/46 (58%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPP--PPPPPVPGRSLDPPPMMAST 137 PPP P PPPPPP PP PPPP PPPPP P PPP M +T Sbjct: 333 PPPCPPPCPPPPPPCPPPPCPPPPCPPPPPPCPPACPIPPPPMETT 378 [30][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/60 (55%), Positives = 34/60 (56%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPPPPPPPP P L PPP P S+LV P Sbjct: 425 PPPPP---PPPPPP---PPPPPPPPPPPPPPPPLLPPPP----------PPSISSFLVPP 468 Score = 65.1 bits (157), Expect = 1e-08 Identities = 38/77 (49%), Positives = 45/77 (58%), Gaps = 3/77 (3%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARRE-PGAESY 101 L PPPPP PPPPPP PPPPPPPPPPPP P PPP ++S ++ + P S Sbjct: 424 LPPPPPPP---PPPPPP---PPPPPPPPPPPPPPLLPPPPPPSISSFLVPPQSCPIPCSP 477 Query: 100 LVSPVCSISSLS--IPS 56 +P CS + S IPS Sbjct: 478 QCAPSCSENCCSSLIPS 494 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRS 167 + PPPPP PPPPPP PPPPPPPPPPPP P ++ Sbjct: 144 QTPPPPP---PPPPPP---PPPPPPPPPPPPKPPKT 173 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/46 (60%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPP 155 PL PPPPP PPPPPP PPPPPP PPPPPP L PP Sbjct: 423 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPPPSISSFLVPP 468 [31][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 66.6 bits (161), Expect = 4e-09 Identities = 34/64 (53%), Positives = 37/64 (57%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRILTWQ 332 GGG G GGGGG GGGGGG + GGGGGGY GGGGG R SG+ W+ Sbjct: 131 GGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGGDRPSGA----------RGWE 180 Query: 333 DRQY 344 DR Y Sbjct: 181 DRSY 184 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +3 Query: 174 PGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 P GGGGGG GGGGG + GGGGGGY GGGGG Sbjct: 114 PRRGGGGGGYGGGGGGYGGGGGGGYGGGGGGG 145 [32][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 66.6 bits (161), Expect = 4e-09 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 ++L PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 68 VILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P PPP+ Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 116 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG 173 PPPPP PPPPPP PPPPPPPPPPPPVPG Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 [33][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 66.6 bits (161), Expect = 4e-09 Identities = 37/79 (46%), Positives = 44/79 (55%), Gaps = 2/79 (2%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLV 95 E PPPP PPPPPP PPPPPPPPPPPP P +L+PPP + + P S Sbjct: 143 EPAPPPP---PPPPPP---PPPPPPPPPPPPPPPTTLEPPPPPPT---SSEPPPPPSTSA 193 Query: 94 SPVCSI--SSLSIPSTSKS 44 +P S SS +PS + S Sbjct: 194 TPTSSAVPSSSVVPSEASS 212 Score = 62.8 bits (151), Expect = 6e-08 Identities = 38/82 (46%), Positives = 43/82 (52%), Gaps = 4/82 (4%) Frame = -3 Query: 298 SLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPP----PPPVPGRSLDPPPMMASTVL 131 + G+P PPPPP PPPPPP PPPPPPPPP PPP P S +PPP ST Sbjct: 140 NFGEPAPPPPPPPPPP--PPPPPP---PPPPPPPPPTTLEPPPPPPTSSEPPP-PPSTSA 193 Query: 130 ARREPGAESYLVSPVCSISSLS 65 S V P + S+LS Sbjct: 194 TPTSSAVPSSSVVPSEASSTLS 215 [34][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/52 (57%), Positives = 30/52 (57%) Frame = -3 Query: 307 NSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 N C P PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 352 NPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 65.9 bits (159), Expect = 7e-09 Identities = 29/43 (67%), Positives = 29/43 (67%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPPPP PPPPPP PPPPPPPPPPPP P PPP AS Sbjct: 374 PPPPPSPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPCPAS 413 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 373 PPPPPPSPPPPPPP---PPPPPPPPPPPPPPPPPPPPPP 408 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 372 PPPPPPPSPPPPPP---PPPPPPPPPPPPPPPPPPPPPP 407 Score = 62.4 bits (150), Expect = 7e-08 Identities = 29/53 (54%), Positives = 30/53 (56%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P S + P PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 348 PPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 400 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPPPP P PPP Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPPPPPPPPPPP P PPP Sbjct: 367 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPPPPPPP P PPP Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/56 (53%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -3 Query: 310 PNSCSLGDPLV---LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PN+C P PPPPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 341 PNACCPPPPSANPCQPCPPPPPPPPPPPPPP---PPPPPPPSPPPPPPPPPPPPPP 393 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDP 158 PPPPP PPPPPP PPPPPPPPPPPP S P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSP 416 [35][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 66.2 bits (160), Expect = 5e-09 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P + PPP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPPPP PPPPPP PPPPPPPP PPP P PPP ++S Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISS 1457 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP PPP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPP P P PPP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVL 131 PPPPP PPPPPP PPPPPPP PPP P PPP+ + T L Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGL 1461 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 PPPPP PPPPPP PP PPPPPPPPP P +A+T Sbjct: 1425 PPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGLFPTVATT 1468 [36][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 66.2 bits (160), Expect = 5e-09 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP+P PPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 65.9 bits (159), Expect = 7e-09 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P L PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 65.9 bits (159), Expect = 7e-09 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PL PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 65.9 bits (159), Expect = 7e-09 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPPPP PPPPPP PPPPPPPPPPPP P PPP+ S Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/71 (46%), Positives = 38/71 (53%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPPL PPPPP PPPPPPPPPPPP P PPP ++ P E Sbjct: 670 PPPPPLPPSPPPPPP--PPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPPSCE------ 721 Query: 88 VCSISSLSIPS 56 VC ++ L P+ Sbjct: 722 VCIVARLLPPA 732 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPL PPPPPP PPPPPPPPPPPP P PPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P L P P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPPL PPPPPPPPPPP P PPP Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 63.9 bits (154), Expect = 2e-08 Identities = 35/69 (50%), Positives = 37/69 (53%), Gaps = 6/69 (8%) Frame = -3 Query: 340 CLSCHVSILV-----PNSCSLGDPLVLERPPPPPLW*PP-PPPPLW*PPPPPPPPPPPPV 179 C C VS ++ P S PL PPP P PP PPPPL PPPPPPPPPPPP Sbjct: 196 CQCCPVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPP 255 Query: 178 PGRSLDPPP 152 P PPP Sbjct: 256 PPPPPPPPP 264 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP S PPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP P PPPPPPPPPP P PPP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP P PPPP PPPPPPPPPPPP P PPP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPPPPPPP P PPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPP PP P PPP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 59.3 bits (142), Expect = 6e-07 Identities = 30/59 (50%), Positives = 32/59 (54%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGA 110 PL PPPPP PPPPPP PPPPPP PPPP P PP ++AR P A Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPPSCEVCIVARLLPPA 732 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPP----PPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPP PPPP P PPP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP----PPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPPP P PPP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP----PPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPPPPP P PPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 [37][TOP] >UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLU7_RICCO Length = 1550 Score = 66.2 bits (160), Expect = 5e-09 Identities = 27/42 (64%), Positives = 29/42 (69%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPPP PPPPP PPPPPPPPPPPP P R+ PPP+ S Sbjct: 887 PPPPRAAPPPPPSRAAPPPPPPPPPPPPPPLRATPPPPLQGS 928 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/51 (52%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP------PPPPPPPVPGRSLDPPPMMASTV 134 PPPPP PPPPPPL PPPP PPPPPP + G PPP S++ Sbjct: 903 PPPPPPPPPPPPPPLRATPPPPLQGSPPPPPPPPQLRGAPPPPPPPHLSSI 953 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/49 (57%), Positives = 29/49 (59%), Gaps = 10/49 (20%) Frame = -3 Query: 268 PPPPPLW*--PPPPPPLW*PPPPPP--------PPPPPPVPGRSLDPPP 152 PPPPP PPPPPP + PPPPP PPPPPP PGR PPP Sbjct: 956 PPPPPFRGAPPPPPPPFYGAPPPPPPPPGRGAPPPPPPP-PGRGAPPPP 1003 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPP----PPPV--PGRSLDPPP 152 PPPP PPPPPP PPPPPPPP PPP+ PGR PPP Sbjct: 1016 PPPPGRGAPPPPPPPGRGPPPPPPPPGRGAPPPLPPPGRGAPPPP 1060 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/58 (51%), Positives = 33/58 (56%), Gaps = 5/58 (8%) Frame = -3 Query: 310 PNSCSLGDPLVLER-PPPPPLW*PPPPPPLW*PPPPPPPP----PPPPVPGRSLDPPP 152 P+S + G P PPPPP PPPPP PPPPPPPP PPPP+ G PPP Sbjct: 879 PSSSARGTPPPPRAAPPPPPSRAAPPPPPP--PPPPPPPPLRATPPPPLQGSPPPPPP 934 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 11/50 (22%) Frame = -3 Query: 268 PPPPPLW*PPPPPP----LW*PPPPPP-------PPPPPPVPGRSLDPPP 152 PPPPP + PPPPP PPPPPP PPPPPP PGR PPP Sbjct: 967 PPPPPFYGAPPPPPPPPGRGAPPPPPPPPGRGAPPPPPPP-PGRGAPPPP 1015 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 7/45 (15%) Frame = -3 Query: 268 PPPPPLW*PPPPPP---LW*PPPPPPP----PPPPPVPGRSLDPP 155 PPPP PPPPPP PPPPPPP PPPPP PGR PP Sbjct: 1004 PPPPGRGAPPPPPPPPGRGAPPPPPPPGRGPPPPPPPPGRGAPPP 1048 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/57 (50%), Positives = 29/57 (50%), Gaps = 18/57 (31%) Frame = -3 Query: 268 PPPPPLW*PPPPPP--------------LW*PPPPPPP----PPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPP PPPPP PGR PPP Sbjct: 1026 PPPPPGRGPPPPPPPPGRGAPPPLPPPGRGAPPPPPPPGGGGPPPPPPPGRGGPPPP 1082 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = -3 Query: 268 PPPPPLW*--PPPPPPLW*PPPPPP-------PPPPPPVPGRSLDPPP 152 PPPPP PPPPPP + PPPP PPPPPP PGR PPP Sbjct: 944 PPPPPHLSSIPPPPPPPFRGAPPPPPPPFYGAPPPPPPPPGRGAPPPP 991 [38][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/44 (65%), Positives = 29/44 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 PPPPP PPPPPP PPPPPPPPPPPP P PPP ST Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPST 531 Score = 65.5 bits (158), Expect = 9e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 L PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMM 146 PPPPP PPPPPP PPPPPPPPPPPP +S+ P ++ Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLI 541 [39][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/48 (62%), Positives = 30/48 (62%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLAR 125 PPPPP PPPPPP PPPPPPPPPPPP P PP S VL R Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSGVLCR 64 Score = 65.5 bits (158), Expect = 9e-09 Identities = 30/52 (57%), Positives = 31/52 (59%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPG 113 PPPPP PPPPPP PPPPPPPPPPPP P PPP + RR G Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSG 60 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [40][TOP] >UniRef100_B4JMZ8 GH24721 n=1 Tax=Drosophila grimshawi RepID=B4JMZ8_DROGR Length = 207 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG PG GGGG GGGGGGYH GGGGGGYH GGGGG Sbjct: 54 GGGGGGHPGGGGGGHPGGGGGGYH-GGGGGGYHGGGGGG 91 Score = 65.9 bits (159), Expect = 7e-09 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG PG GGGG GGGGGGYH GGGGGGYH GGGGG Sbjct: 62 GGGGGGHPGGGGGGYHGGGGGGYH-GGGGGGYHGGGGGG 99 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/56 (53%), Positives = 30/56 (53%), Gaps = 18/56 (32%) Frame = +3 Query: 153 GGGSRLLPGTGGGGG-----------------GGGGGGGYHNGG-GGGGYHNGGGG 266 GGG G GGGGG GGGGGGGYH GG GGGGYH GGGG Sbjct: 86 GGGGGGYHGGGGGGGYGRKPTIEVYVVKPVYQGGGGGGGYHGGGAGGGGYHGGGGG 141 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGG GGGGG H GGGGGG+ GGGGG Sbjct: 37 GGGGYGGGGGYGGGGGYGGGGGGHPGGGGGGHPGGGGGG 75 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/53 (52%), Positives = 29/53 (54%), Gaps = 14/53 (26%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGY--------------HNGGGGG 269 GGG G GGGG GGGGGGYH GGGGGGY + GGGGG Sbjct: 70 GGGGGGYHGGGGGGYHGGGGGGYHGGGGGGGYGRKPTIEVYVVKPVYQGGGGG 122 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 8/37 (21%) Frame = +3 Query: 183 GGGGGG-----GGGGGGYHNGG---GGGGYHNGGGGG 269 GGGGGG G GGGGYH GG GGGGYH GGGGG Sbjct: 118 GGGGGGGYHGGGAGGGGYHGGGGGVGGGGYHGGGGGG 154 [41][TOP] >UniRef100_UPI00016E7FC0 UPI00016E7FC0 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7FC0 Length = 1009 Score = 65.9 bits (159), Expect = 7e-09 Identities = 34/59 (57%), Positives = 35/59 (59%), Gaps = 8/59 (13%) Frame = -3 Query: 304 SCSLGDPLVLERPPPPP-----LW*PPPPPPL---W*PPPPPPPPPPPPVPGRSLDPPP 152 S SL L L PPPPP PPPPPPL PPPPPPPPPPPP+PG PPP Sbjct: 402 SSSLPHTLGLAVPPPPPPLPGGFAPPPPPPPLPGGLAPPPPPPPPPPPPLPGGLAPPPP 460 Score = 62.0 bits (149), Expect = 9e-08 Identities = 29/46 (63%), Positives = 30/46 (65%), Gaps = 4/46 (8%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPL----W*PPPPPPPPPPPPVPGRSLDPPP 152 L PPPPP PPPPPPL PPPPPPPPPP P+PG PPP Sbjct: 437 LAPPPPPP---PPPPPPLPGGLAPPPPPPPPPPPLPLPGGLAPPPP 479 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/55 (52%), Positives = 30/55 (54%), Gaps = 16/55 (29%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL-----W*PPP-----------PPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPPL PPP PPPPPPPPP+PG PPP Sbjct: 457 PPPPP---PPPPPPLPLPGGLAPPPPPPLLSGPAPLPPPPPPPPPLPGGLAPPPP 508 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/51 (56%), Positives = 30/51 (58%), Gaps = 9/51 (17%) Frame = -3 Query: 277 LERPPPPPLW*PP---PPPPLW*PPPPP------PPPPPPPVPGRSLDPPP 152 L PPPPPL P PPPP PPPPP PPPPPPP+PG PPP Sbjct: 474 LAPPPPPPLLSGPAPLPPPP---PPPPPLPGGLAPPPPPPPLPGGLAPPPP 521 [42][TOP] >UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis thaliana RepID=Q9XIL9_ARATH Length = 727 Score = 65.9 bits (159), Expect = 7e-09 Identities = 30/55 (54%), Positives = 36/55 (65%), Gaps = 6/55 (10%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPP---PPPPPPV---PGRSLDPPPMMAS 140 P + PPPPP++ PPPPPP++ PPPPPP PPPPPPV P PPP + S Sbjct: 504 PSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHS 558 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/57 (50%), Positives = 33/57 (57%), Gaps = 13/57 (22%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPP----------PPPP---PPVPGRSLDPP 155 P V PPPPP++ PPPPPP++ PPPPPP PPPP PP P S PP Sbjct: 513 PPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 310 PNSCSLGDPLVLER-PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PN P+ R PPPPP+ PPPP P+ PPPPP PPPP P S PPP + S Sbjct: 478 PNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYS 535 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 10/62 (16%) Frame = -3 Query: 286 PLVLERPPPPPLW*PP-----PPPPLW*PPPP---PPPP--PPPPVPGRSLDPPPMMAST 137 P V PPPPP+ PP PPPP+ PPPP PPPP PPP P +S PPP+ + Sbjct: 611 PPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPP 670 Query: 136 VL 131 +L Sbjct: 671 LL 672 Score = 55.5 bits (132), Expect = 9e-06 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 11/50 (22%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPP---PPPP---PPPPV-----PGRSLDPPPM 149 PPPP++ PPPPPP+ PPPP PPPP PPPPV P S PPP+ Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPV 658 [43][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 65.9 bits (159), Expect = 7e-09 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPP 182 PPPPP++ PPPPPP++ PPPPPPPPPPPP Sbjct: 455 PPPPPVYSPPPPPPVYSPPPPPPPPPPPP 483 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/54 (53%), Positives = 33/54 (61%), Gaps = 7/54 (12%) Frame = -3 Query: 286 PLVLERPPPP---PLW*PPPPPPLW*PPPPP----PPPPPPPVPGRSLDPPPMM 146 P VL PPPP P PPPPP++ PPPPP PPPPPPP P PPP++ Sbjct: 437 PPVLSSPPPPSPPPPSPSPPPPPVYSPPPPPPVYSPPPPPPPPP----PPPPVL 486 [44][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 65.9 bits (159), Expect = 7e-09 Identities = 32/60 (53%), Positives = 34/60 (56%) Frame = -3 Query: 328 HVSILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 H + VP G P L PPPP PPPPPPL PPPPPPPPP PP P PPP+ Sbjct: 1190 HGDVCVPAPVPAGPPPPLTPPPPPLPPPPPPPPPL--PPPPPPPPPLPPPPPPPPPPPPV 1247 [45][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 65.9 bits (159), Expect = 7e-09 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 PPPPP PPPPPP PPPPPPPPPPPP P PPP + ++ Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103 Score = 65.5 bits (158), Expect = 9e-09 Identities = 29/48 (60%), Positives = 30/48 (62%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLAR 125 PPPPP PPPPPP PPPPPPPPPPPP P PPP V +R Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSR 104 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/47 (59%), Positives = 31/47 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLA 128 PPPPP PPPPPP PPPPPPPPPPPP P PP ++ S L+ Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLS 107 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREP 116 PPPPP PPPPPP PPPPPPPPPPPP P R + P+ S + AR P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPL--SALFARPVP 115 [46][TOP] >UniRef100_B4HH21 GM26598 n=1 Tax=Drosophila sechellia RepID=B4HH21_DROSE Length = 359 Score = 65.9 bits (159), Expect = 7e-09 Identities = 36/87 (41%), Positives = 42/87 (48%) Frame = -3 Query: 349 RMYCLSCHVSILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGR 170 R+Y L + +P +G P PPPP PPPPPP PPPPPPPPPPP VPG Sbjct: 117 RVYELPAAIEDWIPRH--VGKPKAKLPSPPPP---PPPPPP---PPPPPPPPPPPGVPGN 168 Query: 169 SLDPPPMMASTVLARREPGAESYLVSP 89 + PP L +P Y P Sbjct: 169 PVSLPPQPVIVPLNPADPIQSFYFAYP 195 [47][TOP] >UniRef100_B3MYN1 GF22178 n=1 Tax=Drosophila ananassae RepID=B3MYN1_DROAN Length = 223 Score = 65.9 bits (159), Expect = 7e-09 Identities = 31/52 (59%), Positives = 32/52 (61%), Gaps = 7/52 (13%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGG-------GYHNGGGGGRSRTSG 287 GGG G GGGG GGGGGGGYH GGGGG GYH GGGGG + G Sbjct: 126 GGGGHRWGGGGGGGYGGGGGGGYHGGGGGGYPGGGGGGYHGGGGGGGPQWGG 177 Score = 61.2 bits (147), Expect = 2e-07 Identities = 33/61 (54%), Positives = 36/61 (59%) Frame = +3 Query: 105 DSAPGSLLASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTS 284 D A SLLA + GGG GGGG GGGGGGG+ GGGGGG NGGGGG + Sbjct: 19 DRATPSLLALKKKLLFGGG-------GGGGWGGGGGGGFGWGGGGGGGFNGGGGGYNGGG 71 Query: 285 G 287 G Sbjct: 72 G 72 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGG GGGGGGYH GGGGGG GGGGG Sbjct: 142 GGGGGGYHGGGGGGYPGGGGGGYHGGGGGGGPQWGGGGG 180 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 10/51 (19%) Frame = +3 Query: 153 GGGSRLLPGTGG---GGGGGGGGGGYHNGGGGG-------GYHNGGGGGRS 275 GGG G GG GGGG GGGGYH GGGGG GYH GGGGG++ Sbjct: 62 GGGGGYNGGGGGYHGGGGGYNGGGGYHGGGGGGNYGGGGGGYHGGGGGGKT 112 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 11/50 (22%) Frame = +3 Query: 153 GGGSRLLP--------GTGGGGG---GGGGGGGYHNGGGGGGYHNGGGGG 269 GGG + + +GGGGG GGGGGGGY GGGGGGYH GGGGG Sbjct: 107 GGGGKTIDIYVVKPVYSSGGGGGHRWGGGGGGGY-GGGGGGGYHGGGGGG 155 [48][TOP] >UniRef100_A0BLV2 Chromosome undetermined scaffold_115, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BLV2_PARTE Length = 1084 Score = 65.9 bits (159), Expect = 7e-09 Identities = 32/56 (57%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = -3 Query: 313 VPNSCSLGDPLVLERPPPPPLW*PPPPPP--LW*PPPPPPPPPPPPVPGRSLDPPP 152 V + S +P + PPPPP PPPPPP L PPPPPPPPPPP PG SL PP Sbjct: 534 VSTTISAPNPPQIAPPPPPP---PPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPP 586 Score = 61.2 bits (147), Expect = 2e-07 Identities = 34/67 (50%), Positives = 36/67 (53%), Gaps = 10/67 (14%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPP---LW*PPPPPPLW*PPPP-------PPPPPPPPVPG 173 +I PN + P PPPPP L PPPPPP PPPP PPPPPPPP PG Sbjct: 537 TISAPNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPP-PG 595 Query: 172 RSLDPPP 152 L PPP Sbjct: 596 GRLPPPP 602 Score = 60.1 bits (144), Expect = 4e-07 Identities = 32/59 (54%), Positives = 32/59 (54%), Gaps = 11/59 (18%) Frame = -3 Query: 292 GDPLVLERPPPPPLW*PPPPPP---LW*PPPPPPPPPP--------PPVPGRSLDPPPM 149 G L PPPPP PPPPPP L PPPPPPPPPP PP PG PPPM Sbjct: 560 GGLLTAPPPPPPP---PPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPPM 615 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/51 (58%), Positives = 32/51 (62%), Gaps = 12/51 (23%) Frame = -3 Query: 268 PPPPP---LW*PPPPPP-------LW*PPPPPP--PPPPPPVPGRSLDPPP 152 PPPPP L PPPPPP L PPPPPP PPPPP+PGR+ PPP Sbjct: 574 PPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPP 624 [49][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 65.9 bits (159), Expect = 7e-09 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P V PPPPP PPPPPP PPPPPPPPPPPP+ + PPP Sbjct: 1027 PAVTAVPPPPPPPPPPPPPPP--PPPPPPPPPPPPMSAGGIPPPP 1069 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/42 (61%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL---W*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP+ PPPPPPPPPPPP + PPP Sbjct: 1046 PPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMSPGMPPPP 1087 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP G PPP Sbjct: 1035 PPPPPPPPPPPPPP---PPPPPPPPPPPMSAGGIPPPPP 1070 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/64 (48%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = -3 Query: 268 PPPPPLW*PPPPPP-----------LW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARR 122 PPPPP PPPPPP + PPPPPPPPPPP PG PPP + V Sbjct: 1040 PPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMSPGMPPPPPPPPGAPV---- 1095 Query: 121 EPGA 110 PGA Sbjct: 1096 -PGA 1098 [50][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 65.5 bits (158), Expect = 9e-09 Identities = 33/73 (45%), Positives = 37/73 (50%), Gaps = 13/73 (17%) Frame = -3 Query: 331 CHVSILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPP-------------PPPPP 191 C +LVP G P PPPP++ PPPPPP + PPPP PPPPP Sbjct: 66 CDEIVLVP-----GKPAPPAYAPPPPVYAPPPPPPAYAPPPPPPAYAPPPPPAYAPPPPP 120 Query: 190 PPPVPGRSLDPPP 152 PPP P S PPP Sbjct: 121 PPPPPPPSYGPPP 133 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 6/45 (13%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PP------PPPPPPPPPPVPGRSLDPPP 152 PPPPP + PPPPPP PP PPPPPPPPPP P S PPP Sbjct: 261 PPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPPAYSPPPPP 305 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/56 (51%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPP---PPPPPVPGRSLDPPP 152 P + + G P PPPPP + PPPPP PPPPPPP PPPPP G PPP Sbjct: 279 PAAYAYGPPPPPPPPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPP 334 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/53 (52%), Positives = 31/53 (58%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P + G P PPPPP + PPPPP + PPPPPPPPPPPP PPP Sbjct: 201 PPPPAYGPPPPPPPPPPPPAY-GPPPPPAYGPPPPPPPPPPPPAYSPPPPPPP 252 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPP---PPPPPPPPPVPGRSLDPPP 152 PPPPP + PPPPPP PPP PPPPPPPPP P PPP Sbjct: 223 PPPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPP 264 Score = 62.4 bits (150), Expect = 7e-08 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPP----PVPGRSLDPPP 152 PPPPP PPPPPP + PPPPPPPPPPP P P + PPP Sbjct: 232 PPPPP---PPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPP 271 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/43 (62%), Positives = 29/43 (67%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP----PPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP + PPPPP PPPPPPP P + PPP Sbjct: 117 PPPPP---PPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPP 156 Score = 62.0 bits (149), Expect = 9e-08 Identities = 29/53 (54%), Positives = 32/53 (60%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P + G P PPPPP + PPPPP + PPPPPPPPPPPP G PPP Sbjct: 132 PPPPAYGPPPPPPPPPPPPAY-GPPPPPAYGPPPPPPPPPPPPAYG----PPP 179 Score = 62.0 bits (149), Expect = 9e-08 Identities = 29/53 (54%), Positives = 32/53 (60%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P + G P PPPPP + PPPPP + PPPPPPPPPPPP G PPP Sbjct: 155 PPPPAYGPPPPPPPPPPPPAY-GPPPPPAYGPPPPPPPPPPPPAYG----PPP 202 Score = 62.0 bits (149), Expect = 9e-08 Identities = 29/53 (54%), Positives = 32/53 (60%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P + G P PPPPP + PPPPP + PPPPPPPPPPPP G PPP Sbjct: 178 PPPPAYGPPPPPPPPPPPPAY-GPPPPPAYGPPPPPPPPPPPPAYG----PPP 225 Score = 62.0 bits (149), Expect = 9e-08 Identities = 31/64 (48%), Positives = 34/64 (53%), Gaps = 11/64 (17%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPP---PPPPPP--------VPGRSL 164 P + G P PPPPP + PPPPPP + PPPPPP PPPPPP V G Sbjct: 321 PPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVYGPPA 380 Query: 163 DPPP 152 PPP Sbjct: 381 PPPP 384 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/51 (54%), Positives = 29/51 (56%), Gaps = 12/51 (23%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PP------------PPPPPPPPPPVPGRSLDPPP 152 PPPPP + PPPPPP PP PPPPPPPPPP P S PPP Sbjct: 200 PPPPPAYGPPPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAYSPPPPP 250 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/47 (57%), Positives = 30/47 (63%), Gaps = 8/47 (17%) Frame = -3 Query: 268 PPPPPLW--*PPPPPPLW*PPPPP------PPPPPPPVPGRSLDPPP 152 PPPPP + PPPPPP + PPPPP PPPPPPP P + PPP Sbjct: 301 PPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPP 347 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP + PPPPPPPPPPP PPP Sbjct: 252 PPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPP 290 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/62 (46%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPPMMASTVLARREPGAESYLV 95 PPPPP PPPPPP + PPPPP PPPPPP P + PPP P +Y Sbjct: 287 PPPPP---PPPPPPAYSPPPPPAYGPPPPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAP 343 Query: 94 SP 89 P Sbjct: 344 PP 345 Score = 60.1 bits (144), Expect = 4e-07 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 12/51 (23%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PP------------PPPPPPPPPPVPGRSLDPPP 152 PPPPP + PPPPPP PP PPPPPPPPPP P PPP Sbjct: 108 PPPPPAYAPPPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAYGPPPPP 158 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/49 (53%), Positives = 28/49 (57%), Gaps = 14/49 (28%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--------------PPPPPPVPGRSL 164 PPPPP + PPPPPP + PPPPPP PPPPPP P R L Sbjct: 344 PPPPPAYAPPPPPPAYAPPPPPPKYSPAPIVVYGPPAPPPPPPAPKRKL 392 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/51 (52%), Positives = 28/51 (54%), Gaps = 6/51 (11%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPP------PPPPPPPPVPGRSLDPPP 152 P PPPP PPPPPP PPPP PPPPPPPP P + PPP Sbjct: 256 PAAYGPPPPPAYGPPPPPPP---PPPPAAYAYGPPPPPPPPPPPPAYSPPP 303 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/44 (56%), Positives = 27/44 (61%), Gaps = 5/44 (11%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPV-----PGRSLDPPP 152 PPPPP PPPPP + PP PPPPPPPPP P + PPP Sbjct: 311 PPPPPPAYAPPPPPAYGPPAPPPPPPPPPAYAPPPPPPAYAPPP 354 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/45 (55%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPP------PPVPGRSLDPPP 152 PPPP + PPPPP PPPPPPPPPP PP P PPP Sbjct: 253 PPPPAAYGPPPPPAYGPPPPPPPPPPPAAYAYGPPPPPPPPPPPP 297 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/66 (43%), Positives = 31/66 (46%), Gaps = 13/66 (19%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PP-------------PPPPPPPPPPVPGR 170 P + G P PPPPP + PPPPPP PP PPPPPPPPPP Sbjct: 224 PPPPAYGPPPPPPPPPPPPAYSPPPPPPPPPPPAAYGPPPPPAYGPPPPPPPPPPPAAYA 283 Query: 169 SLDPPP 152 PPP Sbjct: 284 YGPPPP 289 [51][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 65.5 bits (158), Expect = 9e-09 Identities = 30/49 (61%), Positives = 32/49 (65%), Gaps = 4/49 (8%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPP----VPGRSLDPPP 152 P V PPPPP PPPPPP++ PPPPPPPPPPPP P S PPP Sbjct: 446 PPVYSPPPPPP---PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 65.5 bits (158), Expect = 9e-09 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 P V PPP P PPPPPP++ PPPPPPPPPPPPV S PPP+ +S Sbjct: 477 PPVYSPPPPSP---PPPPPPVYSPPPPPPPPPPPPV--YSPPPPPVYSS 520 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P V PPPPP PPPPPP++ PPPP PPPPPPPV PPP Sbjct: 461 PPVYSPPPPPPP--PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP++ PPPPPPPPPPPPV PPP Sbjct: 438 PPPP---PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPP 472 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPP---PPPPPPPPPVPGRSLDPPP 152 PPPPP++ PPPPPP PPP PPPPPPPPP P PPP Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 5/50 (10%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPP-----PPPPPPVPGRSLDPPP 152 P + PPP P++ PPPPPP PPPPPP PPPPPPV S PPP Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP 644 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/47 (59%), Positives = 30/47 (63%), Gaps = 8/47 (17%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPP--------PPPPPVPGRSLDPPP 152 PPPPP++ PPPPPP PPPPPPP PPPPP P S PPP Sbjct: 458 PPPPPVYSPPPPPP---PPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPP---PPPPPPPPVPGRSLDPPP 152 PPPP++ PPPPPP PPPP PPPPPPPP P PPP Sbjct: 431 PPPPVYSPPPPPP---PPPPVYSPPPPPPPPPPPPVYSPPP 468 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/53 (52%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPPMMASTVLARREP 116 PPPPP++ PPPPPP PPPPPP PPPPPV PP + V R P Sbjct: 489 PPPPPVYSPPPPPP---PPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPP 538 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPP---PVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPPP P P PPP Sbjct: 438 PPPPP---PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 3/49 (6%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPP---PPVPGRSLDPPPM 149 P L PPPP PPPP++ PPPPPPPPPP PP P PPP+ Sbjct: 420 PPTLTSPPPPS-----PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPV 463 [52][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 65.5 bits (158), Expect = 9e-09 Identities = 29/46 (63%), Positives = 29/46 (63%) Frame = -3 Query: 289 DPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 DP PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 62.8 bits (151), Expect = 6e-08 Identities = 29/52 (55%), Positives = 29/52 (55%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 P C P PPPPP PPPPPP PPPPPPPPPPPP P PP Sbjct: 18 PPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 R PPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 RVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSL 164 PPPPP PPPPPP PPPPPPPPPPPP P ++ Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 72 [53][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P S +PPP Sbjct: 236 PPPPPPSPPPPPPP---PPPPPPPPPPPSPPPPSPNPPP 271 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/45 (60%), Positives = 28/45 (62%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P+ PPPPP PPPPPP PPP PPPPPPPP P PPP Sbjct: 219 PVASPSPPPPPPPPPPPPPP---PPPSPPPPPPPPPPPPPPPPPP 260 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPP P P PPP Sbjct: 237 PPPPPSPPPPPPPP---PPPPPPPPPPSPPPPSPNPPPP 272 [54][TOP] >UniRef100_B9RS81 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RS81_RICCO Length = 516 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 L PPPPP PPPP P PPPPPPPPPPPP P PPP Sbjct: 412 LSSPPPPPFSPPPPPSPPLSPPPPPPPPPPPPSPSPLPPPPP 453 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/69 (49%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = -3 Query: 334 SCHVSILVPNSCSLGDPLVLERPPP-PPLW*PPPPPPLW*PPPPPPP---PPPPPVPGRS 167 +CH P S P PPP PPL PPPPPP PPPPP P PPPPP P S Sbjct: 402 NCHKPNPSPPLSSPPPPPFSPPPPPSPPLSPPPPPPP---PPPPPSPSPLPPPPPPPFYS 458 Query: 166 LDPPPMMAS 140 PPP S Sbjct: 459 PPPPPTYQS 467 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/73 (41%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPL---W*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 P S L P PPPPP PPPPPP + PPPPP PPP P ++PPP + Sbjct: 425 PPSPPLSPPPPPPPPPPPPSPSPLPPPPPPPFYSPPPPPTYQSPPPSPPPCVNPPPPPSP 484 Query: 139 TVLARREPGAESY 101 + P A +Y Sbjct: 485 PPCLEQPPPAPTY 497 [55][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 65.5 bits (158), Expect = 9e-09 Identities = 29/46 (63%), Positives = 29/46 (63%) Frame = -3 Query: 289 DPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 DP PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 DPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 R PPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 RVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSL 164 PPPPP PPPPPP PPPPPPPPPPPP P ++ Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNI 69 [56][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMM 146 PPPPP PPPPPP PPPPPPPPPPPP P PPP + Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQL 84 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 [57][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 65.5 bits (158), Expect = 9e-09 Identities = 31/59 (52%), Positives = 32/59 (54%) Frame = -3 Query: 328 HVSILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 H + P S L PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 25 HSLPIFPPSLFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/57 (52%), Positives = 33/57 (57%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 S+ + S + P PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 33 SLFLQQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPPPPPPPP DPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADPP 106 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDP--PP 152 PPPPP PPPPPP PPPPPPPPPPPP P +P PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEPADPP 106 [58][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 65.5 bits (158), Expect = 9e-09 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA 143 PPPPP PPPPPP PPPPPPPPPPPP P PPP+ A Sbjct: 3 PPPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPLRA 41 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPP 36 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPP 37 Score = 62.4 bits (150), Expect = 7e-08 Identities = 29/49 (59%), Positives = 29/49 (59%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARR 122 PPPPP PPPPPP PPPPPPPPPPPP P P S V RR Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSAVRPRR 54 [59][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P PPP+ Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 48 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/43 (62%), Positives = 29/43 (67%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPPPP PPPPPP PPPPPPPPPPPP P PPP + + Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCN 50 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [60][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 65.5 bits (158), Expect = 9e-09 Identities = 31/50 (62%), Positives = 31/50 (62%), Gaps = 4/50 (8%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG----RSLDPPPMMASTVL 131 PPPPP PPPPPP PPPPPPPPPPPP PG L PPP A L Sbjct: 365 PPPPP---PPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAGARAKL 411 [61][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 65.5 bits (158), Expect = 9e-09 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPPL PPPPPP PPPPP PPPPPP P L PP Sbjct: 135 PPPPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPP 172 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P L P P Sbjct: 10 PPPPPSSPPPPPPPSPPPPPPSPPPPPPPSPPSPLPPSP 48 Score = 62.0 bits (149), Expect = 9e-08 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 5/47 (10%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL-W*PPPPPPPPPPPPV----PGRSLDPPPMMA 143 PPPPPL PPPPPPL PPPPPP PPPPP+ P S PPP+++ Sbjct: 96 PPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLS 142 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPP-----PPPPPPPVPGRSLDPPP 152 PPPPL PPPPPPL PPPPP PPPPPP P L PPP Sbjct: 88 PPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPP 130 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 +PPPPP PPPPPP PPPPPPP PPPP+P S PPP + S Sbjct: 63 QPPPPPSSPPPPPPPPS-PPPPPPPSPPPPLP--SPPPPPPLPS 103 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P L PPPPP PPPPPL PPPPPP PPPPP P S PPP Sbjct: 123 PPPLSPPPPPP---SPPPPPLLSPPPPPPSPPPPPPP--SPPPPP 162 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 1 PPPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPPP 38 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPP P PPP Sbjct: 48 PPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPP 86 Score = 60.1 bits (144), Expect = 4e-07 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPP 152 PPPPP P PPPPL PPPPPP PPPPPP+P PPP Sbjct: 81 PPPPP---PSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPP 119 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/45 (60%), Positives = 28/45 (62%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P +L PPPPP PPPPPP PPPPP PPPP P P PPP Sbjct: 138 PPLLSPPPPPPS--PPPPPPPSPPPPPPSPPPPLPPPSPLPPPPP 180 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPP--PPPPPPPPVPGRSLDPPP 152 PPPPPL PPPPP PPPP PPPPPP P P L PPP Sbjct: 105 PPPPPLPSSPPPPPPSPPPPPLSPPPPPPSPPPPPLLSPPP 145 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPP PP P+P PPP Sbjct: 17 PPPPPPPSPPPPPPS--PPPPPPPSPPSPLPPSPPPPPP 53 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/49 (59%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPP----PPVPGRSLDPPP 152 PL PPPPP PPPPPL PPPPP PPPP PP P S PPP Sbjct: 109 PLPSSPPPPPP---SPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPP 154 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/46 (63%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPP-PPPVPGRSLDPPP 152 P L PPPPP PPPPPP PPPP PPPP PPP P L PPP Sbjct: 137 PPPLLSPPPPPPSPPPPPPPSPPPPPPSPPPPLPPPSP---LPPPP 179 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPP-----PLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PL PPPPP PPPPP P PPPPPPPP PPP P S PPP + S Sbjct: 43 PLPPSPPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPS--PPPPLPS 94 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPP PPPPPP P L PP Sbjct: 56 PPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPP 96 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/43 (60%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPP----PLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPPL PPPPP P PPPPPP PPPP P PPP Sbjct: 121 PPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPPPP 163 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PP PPL PPPPPP PPPPPPP PPPP P PPP Sbjct: 219 PPSPPLPPPPPPPPS--PPPPPPPSPPPPSP-----PPP 250 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/47 (59%), Positives = 31/47 (65%), Gaps = 3/47 (6%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPPMMAST 137 PPPPP PPPPPP P PPPP PPPPPP+P S PPP + S+ Sbjct: 72 PPPPPPPSPPPPPP---PSPPPPLPSPPPPPPLP--SPPPPPPLPSS 113 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PP---PPPPPP---PPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPPPP PPPP P S PPP Sbjct: 73 PPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSPPPP 117 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/68 (47%), Positives = 32/68 (47%), Gaps = 11/68 (16%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPP-----------PPPPPPPPPVP 176 S L P S PL PPPPP PPPPPP PPP PP PPPPPP P Sbjct: 173 SPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPP 232 Query: 175 GRSLDPPP 152 PPP Sbjct: 233 SPPPPPPP 240 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPP--PPPVPGRSLDPPPM 149 PPP PL PPP PP PP PPPPPP PPP P S PPP+ Sbjct: 170 PPPSPLPPPPPSPPHPLPPSPPPPPPPSPPPPPPPSPPPPPL 211 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPP--PLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPPPP PPPPP P PP PPPPPPP P P PPP +S Sbjct: 26 PPPPPSPPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSS 70 [62][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 65.5 bits (158), Expect = 9e-09 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA 143 PPPPP PPPPPP PPPPPPPPPPPP P PPP A Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRA 61 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/49 (61%), Positives = 30/49 (61%) Frame = -3 Query: 298 SLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 SL P PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [63][TOP] >UniRef100_UPI000194C62B PREDICTED: similar to Uncharacterized protein C11orf9 homolog n=1 Tax=Taeniopygia guttata RepID=UPI000194C62B Length = 1185 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/73 (43%), Positives = 38/73 (52%) Frame = -3 Query: 307 NSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLA 128 N C + P LE PPPPP PPPPPP PPPPPPPPP P+ + P + + Sbjct: 232 NMCHMTPPSRLEHPPPPP---PPPPPPHLQGPPPPPPPPPHPLQPQHNSHFPGLQRDMFL 288 Query: 127 RREPGAESYLVSP 89 + EP Y V P Sbjct: 289 KAEPLMPPYSVGP 301 [64][TOP] >UniRef100_UPI0000F2E99A PREDICTED: similar to diaphanous homolog 2 (Drosophila), n=1 Tax=Monodelphis domestica RepID=UPI0000F2E99A Length = 1133 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 4/49 (8%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*----PPPPPPPPPPPPVPGRSLDPPP 152 P VL PPPPP PPPPPL PPPPPPPPPPPP+PG PPP Sbjct: 543 PGVLSPPPPPP----PPPPPLVPGGAVPPPPPPPPPPPPLPGGIPPPPP 587 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 10/49 (20%) Frame = -3 Query: 268 PPPPPLW*----PPPPPPLW*PPPPP------PPPPPPPVPGRSLDPPP 152 PPPPPL PPPPPP PPPPP PPPPPPP+PG ++ PPP Sbjct: 554 PPPPPLVPGGAVPPPPPP---PPPPPPLPGGIPPPPPPPLPGGAVPPPP 599 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/48 (58%), Positives = 30/48 (62%), Gaps = 8/48 (16%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL--W*PPPPPPP------PPPPPVPGRSLDPPPM 149 PPPPP PPPPPPL PPPPPPP PPPPP+ G PPP+ Sbjct: 567 PPPPP---PPPPPPLPGGIPPPPPPPLPGGAVPPPPPLFGGPPPPPPL 611 [65][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/49 (61%), Positives = 30/49 (61%) Frame = -3 Query: 298 SLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 SL P PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGR 170 PPPPP PPPPPP PPPPPPPPPPPP P R Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVP 176 PPPPP PPPPPP PPPPPPPPPPPP P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [66][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP P PPPP PPPPPPPPPPPP P S PPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 62.8 bits (151), Expect = 6e-08 Identities = 30/57 (52%), Positives = 36/57 (63%), Gaps = 4/57 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM----MASTVLARREPGA 110 PPPPP PPPPPP PPPPPPPPPPPP P PPP+ + ++A+ +P A Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP-----PPPVYPDQCSVCIVAKLQPPA 320 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPPPPPPPPPPP P PPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPP P PPPPPP PPPPPPPPPPPP P PPP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 62.4 bits (150), Expect = 7e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 253 PPPPP---PPPPPP---PPPPPPPPPPPPSPPPPPPPPP 285 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPPPPPPP P PPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPPPP P PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPP PPPPPPPP P PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPPPPPPP P PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP P PPPPPPPPPP P PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPPPP P PPP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PL L PP PL PPPPP PPP PPPPPPPP P PPP Sbjct: 211 PLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPP 255 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPPPPPPP P PPP Sbjct: 240 PPPPP---PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPPPPPPPPPPP P PPP Sbjct: 239 PPPPP---PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PP PPP PPPPPPPPPPPP P PP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PPP PPPPPPPP P PPP Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPP P PPPPPP P PPPPPPPPPP P PPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/45 (57%), Positives = 26/45 (57%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PL PPPPP PP PPP PPPP PPP PPP P PPP Sbjct: 221 PLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP P PPPP PPP PPP PPPP P PPP Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPP PPPPPPP P PPP Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 [67][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA 143 ++PPPPP P PPP PPPPPPPPPPPP P +P P A Sbjct: 40 QQPPPPPPPPPASPPP---PPPPPPPPPPPPPPPPPPEPEPQPA 80 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP--PPPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPP PPPPPPP P + PPP Sbjct: 1942 PPRPPTLAPPPPPP---PPPPTEDPPPPPPPPPAEAPPPPP 1979 [68][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/44 (56%), Positives = 28/44 (63%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA 143 ++PPPPP P PPP PPPPPPPPPPPP P +P P A Sbjct: 40 QQPPPPPPPPPASPPP---PPPPPPPPPPPPPPPPPPEPEPQPA 80 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP--PPPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPP PPPPPPP P + PPP Sbjct: 1845 PPRPPTLAPPPPPP---PPPPTEDPPPPPPPPPAEAPPPPP 1882 [69][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/61 (49%), Positives = 36/61 (59%) Frame = -3 Query: 307 NSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLA 128 N+ + P ++ PPPPP PPPPPP PPPPPP PPPPP P + PPP +A Sbjct: 342 NNATSDAPKLMPPPPPPP---PPPPPP---PPPPPPRPPPPPPPIKKGAPPPAPPKATMA 395 Query: 127 R 125 R Sbjct: 396 R 396 [70][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPP P PPPPPP+ PPPPPPPPPPPP P L PPP Sbjct: 177 PPPAPCPPPPPPPPMCLPPPPPPPPPPPPCP---LPPPP 212 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/57 (54%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPV----PGRSLDPPP 152 P C P+ PPPPP PPPPPP PPPPPPPPPPPPV P PPP Sbjct: 126 PPVCPPPPPMCAPPPPPPPPPPPPPPPP---PPPPPPPPPPPPVVFCPPPPPCPPPP 179 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP+ PPPPP+ PPPPPPPPPPPP P PPP Sbjct: 123 PPPPPVC--PPPPPMCAPPPPPPPPPPPPPPPPPPPPPP 159 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPPPP P PPP Sbjct: 122 PPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPPPPPP 160 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP-PPPPPPVPGRSLDPPPMM 146 PPPPP+ PPPPPP PPPPPP PPPPPP P PPP++ Sbjct: 130 PPPPPMCAPPPPPPPPPPPPPPPPPPPPPPPP----PPPPVV 167 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/42 (61%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPP---PPPPPPPPVPGRSLDPPP 152 PPP P PPPPPP+ PPPP PPPPPPPP P PPP Sbjct: 114 PPPAPCPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPP 155 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPP 152 PPPPP+ PPPPPP PPPPPP PPPPPP P PPP Sbjct: 186 PPPPPMCLPPPPPP---PPPPPPCPLPPPPPPCP-----PPP 219 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PP----PPPPPPPPPPVPGRSLDPPPMM 146 P C+ P PPPPP PPPPPP PP PPPPP PPPP P PPP M Sbjct: 133 PPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPM 191 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/45 (57%), Positives = 28/45 (62%), Gaps = 6/45 (13%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPP------PPPPPVPGRSLDPPP 152 PPPPP PPPPP ++ PPPPP P PPPPP P L PPP Sbjct: 153 PPPPPPPPPPPPPVVFCPPPPPCPPPPAPCPPPPPPPPMCLPPPP 197 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP PPPPPPPPPPP PPP Sbjct: 176 PPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLPPPPPP 214 [71][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPPL PPPPPP PPPP PPPPPPP P PPP Sbjct: 209 PPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPP 247 Score = 60.1 bits (144), Expect = 4e-07 Identities = 33/68 (48%), Positives = 38/68 (55%), Gaps = 10/68 (14%) Frame = -3 Query: 325 VSILVPNSCSLGDPL----------VLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVP 176 ++I PN S G+P+ V + P PPP PPPPPPL PPPPPPPPP PP P Sbjct: 175 ITITSPNGVS-GEPMSFQELYIWGVVSDFPSPPP---PPPPPPLP-PPPPPPPPPSPPPP 229 Query: 175 GRSLDPPP 152 PPP Sbjct: 230 SPPPPPPP 237 Score = 58.9 bits (141), Expect = 8e-07 Identities = 31/66 (46%), Positives = 32/66 (48%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAE 107 PL PPPPP PPP PP PP PPPP PPPP P PPP T R Sbjct: 213 PLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTGR---SCF 269 Query: 106 SYLVSP 89 SY + P Sbjct: 270 SYAIGP 275 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPP PPPP PPP P S PP Sbjct: 208 PPPPPPLPPPPPPP---PPPSPPPPSPPPPPPPSPPPP 242 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PP PPPP PPPP+P PPP Sbjct: 1175 PPPPPSPPPPSPPP---PPSPPPPSPPPPLPPPPSPPPP 1210 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/56 (48%), Positives = 31/56 (55%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 +++ + CS P PP PP P PPPPL PP PPPP PPPP P S PP Sbjct: 2520 TMISSDPCSPPSPPPPSPPPSPP---PSPPPPLPPPPSPPPPSPPPPSPPPSPPPP 2572 [72][TOP] >UniRef100_Q212G2 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas palustris BisB18 RepID=Q212G2_RHOPB Length = 1026 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/60 (51%), Positives = 36/60 (60%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAE 107 P+V + PPPPP PPPPP+ P PPPPPPPPPPV PPP A+ A P A+ Sbjct: 958 PVVRQAPPPPP----PPPPPVVRPAPPPPPPPPPPVMRPPPPPPPPPAAARPAPPPPAAK 1013 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/46 (56%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Frame = -3 Query: 286 PLVLERPPPPPL-W*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P+V + PPPPP+ PPPPP+ PPPPPPPPPPV + PPP Sbjct: 938 PVVRQAPPPPPVVHQAPPPPPVVRQAPPPPPPPPPPVVRPAPPPPP 983 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 5/50 (10%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPP-----PPPPPPVPGRSLDPPP 152 P+V + PPPPP+ PPPP PPPPPP PPPPPP P + PPP Sbjct: 948 PVVHQAPPPPPVVRQAPPPP---PPPPPPVVRPAPPPPPPPPPPVMRPPP 994 [73][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/74 (48%), Positives = 41/74 (55%), Gaps = 3/74 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTV--LARREPGAES-YL 98 PPPPP PPPPPP PPPPPPPP PPP P R PPP+ TV + R E + Sbjct: 421 PPPPP---PPPPPP---PPPPPPPPTPPPPPPRPPSPPPVEKVTVNPIVRSEKRVSTPPR 474 Query: 97 VSPVCSISSLSIPS 56 P S +S S+ S Sbjct: 475 TGPSTSATSFSVAS 488 [74][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 62.4 bits (150), Expect = 7e-08 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG 173 PPPPP PPPPPP PPPPPPPPPPPP PG Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 80 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLD 161 PPPPP PPPPPP PPPPPPPPPPPP G +D Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 [75][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA-STVLARR 122 PPPPP PPPPPP PPPPPPPPPPPP P R P P A +T L R Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSATATALGAR 125 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPPPP PPPPPP PPPPPPPPPPPP P + P+ +S Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSS 116 [76][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSL 164 PPPPP PPPPPP PPPPPPPPPPP + SL Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKISL 64 [77][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPPL PPPPPP PPPPPPPPPPPP P PP Sbjct: 311 PPPPPLPSPPPPPPT--PPPPPPPPPPPPPPNPPFIPP 346 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/56 (51%), Positives = 31/56 (55%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESY 101 P PPP PPPPPPL PPPPPP PPPPP P PPP + EP S+ Sbjct: 305 PSPPP---PPPPPPLPSPPPPPPTPPPPPPPP---PPPPPPNPPFIPPAEPVIPSF 354 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -3 Query: 271 RPP--PPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 RPP PPP PPPPPP PPPPPP PPPP P PPP Sbjct: 298 RPPATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPPP 339 [78][TOP] >UniRef100_C6HGV1 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus H143 RepID=C6HGV1_AJECH Length = 1711 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP PG S PPP Sbjct: 960 PPPPP---PPPPPPGVGAPPPPPPPPPPPPPGISGPPPP 995 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP + PPPPPPPPPPP V G PPP Sbjct: 975 PPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPP 1013 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Frame = -3 Query: 292 GDPLVLERPPPPPLW*PPPPPPLW*PPP-----PPPPPPPPPVPGRSLDPPP 152 G P PPPP + PPPPPP PPP PPPPPPPPP PG PPP Sbjct: 959 GPPPPPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPP 1010 [79][TOP] >UniRef100_C0NZQ8 Cytokinesis protein SepA/Bni1 n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NZQ8_AJECG Length = 1741 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP PG S PPP Sbjct: 990 PPPPP---PPPPPPGVGAPPPPPPPPPPPPPGISGPPPP 1025 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP + PPPPPPPPPPP V G PPP Sbjct: 1005 PPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPPPPP 1043 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Frame = -3 Query: 292 GDPLVLERPPPPPLW*PPPPPPLW*PPP-----PPPPPPPPPVPGRSLDPPP 152 G P PPPP + PPPPPP PPP PPPPPPPPP PG PPP Sbjct: 989 GPPPPPPPPPPPGVGAPPPPPPPPPPPPPGISGPPPPPPPPPPPGVGGPPPP 1040 [80][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPPPPPPPP P S PP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 62.8 bits (151), Expect = 6e-08 Identities = 33/60 (55%), Positives = 35/60 (58%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPPPPPPPP P PPP S R+P + S V P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP-----PPPPSPS---PPRKPPSPSPPVPP 312 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/51 (56%), Positives = 30/51 (58%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREP 116 PPPPP PPPPPP PPPPPP PPPPP P PPP S R+ P Sbjct: 260 PPPPP---PPPPPP---PPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 286 PLVLERPP-PPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P RPP PPP PP PPP PPPPPPPPPPP P PPP Sbjct: 235 PTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPP 280 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 RPP PP P PPPP PPPPPPPPPPPP P PPP Sbjct: 249 RPPSPPPPSPSPPPPP--PPPPPPPPPPPPSPPPPPPPPP 286 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPP P PPPP PPPPPPPPPPPP P S PPP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 [81][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P PPP+ Sbjct: 167 PPPPPPSPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPV 203 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 160 PPPPPS--PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 166 PPPPPPPSPPPPPP---PPPPPPPPPPPPPPPPPPPPPP 201 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 E PPPPP PPPPPP PPP PPPPPPP P PPP Sbjct: 129 ECPPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPP 169 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P PPP Sbjct: 146 PPPPPS--PPPPPPPSPPPPPSPPPPPPPSPPPPPPPPP 182 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPP PPPPPPPP P PPP Sbjct: 153 PPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PP PPPPPPPPP P PPP Sbjct: 154 PPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPP PPPPPPP P PPP Sbjct: 152 PPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 190 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PP PPPPP PPP P S PPP Sbjct: 140 PPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPP 178 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRS 167 PPPPP PPPPPP PPPPPPPPPPPP R+ Sbjct: 176 PPPPPPPPPPPPPP---PPPPPPPPPPPPPVDRN 206 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP PPP PPPPPPP P PPP Sbjct: 146 PPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPP 183 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPP PPPPP PP P PPP Sbjct: 139 PPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPP 177 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPP PPPPP P P PPP Sbjct: 138 PPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPP 176 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPP PPPPP P PPP Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPPPSP-----PPP 155 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP PPPPPPP PPP P PPP Sbjct: 123 PPPPEPECPPPPPP---SPPPPPPPSPPPPPSPPPPPPP 158 [82][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/54 (57%), Positives = 31/54 (57%) Frame = -3 Query: 313 VPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 V N L P R PPPP PPPPPPL P PPPPPPPPPP S PPP Sbjct: 591 VSNGNPLMPPTPASRGPPPP---PPPPPPLPGPSPPPPPPPPPPTSISSKGPPP 641 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/52 (51%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPP-----PPPPPPPVPGRSLDPPPMM 146 PL PPPPP PP P P PPPPP PPPPPP PG PPP + Sbjct: 736 PLGAHPPPPPPPPPPPAPKPPGAPPPPPKPPSAPPPPPPKPPGAPPPPPPKL 787 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = -3 Query: 265 PPPPLW*PPPPP---PLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPP PL PPPPPPPPPPP P PPP Sbjct: 724 PPPP---PPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPP 761 [83][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2329 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2382 Query: 103 YLVS 92 +V+ Sbjct: 2383 AIVT 2386 [84][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2329 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2382 Query: 103 YLVS 92 +V+ Sbjct: 2383 AIVT 2386 [85][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2299 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2352 Query: 103 YLVS 92 +V+ Sbjct: 2353 AIVT 2356 [86][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2329 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2382 Query: 103 YLVS 92 +V+ Sbjct: 2383 AIVT 2386 [87][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2299 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2352 Query: 103 YLVS 92 +V+ Sbjct: 2353 AIVT 2356 [88][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMM 146 PPPPP PPPPPP PPPPPPPPPPPP P + PPP + Sbjct: 270 PPPPPPPPPPPPPP---PPPPPPPPPPPPPPPPFILPPPFI 307 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/47 (57%), Positives = 28/47 (59%), Gaps = 7/47 (14%) Frame = -3 Query: 271 RPPPPP-------LW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 RPPPPP + P PPPP PPPPPPPPPPPP P PPP Sbjct: 252 RPPPPPPGDPFQEITGPGPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMM 146 PPPPP PPPPPP PPPPPPPPPP +P + PPP + Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPFILPPPFILPPPFI 313 [89][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2299 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2352 Query: 103 YLVS 92 +V+ Sbjct: 2353 AIVT 2356 [90][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2329 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2382 Query: 103 YLVS 92 +V+ Sbjct: 2383 AIVT 2386 [91][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2329 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2382 Query: 103 YLVS 92 +V+ Sbjct: 2383 AIVT 2386 [92][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 37/64 (57%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 L + PPPP PPPPPP PPPPPPPPPPPP+P + PP LA P A + Sbjct: 2299 LDISAQPPPP---PPPPPP---PPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPT 2352 Query: 103 YLVS 92 +V+ Sbjct: 2353 AIVT 2356 [93][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/58 (53%), Positives = 35/58 (60%) Frame = -3 Query: 325 VSILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 ++I V + + PL PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 48 LTIFVGENTGVPPPL----PPPPPPPPPPPPPP---PPPPPPPPPPPPSPPPPPPPPP 98 Score = 62.8 bits (151), Expect = 6e-08 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = -3 Query: 292 GDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 G P L PPPPP PPPPPP PPPPPPPPPP P P PPP Sbjct: 57 GVPPPLPPPPPPPPPPPPPPPP---PPPPPPPPPPSPPPPPPPPPPP 100 Score = 55.5 bits (132), Expect = 9e-06 Identities = 23/40 (57%), Positives = 26/40 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP PPPPPPPPPP + +P P+ Sbjct: 74 PPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSPL 113 [94][TOP] >UniRef100_UPI000194C22E PREDICTED: similar to formin 2 n=1 Tax=Taeniopygia guttata RepID=UPI000194C22E Length = 1673 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPPL PPPPPPL PPPPPPPPP+PG ++ PP Sbjct: 1092 PPPPPLRLPPPPPPLPGGGIPPPPPPPPPLPGAAVPPP 1129 [95][TOP] >UniRef100_UPI0000122FAC Hypothetical protein CBG05832 n=1 Tax=Caenorhabditis briggsae AF16 RepID=UPI0000122FAC Length = 208 Score = 63.9 bits (154), Expect = 2e-08 Identities = 38/79 (48%), Positives = 42/79 (53%), Gaps = 7/79 (8%) Frame = -3 Query: 301 CSLGDPLVLERPPP----PPLW*PPPP--PPLW*PPPPP-PPPPPPPVPGRSLDPPPMMA 143 CS+G P PPP PPL PPPP PP + PPPPP PPPPPPP P PPP M Sbjct: 23 CSMGPPPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPPCPPPPPPPPPPMCPPPPPPMY 82 Query: 142 STVLARREPGAESYLVSPV 86 S +SY +PV Sbjct: 83 SP--------CQSYAPAPV 93 [96][TOP] >UniRef100_B4YB55 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB55_BURPS Length = 369 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPPPP P + PPP Sbjct: 87 PPPPPSTTTPPPPP---PPPPPPPPPPPPPPSTTPSPPP 122 Score = 58.2 bits (139), Expect = 1e-06 Identities = 36/80 (45%), Positives = 41/80 (51%), Gaps = 7/80 (8%) Frame = -3 Query: 268 PPPPPLW*PPP----PPPLW*PPPPPPPPPPPPVPGRSLDP-PPMMASTVLARREPGAES 104 PPPPP PPP PPP PPPPPPPPPPPP P S P PP +T R P + Sbjct: 84 PPPPP---PPPSTTTPPP---PPPPPPPPPPPPPPPPSTTPSPPPPTTTPPTRTTPSTTT 137 Query: 103 YLVS--PVCSISSLSIPSTS 50 S P+ SIP+ + Sbjct: 138 PTPSMHPIQPTQLPSIPNAT 157 [97][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 98 PPPPP---PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP+ PPPPPP PPP PPPPPPPP P PPP Sbjct: 90 PPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 112 PPPPP---PPPPPPPSPPPPPPPPPPPPPNPPPPPPPPP 147 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPPPPPPP P + PPP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPPPP P S PPP Sbjct: 119 PPPPPSPPPPPPPP---PPPPPNPPPPPPPPPPSPSPPP 154 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 +PP PP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 78 QPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPP 117 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P PPP Sbjct: 89 PPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPP 127 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P +PPP Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPP 141 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPP 134 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPP PPPPPPPP P PPP Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PP P PPPPPP+ PPPPPPPPPPPP P PPP Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 E PPPPP PPPP P P P PPPPPPPPVP PPP Sbjct: 64 EHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPP 104 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPP PPP P PPP Sbjct: 88 PPPPPPPVPPPPPP---PPPPPPPPSPPPPPPPPPPPPP 123 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 111 PPPPP---PPPPPPPPSPPPPPPPPPPPP-PNPPPPPPP 145 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 113 PPPPP---PPPPPPSPPPPPPPPPPPPPNPPPPPPPPPP 148 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P V PPPPP PPP PP PPPPPPPP PPP P PPP Sbjct: 93 PPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPP P P S P P Sbjct: 125 PPPPP---PPPPPPPPNPPPPPPPPPPSPSPPPSPPPSP 160 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPP P P P PPP Sbjct: 127 PPPPP---PPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP 162 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -3 Query: 271 RPPP--PPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 RPPP PP P PPPP PP PPPP PPPP P L PPP Sbjct: 228 RPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPP 269 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP P PPP P P PPP Sbjct: 131 PPPPPPPNPPPPPP---PPPPSPSPPPSPPPSPPPSPPP 166 [98][TOP] >UniRef100_B9HGL7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HGL7_POPTR Length = 1486 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/48 (64%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVP---GRSLDPPP 152 PL PPPPP PPPPPPL PPPPPPPPPPP+P SL PPP Sbjct: 1196 PLPDGSPPPPPDS-PPPPPPLPSSPPPPPPPPPPPLPPQLSTSLSPPP 1242 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/50 (56%), Positives = 29/50 (58%), Gaps = 10/50 (20%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPP----------PPPPPPPPPVPGRSLDPPPM 149 PPPPPL PPPPP PPP PPPPPPPPP P S PPP+ Sbjct: 1210 PPPPPLPSSPPPPPPPPPPPLPPQLSTSLSPPPPPPPPPPPLPSQPPPPL 1259 [99][TOP] >UniRef100_A7YFB9 Glycine-rich protein n=1 Tax=Lilium formosanum RepID=A7YFB9_9LILI Length = 135 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/47 (70%), Positives = 33/47 (70%), Gaps = 7/47 (14%) Frame = +3 Query: 153 GGGSRLLPGTGG---GGGGGGGGGGYHNGGG----GGGYHNGGGGGR 272 GGG PG GG GGG GGGGGYHNGGG GGGYHNGGGGGR Sbjct: 54 GGGG--YPGGGGYHNGGGYQGGGGGYHNGGGYQGGGGGYHNGGGGGR 98 [100][TOP] >UniRef100_A4RZU2 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RZU2_OSTLU Length = 779 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/72 (50%), Positives = 38/72 (52%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYL 98 LE PPPP PPPPPP PPPPPPPPPPPP PG L M V PGA Sbjct: 337 LECAPPPP---PPPPPP---PPPPPPPPPPPPPPGFKLSSASM--PKVATPPAPGAPPPP 388 Query: 97 VSPVCSISSLSI 62 PV S+S+ Sbjct: 389 PPPVVQFRSVSL 400 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/60 (50%), Positives = 30/60 (50%), Gaps = 15/60 (25%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPP---------------PPVPGRSLDPPP 152 PL PPPPP PPPPPP PPPPPPPPPP PP PG PPP Sbjct: 336 PLECAPPPPPPP--PPPPPP---PPPPPPPPPPPGFKLSSASMPKVATPPAPGAPPPPPP 390 [101][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P ++ PPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPPPPPPPP P R P Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRPRP 119 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P P P Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRPRP 119 [102][TOP] >UniRef100_A8X1J0 C. briggsae CBR-GRL-4 protein n=1 Tax=Caenorhabditis briggsae RepID=A8X1J0_CAEBR Length = 217 Score = 63.9 bits (154), Expect = 2e-08 Identities = 38/79 (48%), Positives = 42/79 (53%), Gaps = 7/79 (8%) Frame = -3 Query: 301 CSLGDPLVLERPPP----PPLW*PPPP--PPLW*PPPPP-PPPPPPPVPGRSLDPPPMMA 143 CS+G P PPP PPL PPPP PP + PPPPP PPPPPPP P PPP M Sbjct: 23 CSMGPPPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPPCPPPPPPPPPPMCPPPPPPMY 82 Query: 142 STVLARREPGAESYLVSPV 86 S +SY +PV Sbjct: 83 SP--------CQSYAPAPV 93 [103][TOP] >UniRef100_A8MSW5 Putative uncharacterized protein TNRC18 n=1 Tax=Homo sapiens RepID=A8MSW5_HUMAN Length = 1308 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/53 (58%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = -3 Query: 301 CSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGR--SLDPPPM 149 C+L P RPPPPP PPPPPP PP PPPP PPPP+P R L PPP+ Sbjct: 1115 CTLPAPGRPHRPPPPPPHPPPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPL 1167 [104][TOP] >UniRef100_C9S8M2 Cytokinesis protein sepA n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S8M2_9PEZI Length = 842 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 7/46 (15%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL-------W*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP+ PPPPPPPPPPPP+PG PPP Sbjct: 189 PPPPPPPPPPPPPPMPGMLSPGGGPPPPPPPPPPPPMPGAPGMPPP 234 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 4/44 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL----W*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP+ PPPPPPPPPPPP P PPPM Sbjct: 166 PPPPP---PPPPPPMPGQGGAPPPPPPPPPPPPPPP---PPPPM 203 Score = 58.9 bits (141), Expect = 8e-07 Identities = 28/47 (59%), Positives = 30/47 (63%), Gaps = 8/47 (17%) Frame = -3 Query: 268 PPPPPL-----W*PPPPPPLW*PPPPPPPPPPPPVPGR---SLDPPP 152 PPPPP+ PPPPPP PPPPPPPPPPPP+PG PPP Sbjct: 172 PPPPPMPGQGGAPPPPPPP---PPPPPPPPPPPPMPGMLSPGGGPPP 215 [105][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA 143 P + PPPPP PPPPPP PPPPPPPPPPPP P S PP ++ Sbjct: 346 PPAAQAPPPPPP--PPPPPP---PPPPPPPPPPPPPPPASTKPPQALS 388 Score = 62.4 bits (150), Expect = 7e-08 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 RPP PP PPPPP PPPPPPPPPPPP P PPP AST Sbjct: 342 RPPQPPAAQAPPPPPPPPPPPPPPPPPPPPPP-----PPPPPAST 381 [106][TOP] >UniRef100_UPI0000E47171 PREDICTED: similar to conserved hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E47171 Length = 2383 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/57 (54%), Positives = 36/57 (63%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 +I+ P+S S+ P+V PPPPP PPPPPP PPPPPPPPP PG PPP Sbjct: 505 TIMPPSSLSIPSPIV---PPPPP---PPPPPPPGMGGGPPPPPPPPPGPGGIPPPPP 555 [107][TOP] >UniRef100_UPI0000DA1EB9 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1EB9 Length = 270 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/48 (64%), Positives = 31/48 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 GGG G GGGGGGGGGGGG GGGGGG GGGGGR R G R Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGRGRGRGR 217 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/56 (57%), Positives = 33/56 (58%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRI 320 GGG G GGGGGGGGGGGG GGGGGG GGGGG G R + G RI Sbjct: 164 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGRGRGRGRRI 219 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/48 (60%), Positives = 29/48 (60%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 GGG G GGGGGGGGGGGG GGGGGG GGGGG G R Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 209 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 192 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 152 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 182 [108][TOP] >UniRef100_UPI000069F105 Formin-like protein 3 (Formin homology 2 domain-containing protein 3). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069F105 Length = 1108 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/53 (54%), Positives = 32/53 (60%) Frame = -3 Query: 295 LGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 L P P PPP PPPPPP PPPPPPPPPPPP+P PPP + S+ Sbjct: 599 LPPPASASVPAPPP---PPPPPP---PPPPPPPPPPPPMPTGKCPPPPPLPSS 645 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 PPPP PPPPPP PPPPPPPPPPP G+ PPP+ +S+ Sbjct: 610 PPPP---PPPPPP---PPPPPPPPPPPMPTGKCPPPPPLPSSS 646 [109][TOP] >UniRef100_UPI0001B7A397 jumonji domain containing 3 n=1 Tax=Rattus norvegicus RepID=UPI0001B7A397 Length = 1638 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PP PL PPPPPP PPPPPPPPPPPP+PG ++ PP Sbjct: 241 PPGLPLPPPPPPPP---PPPPPPPPPPPPLPGLAISPP 275 [110][TOP] >UniRef100_Q4WDJ2 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus fumigatus RepID=Q4WDJ2_ASPFU Length = 1800 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/51 (56%), Positives = 33/51 (64%), Gaps = 6/51 (11%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPP---LW*PPPPPPPPPPPPVPGR---SLDPPP 152 P+ + PPPPP PPPPPP + PPPPPPPPPPPP PG + PPP Sbjct: 1019 PVSVPAPPPPPPPPPPPPPPGGAVGIPPPPPPPPPPPPPPGAKGLGVPPPP 1069 Score = 58.9 bits (141), Expect = 8e-07 Identities = 30/53 (56%), Positives = 30/53 (56%), Gaps = 14/53 (26%) Frame = -3 Query: 268 PPPPPLW*PPPPPP----LW*PPPPPP----------PPPPPPVPGRSLDPPP 152 PPPPP PPPPPP L PPPPPP PPPPPP PGR PPP Sbjct: 1045 PPPPPPPPPPPPPPGAKGLGVPPPPPPPPPPGFAGGMPPPPPPPPGRFGAPPP 1097 [111][TOP] >UniRef100_Q5NCY0 Lysine-specific demethylase 6B n=1 Tax=Mus musculus RepID=KDM6B_MOUSE Length = 1641 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PP PL PPPPPP PPPPPPPPPPPP+PG ++ PP Sbjct: 241 PPGLPLPPPPPPPP---PPPPPPPPPPPPLPGLAISPP 275 [112][TOP] >UniRef100_UPI00017466C4 RNA-binding protein (RRM domain) n=1 Tax=Verrucomicrobium spinosum DSM 4136 RepID=UPI00017466C4 Length = 158 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/48 (62%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Frame = +3 Query: 153 GGGSRLLPGTGGGG---GGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGG GGGGGGGGY GGGGGGY GGGGG G Sbjct: 84 GGGGGYKGGGGGGGYSGGGGGGGGGYKGGGGGGGYKGGGGGGGGYKGG 131 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 3/45 (6%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGG---GGGGGGYHNGGGGGGYHNGGGGGRSR 278 GGG G GGGGGG GGGGGGY GGGGGG + GGGGG R Sbjct: 93 GGGGGYSGGGGGGGGGYKGGGGGGGYKGGGGGGGGYKGGGGGGFR 137 [113][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/57 (56%), Positives = 33/57 (57%), Gaps = 12/57 (21%) Frame = -3 Query: 286 PLVLERPPPPPLW*---------PPPPPPLW*PPPPPPPPPPPPVPGRSL---DPPP 152 P LERPPPPP PPPPPP PPPPPPPPPPPP+PG PPP Sbjct: 412 PEPLERPPPPPAPPLPGPTTAPRPPPPPP---PPPPPPPPPPPPLPGMRAAFPSPPP 465 Score = 59.7 bits (143), Expect = 5e-07 Identities = 31/66 (46%), Positives = 35/66 (53%), Gaps = 13/66 (19%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPP----------PPPPPPPPVPGRSLD 161 P + L P RPPPPP PPPPPP PPPP PPPPPPPP+P ++ Sbjct: 421 PPAPPLPGPTTAPRPPPPPPPPPPPPPP---PPPPLPGMRAAFPSPPPPPPPPLPNSAIT 477 Query: 160 ---PPP 152 PPP Sbjct: 478 IPAPPP 483 [114][TOP] >UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia MC0-3 RepID=B1JXE0_BURCC Length = 505 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/45 (66%), Positives = 31/45 (68%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG PG GGGGGGGGGGGG NGGGGGG GGGGG +G Sbjct: 323 GGG----PGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGAG 363 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGG NGGGGGG H GGGG G+ Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGN 419 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GG GGGGGGGGG GGGGGG GGGGG G Sbjct: 356 GGGGGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGG 400 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/45 (60%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG+ G GGGGGGGGGGGG GGGGGG GG GG G Sbjct: 359 GGGAGGNGGNGGGGGGGGGGGGGGGGGGGGGGGGGGNGGNGGGGG 403 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGG NGGGGG +G Sbjct: 369 GGGG----GGGGGGGGGGGGGGGGGGGGGGNGGNGGGGGGGHGNG 409 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG+ G G GGGGGGGGGG NG GGGG GGGGG G+ Sbjct: 317 GGGNGNGGGPGNGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGGGA 362 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGG GG GGGGG +G GGGG+ NGGG G SG Sbjct: 382 GGGGGGGGGGGGGNGGNGGGGGGGHGNGGGGHGNGGGNGNGNGSG 426 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGG GG NGGGGGG GGGGG Sbjct: 344 GGGGGGGGGGGGGGGGGGAGGNGGNGGGGGGGGGGGGGG 382 [115][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP S PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/55 (54%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Frame = -3 Query: 301 CSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPP-----PPPPPPVPGRSLDPPP 152 CS P PPPPP PPPPPP PPPPPP PPPPPP P + PPP Sbjct: 374 CSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 58.9 bits (141), Expect = 8e-07 Identities = 31/69 (44%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPV-----PGRSLDPPPMMASTVLARREPGAES 104 PPPPP PPPPPP P PPPPPP PPP P + PPP V P + Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Query: 103 YLV-SPVCS 80 Y+ SP C+ Sbjct: 454 YMYPSPPCN 462 [116][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPPPP P S PPP Sbjct: 233 PPPPPPPSPPPPPP---PPPPPSPPPPPPPPSPSPPPPP 268 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P S PPP Sbjct: 210 PPPPPPSPPPPPPP---PPPPSPPPPPPPPPPPSPPPPP 245 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPPPPP P S PPP Sbjct: 222 PPPPPPSPPPPPPP---PPPPSPPPPPPPPPPPSPPPPP 257 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPPPPPPP P PPP Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPPPPPPP P PPP Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPP--PPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPP PPPP P S PPP Sbjct: 229 PPPPP---PPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/73 (41%), Positives = 36/73 (49%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPP P PPP P PPP + P + Sbjct: 241 PPPPP---PPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFVPGFFDCE 297 Query: 88 VCSISSLSIPSTS 50 +C + L+ P+ S Sbjct: 298 LCFAAELTPPTDS 310 Score = 60.1 bits (144), Expect = 4e-07 Identities = 27/50 (54%), Positives = 30/50 (60%) Frame = -3 Query: 301 CSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 C + +V +PPPPP PPP PP PPPPPP PPPPP P PPP Sbjct: 194 CCPQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPP P PPPPPP PPPPPPPPPP P P PPP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPP P PPPPPP PPPPPPP P PP P S PPP Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPP 275 [117][TOP] >UniRef100_C5XP48 Putative uncharacterized protein Sb03g005056 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XP48_SORBI Length = 109 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGG GGGGGGG + GGGGGGY GGGGGR G Sbjct: 31 GGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGGGGRGGGGG 75 Score = 60.1 bits (144), Expect = 4e-07 Identities = 31/53 (58%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGG-----GGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 G GS G GGGGGGGG GGGGY GGGGGGY GGGGG G R Sbjct: 18 GYGSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGGGGYGGGGGGGYGGGGGGGR 70 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GG GGGGGGGG GGGGGGY GGGGG Sbjct: 14 GGGGGYGSGGYGGRGGGGGGGGRGRGGGGGGYGGGGGGG 52 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGG GGGGGGGY GGGGGG GGGGG Sbjct: 40 GGGGGYGGGGGGGGYGGGGGGGY--GGGGGGGRGGGGGG 76 [118][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/40 (70%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PP-PPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPPL PP PPPPPPPPPP P +S PPP Sbjct: 45 PFPPPPSPPPPPPPLPPPPSPPPPPPPPPPPPSKSPPPPP 84 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPPL PP PPP PPPPPP PPP P + L PPP Sbjct: 54 PPPPPLPPPPSPPPPPPPPPPPPSKSPPPPPRKKLQPPP 92 [119][TOP] >UniRef100_A9TWA3 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TWA3_PHYPA Length = 2209 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPP P+ GR+ PPP Sbjct: 1583 PPPPPPPPPPPPPGRSAPPPPPPPPPPLPLGGRAAPPPP 1621 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/48 (60%), Positives = 29/48 (60%), Gaps = 9/48 (18%) Frame = -3 Query: 268 PPP----PPLW*PPPPPPLW*-----PPPPPPPPPPPPVPGRSLDPPP 152 PPP PP PPP PP PPPPPPPPPPPP PGRS PPP Sbjct: 1556 PPPGKSAPPRRPPPPLPPSLPGKSAPPPPPPPPPPPPPPPGRSAPPPP 1603 [120][TOP] >UniRef100_UPI0001553749 PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI0001553749 Length = 56 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVP 176 P L PPPPP PPPPPP PPPPPPPPPPPP+P Sbjct: 15 PPPLPPPPPPPRPPPPPPPPPPPPPPPPPPPPPPPLP 51 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = -3 Query: 262 PPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPL PPPPPP PPPPPPPPPPPP P PPP+ Sbjct: 15 PPPL--PPPPPPPRPPPPPPPPPPPPPPPPPPPPPPPL 50 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPPPPPPPPPPP P PPP Sbjct: 19 PPPPP---PPRPPP---PPPPPPPPPPPPPP-----PPP 46 [121][TOP] >UniRef100_UPI0000E4896A PREDICTED: similar to CG33556-PA n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4896A Length = 1472 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPPPPPP+PG S PPP Sbjct: 421 PPPPP---PPPLPPGVGAPPPPPPPPPPPLPGGSCIPPP 456 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/52 (55%), Positives = 30/52 (57%), Gaps = 12/52 (23%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL----W*PPPPPPP--------PPPPPVPGRSLDPPPM 149 PPPPP PPPPPPL PPPPPPP PPPPP PG PPP+ Sbjct: 436 PPPPP---PPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPL 484 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/61 (50%), Positives = 34/61 (55%), Gaps = 13/61 (21%) Frame = -3 Query: 295 LGDPLVLERPPPPPL----W*PPPPPPLW*----PPPPPPP-----PPPPPVPGRSLDPP 155 +G P PPPPPL PPPPPP PPPPPPP PPPPP+PG + PP Sbjct: 433 VGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPPP 492 Query: 154 P 152 P Sbjct: 493 P 493 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 6/44 (13%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPP------PPPPPPPVPGRSLDPPP 152 PPPP PPPP P PPPPP PPPPPPP PG + PPP Sbjct: 466 PPPP---PPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPP 506 [122][TOP] >UniRef100_UPI0000E23E7D PREDICTED: WAS protein homology region 2 domain containing 1 n=1 Tax=Pan troglodytes RepID=UPI0000E23E7D Length = 813 Score = 62.8 bits (151), Expect = 6e-08 Identities = 34/73 (46%), Positives = 39/73 (53%), Gaps = 6/73 (8%) Frame = -3 Query: 340 CLSCHVSILVPNSCSLGDPL------VLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPV 179 C +CH +I V +GD L PPPPP PPPPP PPPPPPPPPPPP Sbjct: 609 CQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPP----PPPPP---PPPPPPPPPPPPP 661 Query: 178 PGRSLDPPPMMAS 140 P R+L A+ Sbjct: 662 PLRALSSSSQAAT 674 [123][TOP] >UniRef100_UPI0000E1F761 PREDICTED: formin-like 2 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E1F761 Length = 1087 Score = 62.8 bits (151), Expect = 6e-08 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 3/84 (3%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG---RSLDPPPMMASTVLARREP 116 P+ PPPPP PPPPP PPPPPPPPPPPP+PG ++ PP+ A P Sbjct: 547 PVTPPMPPPPP----PPPPP---PPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 599 Query: 115 GAESYLVSPVCSISSLSIPSTSKS 44 G S V ++++ I K+ Sbjct: 600 GTSSPTVVFNSGLAAVKIKKPIKT 623 [124][TOP] >UniRef100_UPI0000E1F760 PREDICTED: formin-like 2 isoform 8 n=1 Tax=Pan troglodytes RepID=UPI0000E1F760 Length = 1093 Score = 62.8 bits (151), Expect = 6e-08 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 3/84 (3%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG---RSLDPPPMMASTVLARREP 116 P+ PPPPP PPPPP PPPPPPPPPPPP+PG ++ PP+ A P Sbjct: 547 PVTPPMPPPPP----PPPPP---PPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 599 Query: 115 GAESYLVSPVCSISSLSIPSTSKS 44 G S V ++++ I K+ Sbjct: 600 GTSSPTVVFNSGLAAVKIKKPIKT 623 [125][TOP] >UniRef100_UPI00016E98C1 UPI00016E98C1 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C1 Length = 557 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 ++ PP P PPPPPP PPPPPPPPPPPP+P R P M+A + A G ++ Sbjct: 426 KQTPPAP---PPPPPP---PPPPPPPPPPPPLPQREKKPTRMIAEVIKAHEASGKKT 476 [126][TOP] >UniRef100_UPI00016E98A2 UPI00016E98A2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98A2 Length = 540 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAES 104 ++ PP P PPPPPP PPPPPPPPPPPP+P R P M+A + A G ++ Sbjct: 409 KQTPPAP---PPPPPP---PPPPPPPPPPPPLPQREKKPTRMIAEVIKAHEASGKKT 459 [127][TOP] >UniRef100_UPI0001951234 Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein). n=1 Tax=Canis lupus familiaris RepID=UPI0001951234 Length = 1045 Score = 62.8 bits (151), Expect = 6e-08 Identities = 38/92 (41%), Positives = 48/92 (52%), Gaps = 4/92 (4%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPP----LW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA 143 P+S + P + PPPPP ++ PPPPPP PPPPPPPPPPPP P + PPP+ A Sbjct: 840 PSSIPVPSP---DFPPPPPESSLVFPPPPPPPP--PPPPPPPPPPPPAPAPA--PPPLTA 892 Query: 142 STVLARREPGAESYLVSPVCSISSLSIPSTSK 47 + ++ A SP S S P K Sbjct: 893 TPTVS----PASDKSGSPGKKTSKTSSPGAKK 920 [128][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLAR 125 PPPPP PPPPPP PPPPPPPPPPPP P PP ++A+ R Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-----PPDVLAADAFDR 694 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = -3 Query: 298 SLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLD 161 S+G P PPPPP PPPPPP PPPPPPPPPP + + D Sbjct: 648 SVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAFD 693 [129][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 62.8 bits (151), Expect = 6e-08 Identities = 36/76 (47%), Positives = 44/76 (57%), Gaps = 4/76 (5%) Frame = -3 Query: 268 PPPPPLW*PPPPPP--LW*PPPPPPPP--PPPPVPGRSLDPPPMMASTVLARREPGAESY 101 PPPPP+ PPPPPP + PPPPPPPP PPPP P S PPP V+ +P Sbjct: 1269 PPPPPVSPPPPPPPPPVSPPPPPPPPPVSPPPPPPPVSPPPPPPPPPPVI--EDPAVNET 1326 Query: 100 LVSPVCSISSLSIPST 53 + + +I+S SI ST Sbjct: 1327 VTTETTNITS-SIQST 1341 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 4/42 (9%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPP----PPPPPPVPGRSLDPPP 152 PPPP PPPPPP+ PPPPPP PPPPPP P S PPP Sbjct: 1264 PPPP---PPPPPPVSPPPPPPPPPVSPPPPPPPPPVSPPPPP 1302 [130][TOP] >UniRef100_A5GHM5 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. WH 7803 RepID=A5GHM5_SYNPW Length = 207 Score = 62.8 bits (151), Expect = 6e-08 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 6/70 (8%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGG---GGGGYHNGGGGGGYHNGG---GGGRSRTSGSPRLQEFGT 314 GGG G GGGGGGGG GGGGY++GGGGGGY GG GGG R SG+ Sbjct: 87 GGG-----GYGGGGGGGGYRGGGGGYNDGGGGGGYRGGGGGYGGGGERRSGA-------- 133 Query: 315 RILTWQDRQY 344 W+DR Y Sbjct: 134 --RGWEDRSY 141 [131][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPP P PPP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 466 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPP P S PPP Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 331 PPPPPPSPPPPPPPS--PPPPPPPSPPPPSPPPPSPPPP 367 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 375 PPPPPPSPPPPPPPS--PPPPPPPSPPPPSPPPPSPPPP 411 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 445 PPPPPPSPPPPPPPS--PPPPPPPSPPPPSPPPPSPPPP 481 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 489 PPPPPPSPPPPPPPS--PPPPPPPSPPPPSPPPPSPPPP 525 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPPP P PPP Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPPPPP PPPPP P PPP Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 295 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPP P P PPP Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 377 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 383 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPPPP PPPPP P PPP Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 491 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 497 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 535 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPP PPPP P PPP Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPP PPPP P PPP Sbjct: 256 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPP PPPP P PPP Sbjct: 290 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPPPPP PPPP P S PPP Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 277 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPP PPPP PPP P S PP Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPP PPPP P S PP Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPP PPPP PPP P S PPP Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPP PPPP P S PP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPP PPPP P S PP Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 481 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPP PPPP PPP P S PPP Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPP PPPP P S PP Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPP PPPP PPP P S PPP Sbjct: 247 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPP PP P PPP Sbjct: 282 PPPPPPSPPPPPPPS--PPPPSPPPPSPPPPPPPSPPPP 318 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPPPPPP PPP P S PPP Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPPPP PPPPPP P PPP Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPP PPPPPP PPPPP P PPP Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 352 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPPPP PPPPPP P PPP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 362 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPP PPPPPP PPPPP P PPP Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 396 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPPPP PPPPPP P PPP Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 406 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPP PPPPPP PPPPP P PPP Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 450 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPP PPPPPP PPPPP P PPP Sbjct: 473 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 510 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPPPP PPPPPP P PPP Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 520 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PP PPPP PPPP P PPP Sbjct: 248 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPP PPPP PPP P S PPP Sbjct: 307 PPPPP---PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPP PPPP PP P PPP Sbjct: 505 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPP PPPPPPP P PPP Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 313 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPP PPPP PP P PPP Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 357 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPP PPPP PP P PPP Sbjct: 461 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 471 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPP PPPPPPP P PPP Sbjct: 515 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 520 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/42 (61%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPP---PPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPP PPPPP PPP P S PPP Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPP PPPPPP PPPP P S PPP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 259 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPP PPP PPPP PPP P S PPP Sbjct: 403 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 [132][TOP] >UniRef100_C5Z660 Putative uncharacterized protein Sb10g024410 n=1 Tax=Sorghum bicolor RepID=C5Z660_SORBI Length = 260 Score = 62.8 bits (151), Expect = 6e-08 Identities = 35/68 (51%), Positives = 36/68 (52%), Gaps = 2/68 (2%) Frame = +3 Query: 114 PGSLLASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHN--GGGGGGYHNGGGGGRSRTSG 287 PG T A G PG GGGGGGGGGGGG N GGGGGG GGGG SG Sbjct: 132 PGGGTPGTPGAAGTPGPPGCPGGGGGGGGGGGGGGGSNGDGGGGGGGFGGGGGSAGSPSG 191 Query: 288 SPRLQEFG 311 SP + G Sbjct: 192 SPSSPDHG 199 [133][TOP] >UniRef100_Q95UX2 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX2_DROVI Length = 165 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/38 (73%), Positives = 28/38 (73%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 G GGGGGGGGGGGG GGGGGG GGGGGR R GS Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGS 104 Score = 55.8 bits (133), Expect = 7e-06 Identities = 29/50 (58%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGY-----HNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG + SG Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 116 [134][TOP] >UniRef100_Q7YYP5 Hydroxyproline-rich glycoprotein dz-hrgp, probable n=1 Tax=Cryptosporidium parvum RepID=Q7YYP5_CRYPV Length = 203 Score = 62.8 bits (151), Expect = 6e-08 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 9/70 (12%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW------*PPPPPPPPPPPPVPG---RSLDPPPMMASTVLARREP 116 PPPPP PPPPPPL PPPPPPPPPPPP+P +L PPP + + P Sbjct: 79 PPPPP---PPPPPPLQAPSNEDFPPPPPPPPPPPPLPSPPPPTLPPPPSLPPYPV----P 131 Query: 115 GAESYLVSPV 86 G++S + P+ Sbjct: 132 GSQSSMPMPM 141 [135][TOP] >UniRef100_Q5CWS3 Putative uncharacterized protein (Fragment) n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CWS3_CRYPV Length = 296 Score = 62.8 bits (151), Expect = 6e-08 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 9/70 (12%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW------*PPPPPPPPPPPPVPG---RSLDPPPMMASTVLARREP 116 PPPPP PPPPPPL PPPPPPPPPPPP+P +L PPP + + P Sbjct: 172 PPPPP---PPPPPPLQAPSNEDFPPPPPPPPPPPPLPSPPPPTLPPPPSLPPYPV----P 224 Query: 115 GAESYLVSPV 86 G++S + P+ Sbjct: 225 GSQSSMPMPM 234 [136][TOP] >UniRef100_B4M1S7 NonA n=1 Tax=Drosophila virilis RepID=B4M1S7_DROVI Length = 699 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/38 (73%), Positives = 28/38 (73%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 G GGGGGGGGGGGG GGGGGG GGGGGR R GS Sbjct: 196 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGS 233 Score = 55.8 bits (133), Expect = 7e-06 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 6/51 (11%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHN------GGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG + GGGGG + SG Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGSRGGGGGGGQNSG 245 [137][TOP] >UniRef100_A5JUU8 Formin B n=2 Tax=Trypanosoma brucei RepID=A5JUU8_9TRYP Length = 1004 Score = 62.8 bits (151), Expect = 6e-08 Identities = 29/49 (59%), Positives = 32/49 (65%), Gaps = 7/49 (14%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPP---LW*PPPPPPP----PPPPPVPGRSLDPPP 152 L PPPPP+ PPPPPP PPPPPPP PPPPP PG++ PPP Sbjct: 477 LPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPP 525 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/50 (58%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -3 Query: 286 PLVLERPPPPP---LW*PPPPPP--LW*PPPPPPPPPPPPVPGRSLDPPP 152 P+ L PPPPP L PPPPPP PPPPPP PPP PG L PPP Sbjct: 484 PVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPP 533 [138][TOP] >UniRef100_UPI000175F433 PREDICTED: similar to formin-like 1 n=1 Tax=Danio rerio RepID=UPI000175F433 Length = 1102 Score = 62.4 bits (150), Expect = 7e-08 Identities = 33/70 (47%), Positives = 36/70 (51%), Gaps = 13/70 (18%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPP-------LW*PPPPPPLW*PPPP------PPPPPPPP 182 ++ VP+S S P PPPPP PPPPPP PPPP PPPPPPPP Sbjct: 560 TVTVPDSASQAPPSPAAAPPPPPPPPPLPGAEAPPPPPP---PPPPSGSGGAPPPPPPPP 616 Query: 181 VPGRSLDPPP 152 PG PPP Sbjct: 617 PPGGGPPPPP 626 [139][TOP] >UniRef100_UPI0000E1F767 PREDICTED: formin-like 2 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F767 Length = 994 Score = 62.4 bits (150), Expect = 7e-08 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 3/84 (3%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG---RSLDPPPMMASTVLARREP 116 P+V PP P PPPPPP PPPPPPPPPPPP+PG ++ PP+ A P Sbjct: 444 PVVASVTPPMPPPPPPPPPP---PPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 500 Query: 115 GAESYLVSPVCSISSLSIPSTSKS 44 G S V ++++ I K+ Sbjct: 501 GTSSPTVVFNSGLAAVKIKKPIKT 524 [140][TOP] >UniRef100_UPI0000E1F766 PREDICTED: formin-like 2 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E1F766 Length = 1026 Score = 62.4 bits (150), Expect = 7e-08 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 3/84 (3%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG---RSLDPPPMMASTVLARREP 116 P+V PP P PPPPPP PPPPPPPPPPPP+PG ++ PP+ A P Sbjct: 495 PVVASVTPPMPPPPPPPPPP---PPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 551 Query: 115 GAESYLVSPVCSISSLSIPSTSKS 44 G S V ++++ I K+ Sbjct: 552 GTSSPTVVFNSGLAAVKIKKPIKT 575 [141][TOP] >UniRef100_UPI0000E1F765 PREDICTED: formin-like 2 isoform 7 n=1 Tax=Pan troglodytes RepID=UPI0000E1F765 Length = 1045 Score = 62.4 bits (150), Expect = 7e-08 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 3/84 (3%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG---RSLDPPPMMASTVLARREP 116 P+V PP P PPPPPP PPPPPPPPPPPP+PG ++ PP+ A P Sbjct: 495 PVVASVTPPMPPPPPPPPPP---PPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 551 Query: 115 GAESYLVSPVCSISSLSIPSTSKS 44 G S V ++++ I K+ Sbjct: 552 GTSSPTVVFNSGLAAVKIKKPIKT 575 [142][TOP] >UniRef100_UPI0000E1F763 PREDICTED: formin-like 2 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F763 Length = 1037 Score = 62.4 bits (150), Expect = 7e-08 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 3/84 (3%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG---RSLDPPPMMASTVLARREP 116 P+V PP P PPPPPP PPPPPPPPPPPP+PG ++ PP+ A P Sbjct: 495 PVVASVTPPMPPPPPPPPPP---PPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLP 551 Query: 115 GAESYLVSPVCSISSLSIPSTSKS 44 G S V ++++ I K+ Sbjct: 552 GTSSPTVVFNSGLAAVKIKKPIKT 575 [143][TOP] >UniRef100_UPI0000D9E82E PREDICTED: similar to additional sex combs like 1 isoform 4 n=1 Tax=Macaca mulatta RepID=UPI0000D9E82E Length = 2250 Score = 62.4 bits (150), Expect = 7e-08 Identities = 31/52 (59%), Positives = 34/52 (65%), Gaps = 5/52 (9%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPP-PPPVPGRSL--DP--PPMMAST 137 L PPPPP PPPPPPL PPPPPPPPP PPP+P + DP PP+ T Sbjct: 2014 LVHPPPPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVPSDPKQPPVTMET 2065 [144][TOP] >UniRef100_UPI0000D9E82D PREDICTED: similar to additional sex combs like 1 isoform 2 n=3 Tax=Macaca mulatta RepID=UPI0000D9E82D Length = 2249 Score = 62.4 bits (150), Expect = 7e-08 Identities = 31/52 (59%), Positives = 34/52 (65%), Gaps = 5/52 (9%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPP-PPPVPGRSL--DP--PPMMAST 137 L PPPPP PPPPPPL PPPPPPPPP PPP+P + DP PP+ T Sbjct: 2013 LVHPPPPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVPSDPKQPPVTMET 2064 [145][TOP] >UniRef100_UPI0000547F81 PREDICTED: formin 1 n=1 Tax=Danio rerio RepID=UPI0000547F81 Length = 1741 Score = 62.4 bits (150), Expect = 7e-08 Identities = 29/61 (47%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = -3 Query: 313 VPNSCSLGDPLV------LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 +P C+ PL + PPPPP PPPPPP+ PPPPPPPPP+ G L PPP Sbjct: 1177 LPGPCTPNIPLAQPPNKHVNVPPPPP---PPPPPPMTGSGLPPPPPPPPPMTGSGLPPPP 1233 Query: 151 M 149 + Sbjct: 1234 L 1234 [146][TOP] >UniRef100_UPI0001A2D69A UPI0001A2D69A related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D69A Length = 1058 Score = 62.4 bits (150), Expect = 7e-08 Identities = 33/70 (47%), Positives = 36/70 (51%), Gaps = 13/70 (18%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPP-------LW*PPPPPPLW*PPPP------PPPPPPPP 182 ++ VP+S S P PPPPP PPPPPP PPPP PPPPPPPP Sbjct: 507 TVTVPDSASQAPPSPAAAPPPPPPPPPLPGAEAPPPPPP---PPPPSGSGGAPPPPPPPP 563 Query: 181 VPGRSLDPPP 152 PG PPP Sbjct: 564 PPGGGPPPPP 573 [147][TOP] >UniRef100_UPI0001A2CA84 UPI0001A2CA84 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2CA84 Length = 1101 Score = 62.4 bits (150), Expect = 7e-08 Identities = 39/88 (44%), Positives = 45/88 (51%), Gaps = 4/88 (4%) Frame = -3 Query: 292 GDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG----RSLDPPPMMASTVLAR 125 G PL+ PPPP PPPPPPL PPPPPPPP PP+P S PPP S + Sbjct: 553 GSPLLF---PPPP---PPPPPPLLHPPPPPPPPLLPPLPPSFAFSSPPPPPPPPSFGCPQ 606 Query: 124 REPGAESYLVSPVCSISSLSIPSTSKSI 41 PGA SP + SIP S+ + Sbjct: 607 PPPGAPPSTTSP----QTKSIPQPSQPL 630 [148][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPP PPPPPPPP P PPP Sbjct: 1935 PPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPP 1973 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/42 (61%), Positives = 26/42 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMA 143 PPPPP PPPPPP PPP PPPPPPP P PPP A Sbjct: 1934 PPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSA 1975 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/49 (55%), Positives = 28/49 (57%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSL 164 P S + L L P PL PPPPP PPPPPPPPPPPP P SL Sbjct: 3043 PTSATSSPALSLSSAPSKPLLQTPPPPPPPPPPPPPPPPPPPPPPSSSL 3091 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/41 (63%), Positives = 26/41 (63%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 E PPPPP PPPPPP PPPPPP P PPP P PPP Sbjct: 1930 ETPPPPP---PPPPPP---PPPPPPTPAPPPTPPPPPPPPP 1964 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP P PPP PPPPPP P PPP Sbjct: 1933 PPPPPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPP 1971 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = -3 Query: 268 PPPPPLW*PPPP---PPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPP PP PPPPPPPPPPPP P PP Sbjct: 1937 PPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPSAPP 1977 [149][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 62.4 bits (150), Expect = 7e-08 Identities = 27/44 (61%), Positives = 29/44 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 PPPPP PPPPPP PPPPPPPPPPPP P P ++A T Sbjct: 470 PPPPPPPPPPPPPP---PPPPPPPPPPPPPPPVETSPKIVLAGT 510 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/41 (63%), Positives = 27/41 (65%) Frame = -3 Query: 262 PPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPP PPPPPP PPPPPPPPPPPP P PPP+ S Sbjct: 468 PPP---PPPPPP---PPPPPPPPPPPPPPPPPPPPPPVETS 502 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPP 182 PPPPP PPPPPP PPPPPPPPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/57 (45%), Positives = 33/57 (57%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLV 95 PPPP PPPPPP PPPPPPPPPPPP P PP + ++ +S+++ Sbjct: 468 PPPP---PPPPPP---PPPPPPPPPPPPPPPPPPPPPVETSPKIVLAGTTANDSFIL 518 [150][TOP] >UniRef100_B4YB56 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB56_BURPS Length = 374 Score = 62.4 bits (150), Expect = 7e-08 Identities = 27/53 (50%), Positives = 33/53 (62%) Frame = -3 Query: 295 LGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 +GD + + PPPP PPPP PPPPPPPPPPPP P + PPP ++T Sbjct: 74 VGDRTLPNKVPPPP----PPPPSTTTPPPPPPPPPPPPPPSTTPPPPPPPSTT 122 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/41 (60%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPP PPPPP P + PPP Sbjct: 87 PPPPPSTTTPPPPPPPPPPPPPPSTTPPPPPPPSTTPSPPP 127 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/75 (40%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVS- 92 PPPP PPPPPP PPPPP PPPP P + PP +T R P + S Sbjct: 88 PPPPSTTTPPPPPPPPPPPPPPSTTPPPPPPPSTTPSPPPPTTTPPTRTTPSTTTPTPSM 147 Query: 91 -PVCSISSLSIPSTS 50 P+ SIP+ + Sbjct: 148 HPIQPTQLPSIPNAT 162 [151][TOP] >UniRef100_A4CWS8 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 7805 RepID=A4CWS8_SYNPV Length = 197 Score = 62.4 bits (150), Expect = 7e-08 Identities = 33/64 (51%), Positives = 35/64 (54%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRILTWQ 332 GGG G GGGG GGGGGGGY GGGGGGY GGGG G E + W+ Sbjct: 87 GGGGGGYGGGGGGGYGGGGGGGY-GGGGGGGYRGGGGGYNDGGGGYGGGGERRSGARGWE 145 Query: 333 DRQY 344 DR Y Sbjct: 146 DRSY 149 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/33 (75%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = +3 Query: 174 PGTGGGGGG-GGGGGGYHNGGGGGGYHNGGGGG 269 P GGGGGG GGGGGG + GGGGGGY GGGGG Sbjct: 84 PRRGGGGGGYGGGGGGGYGGGGGGGYGGGGGGG 116 [152][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP P PPP Sbjct: 227 PPPPP---PPPPPPS--PPPPPPPPPPPSPPPPPSPPPP 260 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPPPPPPPPP P PPP Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/47 (57%), Positives = 28/47 (59%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLA 128 PPPPP PPPPPP PPPP PPPPP P P PPP + S A Sbjct: 232 PPPPPPSPPPPPPP---PPPPSPPPPPSPPPPSPPLPPPSIPSPPFA 275 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPP P PPPPPP PPPPPPPPPP P P S PP Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP P P PP PPPP PPPPPPP P S PPP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PP PPP PPPPPPPP PPP P PP+ Sbjct: 228 PPPPPPPPPPSPPP---PPPPPPPPSPPPPPSPPPPSPPL 264 [153][TOP] >UniRef100_C4IYG5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4IYG5_MAIZE Length = 678 Score = 62.4 bits (150), Expect = 7e-08 Identities = 37/81 (45%), Positives = 44/81 (54%), Gaps = 5/81 (6%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPP-----PPPPPVPGRSLDPPPMMASTVLARREPGAES 104 PPPPPL PP PPP+ PPPPPPP PPPPP P PPP A LA + Sbjct: 382 PPPPPL--PPSPPPVTPPPPPPPPLSPASPPPPPPPPLPSGPPPQPAPPPLATQ------ 433 Query: 103 YLVSPVCSISSLSIPSTSKSI 41 V+P+ SI +PS+ S+ Sbjct: 434 --VTPLPSIPP-PVPSSPPSL 451 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 4/63 (6%) Frame = -3 Query: 328 HVSILVPNSCSLGD----PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLD 161 H SI P S D P + + PPP P PPPPPPL PPP PPPPPP P Sbjct: 349 HDSIQDPGSEQAIDQNDFPSLPDGPPPLPSDSPPPPPPLPPSPPPVTPPPPPPPPLSPAS 408 Query: 160 PPP 152 PPP Sbjct: 409 PPP 411 [154][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPL--W*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPP PL PPPPPP PPPPPPPPPPPP P S PPP Sbjct: 250 PPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPP 290 Score = 59.7 bits (143), Expect = 5e-07 Identities = 30/59 (50%), Positives = 31/59 (52%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGA 110 PL PPPPP PPPPPP PPPPPPPPPP P P PP + R P A Sbjct: 254 PLPPSPPPPPPPSPPPPPPPP--PPPPPPPPPPSPSPPPPELPPAQPVTPARKRPPPPA 310 [155][TOP] >UniRef100_B7QMB8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QMB8_IXOSC Length = 89 Score = 62.4 bits (150), Expect = 7e-08 Identities = 33/59 (55%), Positives = 34/59 (57%) Frame = +3 Query: 129 ASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQE 305 A+T I G SR G GGGGGGGGGGGG GGGGGG GGGGG G L E Sbjct: 20 ATTFSECISGTSRRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGLIE 78 [156][TOP] >UniRef100_B7PDJ8 SGRP-1, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ8_IXOSC Length = 166 Score = 62.4 bits (150), Expect = 7e-08 Identities = 32/67 (47%), Positives = 39/67 (58%) Frame = +3 Query: 69 KLDIEQTGLTRYDSAPGSLLASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGY 248 K +E+ G+ + + L T+ A+ GG G GGGGGGGGGGGG GGGGGG Sbjct: 71 KTFVEEIGMVNECNIQKNSLPRTLPAMTRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 130 Query: 249 HNGGGGG 269 GGGGG Sbjct: 131 GGGGGGG 137 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 108 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 109 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 148 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 149 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 150 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 151 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 152 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 153 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 154 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 155 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 156 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 120 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 121 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 128 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 [157][TOP] >UniRef100_B4R7C9 GD16486 n=1 Tax=Drosophila simulans RepID=B4R7C9_DROSI Length = 197 Score = 62.4 bits (150), Expect = 7e-08 Identities = 29/57 (50%), Positives = 37/57 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRIL 323 GGG G GGGGG GGGGGG+ +GGGGGG+ +GGGGG + G GT+++ Sbjct: 113 GGGHGGGGGHGGGGGHGGGGGGWSSGGGGGGWSSGGGGGHGSSGGG------GTKVI 163 [158][TOP] >UniRef100_B4I348 GM18116 n=1 Tax=Drosophila sechellia RepID=B4I348_DROSE Length = 1519 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P + PPPPP PPPPP PPPPPPPPPPPP+ PPP Sbjct: 942 PHAVAPPPPPP---PPPPPAFDAPPPPPPPPPPPPLANYGAPPPP 983 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 7/46 (15%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPP-------PPPPPPPPVPGRSLDPPP 152 PPPPP + PPPPP PPPP PPPPPPPP G + PPP Sbjct: 953 PPPPPAFDAPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 998 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/61 (49%), Positives = 31/61 (50%), Gaps = 14/61 (22%) Frame = -3 Query: 292 GDPLVLERPPPPPLW*PPPPPPLW*---PPPPPP-----------PPPPPPVPGRSLDPP 155 GD PPPPP PPPPPP + PPPPPP PPPPPP PG PP Sbjct: 939 GDKPHAVAPPPPP---PPPPPPAFDAPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 995 Query: 154 P 152 P Sbjct: 996 P 996 [159][TOP] >UniRef100_B3MV25 GF22854 n=1 Tax=Drosophila ananassae RepID=B3MV25_DROAN Length = 587 Score = 62.4 bits (150), Expect = 7e-08 Identities = 28/43 (65%), Positives = 30/43 (69%) Frame = +3 Query: 141 DAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 + I+GGG R G GGGGGGG GGGG GGGGGG GGGGG Sbjct: 74 NGIVGGGGRRRRGRGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 116 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/42 (69%), Positives = 29/42 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSR 278 GGG R G GGGGGGGGGGGG GGGGGG GGG GR R Sbjct: 91 GGGGR---GGGGGGGGGGGGGGGGGGGGGGGGGGGGGFGRGR 129 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/54 (55%), Positives = 31/54 (57%), Gaps = 8/54 (14%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGG--------YHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG GGGGGR R + S Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGFGRGRRNRRGGGGGGGGGGGGGGGRGRQNSS 155 [160][TOP] >UniRef100_C5FCB8 Epstein-Barr nuclear antigen 2 n=1 Tax=Microsporum canis CBS 113480 RepID=C5FCB8_NANOT Length = 951 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = -3 Query: 262 PPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAS 140 PPP+ PPPPPP PPPPPPPPPPPP+ + L P P AS Sbjct: 416 PPPVGAPPPPPPP--PPPPPPPPPPPPIQQQELPPAPTQAS 454 [161][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 62.4 bits (150), Expect = 7e-08 Identities = 26/41 (63%), Positives = 29/41 (70%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPP--LW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP + PPPPPPPPPPPP G+ + PP Sbjct: 1027 PPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPGGKGMGVPP 1067 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/63 (46%), Positives = 33/63 (52%), Gaps = 10/63 (15%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPP----LW*PPPPPPLW*PP------PPPPPPPPPPVPGRSLD 161 P + + P PPPPP + PPPPPP PP PPPPPPPPPP G + Sbjct: 1040 PGAIGVPPPPPPPPPPPPPGGKGMGVPPPPPPPPPPPGFGGGMPPPPPPPPPPGFGGGMP 1099 Query: 160 PPP 152 PPP Sbjct: 1100 PPP 1102 [162][TOP] >UniRef100_UPI000186A01D hypothetical protein BRAFLDRAFT_106142 n=1 Tax=Branchiostoma floridae RepID=UPI000186A01D Length = 550 Score = 62.0 bits (149), Expect = 9e-08 Identities = 30/45 (66%), Positives = 30/45 (66%), Gaps = 6/45 (13%) Frame = -3 Query: 268 PP--PPPLW*PPPPPPLW*PPP----PPPPPPPPPVPGRSLDPPP 152 PP PPPL PP PPPL PPP PPPPPPPPP P SL PPP Sbjct: 92 PPYLPPPLANPPSPPPLPTPPPYPPPPPPPPPPPPPPPNSLPPPP 136 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPP---PPVPGRSLDPPP 152 P + P PPPL PPP PP PPPPPPPPPP PP P +S P P Sbjct: 97 PPLANPPSPPPLPTPPPYPPPPPPPPPPPPPPPNSLPPPPPQSKPPYP 144 [163][TOP] >UniRef100_UPI00017600E2 PREDICTED: im:7158925 n=1 Tax=Danio rerio RepID=UPI00017600E2 Length = 1418 Score = 62.0 bits (149), Expect = 9e-08 Identities = 34/70 (48%), Positives = 39/70 (55%), Gaps = 16/70 (22%) Frame = -3 Query: 313 VPNSCSLGDPLVL---ERPPPPP----LW*PPPPPPL---W*PPPPPP------PPPPPP 182 +P C++ P L PPPPP L PPPPPPL PPPPPP PPPPPP Sbjct: 853 LPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPP 912 Query: 181 VPGRSLDPPP 152 +PG + PPP Sbjct: 913 LPGMGVPPPP 922 Score = 58.9 bits (141), Expect = 8e-07 Identities = 32/62 (51%), Positives = 33/62 (53%), Gaps = 23/62 (37%) Frame = -3 Query: 268 PPPPPL---W*PPPPPPL-------------W*PPPPPPP-------PPPPPVPGRSLDP 158 PPPPPL PPPPPPL PPPPPPP PPPPP+PG SL P Sbjct: 813 PPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPP 872 Query: 157 PP 152 PP Sbjct: 873 PP 874 [164][TOP] >UniRef100_UPI0001552F36 PREDICTED: similar to SH3 domain binding protein n=1 Tax=Mus musculus RepID=UPI0001552F36 Length = 455 Score = 62.0 bits (149), Expect = 9e-08 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPPL PPPPP PPPPPPP P S D P + Sbjct: 7 PPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSL 49 [165][TOP] >UniRef100_UPI0001552DAA PREDICTED: similar to CR16 n=1 Tax=Mus musculus RepID=UPI0001552DAA Length = 483 Score = 62.0 bits (149), Expect = 9e-08 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPPL PPPPP PPPPPPP P S D P + Sbjct: 7 PPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSL 49 [166][TOP] >UniRef100_UPI0000DD90BE Os04g0438100 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD90BE Length = 200 Score = 62.0 bits (149), Expect = 9e-08 Identities = 30/56 (53%), Positives = 34/56 (60%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRI 320 GGG G GGGGGGGGGGGG GGGGGG GGGGG+ GS R + + + Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQCGGGGSTRQNDTNSEL 174 Score = 60.1 bits (144), Expect = 4e-07 Identities = 29/55 (52%), Positives = 33/55 (60%) Frame = +3 Query: 105 DSAPGSLLASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 +S+P + + GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 94 NSSPAIGTTTITTMLFGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 148 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG + G Sbjct: 117 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQCGG 161 Score = 58.5 bits (140), Expect = 1e-06 Identities = 33/67 (49%), Positives = 34/67 (50%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRILTWQ 332 GGG G GGGGGGGGGGGG GGGGGG GGGGG G Q L Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQCGGGGSTRQNDTNSELPLA 177 Query: 333 DRQYIRF 353 R I+F Sbjct: 178 IRAQIQF 184 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 149 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 150 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 151 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 152 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 115 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 153 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 154 [167][TOP] >UniRef100_UPI0000DA3CD5 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA3CD5 Length = 311 Score = 62.0 bits (149), Expect = 9e-08 Identities = 30/45 (66%), Positives = 30/45 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGGRS G Sbjct: 193 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGG 237 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG R+ G Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGG 235 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGR 272 GGG G GGGGGGGGGGGG GGGGGG +GGGGGR Sbjct: 200 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGR 239 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +3 Query: 150 IGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 I G S +PG GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 168 IKGCSVRVPGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG SG Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSG 234 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/48 (60%), Positives = 29/48 (60%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 GGG G GGGGGGGGGGGG GGGGGG GGGGG G R Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 232 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/48 (60%), Positives = 29/48 (60%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 GGG G GGGGGGGGGGGG GGGGGG GGGGG G R Sbjct: 192 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGR 239 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 217 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 218 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 219 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 222 [168][TOP] >UniRef100_UPI0001A2C389 UPI0001A2C389 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2C389 Length = 1405 Score = 62.0 bits (149), Expect = 9e-08 Identities = 34/70 (48%), Positives = 39/70 (55%), Gaps = 16/70 (22%) Frame = -3 Query: 313 VPNSCSLGDPLVL---ERPPPPP----LW*PPPPPPL---W*PPPPPP------PPPPPP 182 +P C++ P L PPPPP L PPPPPPL PPPPPP PPPPPP Sbjct: 862 LPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPP 921 Query: 181 VPGRSLDPPP 152 +PG + PPP Sbjct: 922 LPGMGVPPPP 931 Score = 58.9 bits (141), Expect = 8e-07 Identities = 32/62 (51%), Positives = 33/62 (53%), Gaps = 23/62 (37%) Frame = -3 Query: 268 PPPPPL---W*PPPPPPL-------------W*PPPPPPP-------PPPPPVPGRSLDP 158 PPPPPL PPPPPPL PPPPPPP PPPPP+PG SL P Sbjct: 822 PPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPP 881 Query: 157 PP 152 PP Sbjct: 882 PP 883 [169][TOP] >UniRef100_Q3MC83 Putative uncharacterized protein n=1 Tax=Anabaena variabilis ATCC 29413 RepID=Q3MC83_ANAVT Length = 387 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPP P PPP Sbjct: 325 PPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPP 363 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPP P PPP Sbjct: 333 PPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPP 371 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPP P PPP Sbjct: 341 PPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPP 379 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPP P PPP Sbjct: 349 PPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPP 387 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/47 (59%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = -3 Query: 289 DPLVLERP-PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 DP + + P PPPP PPPPPP PPPPPP PPPPP P PPP Sbjct: 309 DPPLPDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPP 355 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPPP P P DPPP Sbjct: 318 PPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 359 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPPP P P DPPP Sbjct: 334 PPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 375 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/42 (64%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPP PPPPP P P DPPP Sbjct: 342 PPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPP 383 [170][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 62.0 bits (149), Expect = 9e-08 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLAR 125 PPPPP PPPPPP PPPPPPPPPPPP P PP + L++ Sbjct: 234 PPPPP---PPPPPP---PPPPPPPPPPPPPPPEETTPPLAQQCSALSQ 275 [171][TOP] >UniRef100_A9C2F8 Putative uncharacterized protein n=1 Tax=Delftia acidovorans SPH-1 RepID=A9C2F8_DELAS Length = 365 Score = 62.0 bits (149), Expect = 9e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +3 Query: 174 PGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 PG GGGG GGGG GGY+ GGGGGGY GGGGG Sbjct: 246 PGLGGGGAGGGGAGGYNAGGGGGGYGGGGGGG 277 [172][TOP] >UniRef100_A3Q1Z8 Molecular chaperone-like n=3 Tax=Mycobacterium RepID=A3Q1Z8_MYCSJ Length = 568 Score = 62.0 bits (149), Expect = 9e-08 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPP---PPPPPPVPGRSLDPPPMM 146 P E PPPPP PPPPPP PPPPPP PPPPPP + PPP++ Sbjct: 501 PAATEAPPPPPAQEPPPPPPAEEPPPPPPAEEPPPPPP----TTQPPPVI 546 [173][TOP] >UniRef100_C1ZIK1 RRM domain-containing RNA-binding protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZIK1_PLALI Length = 146 Score = 62.0 bits (149), Expect = 9e-08 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGG 266 GGG R P +GGGGG GGGGGGY GGGGGGY GGGG Sbjct: 102 GGGGR--PRSGGGGGYGGGGGGYGGGGGGGGYGGGGGG 137 [174][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 62.0 bits (149), Expect = 9e-08 Identities = 32/63 (50%), Positives = 39/63 (61%) Frame = +3 Query: 81 EQTGLTRYDSAPGSLLASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGG 260 ++ G+ RY + ++A TV +GG GGGGGG GGGGGY GGGGGGY GG Sbjct: 89 DKEGIKRYST---EIIADTVQ-FLGGRD------GGGGGGRGGGGGYDGGGGGGGYGGGG 138 Query: 261 GGG 269 GGG Sbjct: 139 GGG 141 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/47 (55%), Positives = 28/47 (59%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSP 293 GGG G GGGG GGGGG Y GG GGG + GGGGG + G P Sbjct: 129 GGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGGGGGGNSGGGGP 175 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGG--GGGGYHNGGGGGRSRTSG 287 GGG G GGGGG GGGGG + GG GGGGY GGGGG S G Sbjct: 128 GGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGGGGGGNSGGGG 174 [175][TOP] >UniRef100_C1MSQ5 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MSQ5_9CHLO Length = 1516 Score = 62.0 bits (149), Expect = 9e-08 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP P PPPP P PPPPPPPPPP+P PPP Sbjct: 1052 PPPPPPSPPSPPPPNGSPQPPPPPPPPPPLPSPPPSPPP 1090 [176][TOP] >UniRef100_A9SKS2 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SKS2_PHYPA Length = 250 Score = 62.0 bits (149), Expect = 9e-08 Identities = 30/48 (62%), Positives = 30/48 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 GGG G GGGGGGGGGGGG GGGGGG GGGGG R G R Sbjct: 106 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDRNRGGGR 153 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG R G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 90 GGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 128 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/48 (60%), Positives = 29/48 (60%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 GGG G GGGGGGGGGGGG GGGGGG GGGGG G R Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDR 147 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = +3 Query: 147 IIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 + GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 83 LAGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 89 GGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 127 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 133 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 134 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 135 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 136 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 137 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 91 GGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 129 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/56 (55%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +3 Query: 105 DSAPGSL-LASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 DSA G+L + I R+L G GGGGGGG GGGG GGGGGG GGGGG Sbjct: 60 DSAGGALPMKEEEHHEISIQGRMLAGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 115 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/53 (52%), Positives = 31/53 (58%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFG 311 GGG G GGGGGGGGGGGG GGGGG + GGG G R +P + G Sbjct: 116 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDRNRGGGRGPYRPPWNPPRDDRG 168 [177][TOP] >UniRef100_Q55FU3 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q55FU3_DICDI Length = 354 Score = 62.0 bits (149), Expect = 9e-08 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP+ PPPPPPPPPPP+ ++ PPP Sbjct: 108 PPPP---PPPPPPMTGVPPPPPPPPPPPISKSNIPPPP 142 [178][TOP] >UniRef100_B5DI49 GA25909 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DI49_DROPS Length = 1129 Score = 62.0 bits (149), Expect = 9e-08 Identities = 28/47 (59%), Positives = 31/47 (65%), Gaps = 2/47 (4%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPP--PPPPPPPPVPGRSLDPPP 152 P ++ PPPPP PPPPP PPPP PPPPPPPP+PG PPP Sbjct: 531 PALVIPPPPPPP--PPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPP 575 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/56 (53%), Positives = 32/56 (57%), Gaps = 12/56 (21%) Frame = -3 Query: 283 LVLERPPPPPLW*PP----PPPPLW*PPPPPPP--------PPPPPVPGRSLDPPP 152 LV+ PPPPP PP PPPP PPPPPPP PPPPP+PG PPP Sbjct: 533 LVIPPPPPPPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPPPPPMPGSGAPPPP 588 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL---W*PPPPPPP------PPPPPVPGRSLDPPP 152 PPPP PPPPPP+ PPPPPPP PPPPP PG PPP Sbjct: 552 PPPPAAPPPPPPPPMPGSGAPPPPPPPMPGSGAPPPPPPPGFGGPPPP 599 [179][TOP] >UniRef100_B4G8I0 GL19302 n=1 Tax=Drosophila persimilis RepID=B4G8I0_DROPE Length = 1104 Score = 62.0 bits (149), Expect = 9e-08 Identities = 28/47 (59%), Positives = 31/47 (65%), Gaps = 2/47 (4%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPP--PPPPPPPPVPGRSLDPPP 152 P ++ PPPPP PPPPP PPPP PPPPPPPP+PG PPP Sbjct: 506 PALVIPPPPPPP--PPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPP 550 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/56 (53%), Positives = 32/56 (57%), Gaps = 12/56 (21%) Frame = -3 Query: 283 LVLERPPPPPLW*PP----PPPPLW*PPPPPPP--------PPPPPVPGRSLDPPP 152 LV+ PPPPP PP PPPP PPPPPPP PPPPP+PG PPP Sbjct: 508 LVIPPPPPPPPPPPPFAGAPPPPAAPPPPPPPPMPGSGAPPPPPPPMPGSGAPPPP 563 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/48 (56%), Positives = 28/48 (58%), Gaps = 9/48 (18%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL---W*PPPPPPP------PPPPPVPGRSLDPPP 152 PPPP PPPPPP+ PPPPPPP PPPPP PG PPP Sbjct: 527 PPPPAAPPPPPPPPMPGSGAPPPPPPPMPGSGAPPPPPPPGFGGPPPP 574 [180][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 62.0 bits (149), Expect = 9e-08 Identities = 29/59 (49%), Positives = 33/59 (55%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPP++ P PPPP PPPPPPPPPPPP P PPP + +T P Y P Sbjct: 111 PPPPIFTPAPPPPPPPPPPPPPPPPPPPPP----PPPPPLFTTRGVSFPPHGNPYPYPP 165 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/45 (57%), Positives = 28/45 (62%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P+ PPPPP PPPPPP PPPPPPPPPPP R + PP Sbjct: 114 PIFTPAPPPPPPPPPPPPPPP--PPPPPPPPPPPLFTTRGVSFPP 156 [181][TOP] >UniRef100_B8PFG8 Predicted protein n=1 Tax=Postia placenta Mad-698-R RepID=B8PFG8_POSPM Length = 476 Score = 62.0 bits (149), Expect = 9e-08 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPP G PPP Sbjct: 343 PPPPP---PPPPPPAGGAPPPPPPPPPPPSGGMPPPPPP 378 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/43 (60%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPP----PPPPPPPPPVPGRSLDPPP 152 PPP P PPPPPP PPP PPPPPPPPP P + PPP Sbjct: 334 PPPAPSGGPPPPPPPPPPPPAGGAPPPPPPPPPPPSGGMPPPP 376 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/52 (55%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Frame = -3 Query: 286 PLVLERPPP----PPLW*PPPPPP---LW*PPPPPPPPPPPPVPGRSLDPPP 152 P V PPP PP PPPPPP PPPPPPPPPPPP G PPP Sbjct: 312 PAVAPPPPPTRPAPPSGGPPPPPPPAPSGGPPPPPPPPPPPPAGGAPPPPPP 363 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPP G PPP Sbjct: 342 PPPPP---PPPPPPPAGGAPPPPPPPPPPPSGGMPPPPP 377 Score = 56.2 bits (134), Expect = 5e-06 Identities = 35/77 (45%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPP----PPPPPPPPPVPGRSLDPPPMMA 143 P + S G P PPPPP PPPPP PPP PPPPPPPPP G P P Sbjct: 335 PPAPSGGPPPPPPPPPPPPAGGAPPPPPPPPPPPSGGMPPPPPPPPPAGG---SPGP--- 388 Query: 142 STVLARREPGAESYLVS 92 S L PG ++ L S Sbjct: 389 SAGLPAPAPGRDALLAS 405 [182][TOP] >UniRef100_P0C7L0-2 Isoform 2 of WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=P0C7L0-2 Length = 451 Score = 62.0 bits (149), Expect = 9e-08 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPPL PPPPP PPPPPPP P S D P + Sbjct: 7 PPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSL 49 [183][TOP] >UniRef100_P0C7L0 WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=WIPF3_MOUSE Length = 485 Score = 62.0 bits (149), Expect = 9e-08 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPPL PPPPP PPPPPPP P S D P + Sbjct: 7 PPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSL 49 [184][TOP] >UniRef100_Q64467 Glyceraldehyde-3-phosphate dehydrogenase, testis-specific n=1 Tax=Mus musculus RepID=G3PT_MOUSE Length = 440 Score = 62.0 bits (149), Expect = 9e-08 Identities = 34/74 (45%), Positives = 38/74 (51%), Gaps = 13/74 (17%) Frame = -3 Query: 331 CHVSILVPNSCSLGDP--LVLERPPPPPLW*PPPPPPLW*PPPPP-----------PPPP 191 C ++ P L DP V E+PPPPP PPPPPP PPPPP PPPP Sbjct: 31 CPCPVIRPPPPKLEDPPPTVEEQPPPPP---PPPPPPPPPPPPPPPQIEPDKFEEAPPPP 87 Query: 190 PPPVPGRSLDPPPM 149 PPP P PPP+ Sbjct: 88 PPPPPPPPPPPPPL 101 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/53 (52%), Positives = 29/53 (54%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P C P + RPPPP L PPP PPPPPPPPPPPP P PPP Sbjct: 24 PCPCPCPCPCPVIRPPPPKLEDPPPTVEEQPPPPPPPPPPPPPPP-----PPP 71 [185][TOP] >UniRef100_UPI000155D0AC PREDICTED: similar to KIAA1727 protein n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155D0AC Length = 1167 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/48 (58%), Positives = 30/48 (62%), Gaps = 9/48 (18%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL---------W*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPPL + PP PPPPPPPPP+PG PPP Sbjct: 32 PPPPPPPPPPPPPPLPPCPFPDAGFAPPLPPPPPPPPPLPGGPPAPPP 79 [186][TOP] >UniRef100_UPI0000F2DD8B PREDICTED: similar to zinc finger protein 312, n=1 Tax=Monodelphis domestica RepID=UPI0000F2DD8B Length = 800 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 31/49 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRL 299 GGG G GGGGGGGGGGGG GG GGG GGGGG SG P++ Sbjct: 524 GGGGSHGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGSGGPQI 572 [187][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/76 (44%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLD--PPPMMASTVLARREPGAESYLV 95 PPPPP PPPPPP PPPPPPPPPPPP P S++ P + V +++ E Sbjct: 2801 PPPPPPPTPPPPPP---PPPPPPPPPPPPPPQHSINVTSTPTLPIPVSSQKRKRDEEKES 2857 Query: 94 SPVCSISSLSIPSTSK 47 S S I +TSK Sbjct: 2858 SASKSKKKKMISTTSK 2873 [188][TOP] >UniRef100_UPI0000DB6FB3 PREDICTED: similar to plexus CG4444-PA n=1 Tax=Apis mellifera RepID=UPI0000DB6FB3 Length = 2310 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/70 (44%), Positives = 39/70 (55%), Gaps = 8/70 (11%) Frame = -3 Query: 244 PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREP--------GAESYLVSP 89 PPPPPP PPPPPPPPPPPP P S D P A+ +R P G S + Sbjct: 1230 PPPPPPTVAPPPPPPPPPPPPPPPPSSD-PTATANIYHSRLPPFPNPPAPIGPASLATAT 1288 Query: 88 VCSISSLSIP 59 +CS+S+ ++P Sbjct: 1289 ICSVSTAAMP 1298 [189][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPP-PPPPPPPPVPGRSLDPPPM 149 PPPPPL PPPPPP PPPP PPPPPPPP+P PPP+ Sbjct: 89 PPPPPLPPPPPPPPPLPPPPPLPPPPPPPPLPPPL--PPPL 127 Score = 59.3 bits (142), Expect = 6e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPPL PPPPPL PPPPPPPPP PP P PPP Sbjct: 83 PPPPPL---PPPPPL--PPPPPPPPPLPPPPPLPPPPPP 116 Score = 58.9 bits (141), Expect = 8e-07 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPP--PPPPPPPPPVPGRSLDPPP 152 PPPPPL PPPPPL PPP PPPPPPPP P L PPP Sbjct: 77 PPPPPL---PPPPPLPPPPPLPPPPPPPPPLPPPPPLPPPP 114 [190][TOP] >UniRef100_Q4RLQ7 Chromosome 10 SCAF15019, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RLQ7_TETNG Length = 579 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPPPPPPPPPP +PG PPP Sbjct: 389 PPPPP---PPPPLPGGGPPPPPPPPPPPGLPGAGPPPPP 424 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/50 (60%), Positives = 30/50 (60%), Gaps = 7/50 (14%) Frame = -3 Query: 268 PPPPPL--W*PPPPPPLW*PPPPP-----PPPPPPPVPGRSLDPPPMMAS 140 PPPPPL PPPPPP PPPPP PPPPPP PG PPP M S Sbjct: 393 PPPPPLPGGGPPPPPP---PPPPPGLPGAGPPPPPPPPGCGPPPPPPMGS 439 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 13/65 (20%) Frame = -3 Query: 307 NSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPP-------------PPPPPPVPGRS 167 N ++G L PPPPP PPPPPP + PPPPP PPPPPP+PG Sbjct: 346 NLDAIGLNLKAGAPPPPP---PPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGG 402 Query: 166 LDPPP 152 PPP Sbjct: 403 PPPPP 407 [191][TOP] >UniRef100_C5CY78 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CY78_VARPS Length = 137 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = +3 Query: 174 PGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 P TGGGGG GGGGGG + GGGGGG + GGGGGRS G Sbjct: 87 PRTGGGGGYGGGGGGGYGGGGGGGGYGGGGGGRSGGGG 124 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/45 (64%), Positives = 29/45 (64%), Gaps = 5/45 (11%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNG-----GGGGGYHNGGGGGR 272 GGG G GGG GGGGGGGGY G GGGGGY GGGGGR Sbjct: 90 GGGGGYGGGGGGGYGGGGGGGGYGGGGGGRSGGGGGYGGGGGGGR 134 [192][TOP] >UniRef100_A3PW04 U5 snRNP spliceosome subunit-like protein n=1 Tax=Mycobacterium sp. JLS RepID=A3PW04_MYCSJ Length = 137 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P + PPP+ Sbjct: 83 PPPPP---PPPPPPPGAPPPPPPPPPPPP-PPVYVPPPPV 118 [193][TOP] >UniRef100_Q9WX60 Ccp protein n=1 Tax=Gluconacetobacter xylinus RepID=Q9WX60_ACEXY Length = 329 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/75 (45%), Positives = 37/75 (49%), Gaps = 9/75 (12%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPP---------VPGRSLDPPPMMASTV 134 P+V E PPPPP PPPP PPPPPPPPPPPP VP P P + TV Sbjct: 85 PIVEEAPPPPP-----PPPP---PPPPPPPPPPPPAPVVPEAVHVPQPPAQPAPPVMETV 136 Query: 133 LARREPGAESYLVSP 89 P +VSP Sbjct: 137 APEPPPPPPETVVSP 151 [194][TOP] >UniRef100_Q08W59 Putative uncharacterized protein n=1 Tax=Stigmatella aurantiaca DW4/3-1 RepID=Q08W59_STIAU Length = 437 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +3 Query: 156 GGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRS 275 GG+ L GTGG GGGGGGGGG GGGGGG GGGGG S Sbjct: 376 GGTGALDGTGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGS 415 [195][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 274 ERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVP 176 E PPPPP PPPPPP PPPPPPPPPPPP P Sbjct: 222 EAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 254 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDP 158 PPPPP PPPPPP PPPPPPPPPPPP P + P Sbjct: 226 PPPPPPPPPPPPPP---PPPPPPPPPPPPPPPCNTGP 259 [196][TOP] >UniRef100_Q10R38 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10R38_ORYSJ Length = 209 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/51 (58%), Positives = 31/51 (60%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTV 134 P V PPPPPL PPPPP PPPPP PPPP PV +S PPP S V Sbjct: 77 PSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPV--KSSPPPPPAWSPV 125 Score = 59.7 bits (143), Expect = 5e-07 Identities = 34/84 (40%), Positives = 39/84 (46%), Gaps = 4/84 (4%) Frame = -3 Query: 286 PLVLERPPPP---PLW*PPPPPPLW*PPPPPPP-PPPPPVPGRSLDPPPMMASTVLARRE 119 P V PPPP PL PPPPPP PPPPP PPPPP P S PPP + Sbjct: 55 PSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKS 114 Query: 118 PGAESYLVSPVCSISSLSIPSTSK 47 SPV +++ +I K Sbjct: 115 SPPPPPAWSPVTNVNDYTIQQVGK 138 [197][TOP] >UniRef100_C1FED3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1FED3_9CHLO Length = 2618 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/56 (55%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPP---PLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P+ L P L PPPP PL PPPPPP P PPPPPP PPP P S PPP Sbjct: 2027 PSPPPLPSPPPLPSPPPPSPPPLSPPPPPPPPPAPLPPPPPPLPPPAPSPSPPPPP 2082 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/40 (65%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPP-PVPGRSLDPPP 152 PPP P PPPPPP W PPP PPPPPPP P PG + P P Sbjct: 2070 PPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAPWP 2109 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/53 (54%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPP--VPGRSLDPPPMMASTVLARREP 116 PPPPP PPPPPPL P P P PPPPPP P S PPP A A + P Sbjct: 2055 PPPPPAPLPPPPPPLPPPAPSPSPPPPPPPWPPPPSPPPPPPPAPPPGAAQAP 2107 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/53 (49%), Positives = 26/53 (49%), Gaps = 14/53 (26%) Frame = -3 Query: 268 PPPPPLW*PPPPPP--------------LW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP W PPP PP W PPP P PPPP P P S PPP Sbjct: 2079 PPPPPPWPPPPSPPPPPPPAPPPGAAQAPWPPPPSPSPPPPSPPPPPSPPPPP 2131 [198][TOP] >UniRef100_A8JAG8 Argonaute-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JAG8_CHLRE Length = 1037 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG R G GGGG GGGGGGGY GGGGGG GGGGG Sbjct: 34 GGGDRGGGGYGGGGRGGGGGGGYGGGGGGGGRGGGGGGG 72 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGG GGGGGGGY GGG GG GGGGG Sbjct: 51 GGGGGYGGGGGGGGRGGGGGGGYGGGGGRGGGGGGGGGG 89 Score = 55.8 bits (133), Expect = 7e-06 Identities = 30/48 (62%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGG---GGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGG GGGGGG GGGGGGY GGGGGR G Sbjct: 39 GGGGYGGGGRGGGGGGGYGGGGGGGGRGGGGGGGY--GGGGGRGGGGG 84 [199][TOP] >UniRef100_B4NCX9 GK10119 n=1 Tax=Drosophila willistoni RepID=B4NCX9_DROWI Length = 201 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGY-HNGGGGGRSRTS 284 GGG G GGGG GGGGGG Y +GGGGG Y H GGGGGR T+ Sbjct: 43 GGGGGGWGGGGGGGWGGGGGGNYGHGGGGGNYGHGGGGGGRGGTT 87 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G GGG GGGGGGGYH GGGGGGY GGGGG Sbjct: 99 GGGGGHHGGGGGGGYHGGGGGGGYPGGGGGG 129 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGG GGGGGG + GGGGGGYH GGGGG Sbjct: 99 GGGGGHHGGGGGGGYHGGGGGGGYPGGGGGGYHGGGGGG 137 Score = 60.1 bits (144), Expect = 4e-07 Identities = 31/61 (50%), Positives = 34/61 (55%), Gaps = 8/61 (13%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYH--------NGGGGGRSRTSGSPRLQEF 308 GGG G GGGG GGGGGGYH GGGGGG + +GGGGG S S S + Sbjct: 108 GGGGGYHGGGGGGGYPGGGGGGYHGGGGGGGGYPQWGGGGGSGGGGGGSYASSSANSYSY 167 Query: 309 G 311 G Sbjct: 168 G 168 [200][TOP] >UniRef100_B4JKF0 GH12649 n=1 Tax=Drosophila grimshawi RepID=B4JKF0_DROGR Length = 202 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 3/49 (6%) Frame = +3 Query: 153 GGGSRLLPGTGGGGG---GGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGG GGGGGGG+ +GGGGGG+ +GGGGG + GS Sbjct: 148 GGGGGWKSGGGGGGGWKSGGGGGGGWKSGGGGGGWKSGGGGGGWSSGGS 196 [201][TOP] >UniRef100_A0NCZ0 AGAP001055-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A0NCZ0_ANOGA Length = 208 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +3 Query: 147 IIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 ++GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 15 VVGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSP 293 GGG G GGGGGGGGGGGG GGGGGG GGGGG G P Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGP 98 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/50 (56%), Positives = 33/50 (66%) Frame = +3 Query: 120 SLLASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 +++ V + GGG+ G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 7 AVIDHVVRVVGGGGNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGG 100 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 25 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 30 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 31 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GG S G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 19 GGNSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG GGG G R G+ Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGPGGGGWGGWRGRGA 111 [202][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 30/45 (66%), Gaps = 3/45 (6%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPV---PGRSLDPPP 152 L PPPPPL PPPPPP PPPPPPPPPPP + SL PPP Sbjct: 469 LPPPPPPPLPPPPPPPP---PPPPPPPPPPPALDVGETSSLQPPP 510 [203][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 31/49 (63%), Gaps = 9/49 (18%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLD---------PPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P +LD PPP+ Sbjct: 841 PPPPP---PPPPPP---PPPPPPPPPPPPPPPPALDVGETSNLQPPPPL 883 [204][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 31/49 (63%), Gaps = 9/49 (18%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLD---------PPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P +LD PPP+ Sbjct: 919 PPPPP---PPPPPP---PPPPPPPPPPPPPPPPALDVGETSNLQPPPPL 961 [205][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 31/49 (63%), Gaps = 9/49 (18%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLD---------PPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P +LD PPP+ Sbjct: 919 PPPPP---PPPPPP---PPPPPPPPPPPPPPPPALDVGETSNLQPPPPL 961 [206][TOP] >UniRef100_Q7RWH7 Cytokinesis protein sepA n=1 Tax=Neurospora crassa RepID=Q7RWH7_NEUCR Length = 1817 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/51 (54%), Positives = 30/51 (58%), Gaps = 12/51 (23%) Frame = -3 Query: 268 PPPPPLW*PPPPPP------------LW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP+PG + PPP Sbjct: 1061 PPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPPP 1111 Score = 59.7 bits (143), Expect = 5e-07 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 4/52 (7%) Frame = -3 Query: 268 PPPPPLW*PPPPPPL----W*PPPPPPPPPPPPVPGRSLDPPPMMASTVLAR 125 PPPPP PPPPPP+ PPPPPPPPP P +PG PPP M R Sbjct: 1091 PPPPP---PPPPPPMPGMAGMPPPPPPPPPMPGMPGMPPPPPPPMPGPASGR 1139 [207][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/38 (71%), Positives = 27/38 (71%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPG 173 P L PPPPP PPPPPP PPPPPPPPPPPP PG Sbjct: 980 PNGLSPPPPPPPPPPPPPPPP--PPPPPPPPPPPPPPG 1015 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/48 (60%), Positives = 30/48 (62%), Gaps = 9/48 (18%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPP------VPGRS---LDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP +P S L PPP Sbjct: 985 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGFKGIIPSSSGIPLPPPP 1032 [208][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/60 (50%), Positives = 33/60 (55%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 PPPPP PPPPPP PPPPPPPPPPP P PM+ S + R P L +P Sbjct: 335 PPPPPPPRPPPPPP----PPPPPPPPPPPPPALKNVENPMIPSPPIRRPVPLKPPALTTP 390 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/56 (48%), Positives = 31/56 (55%) Frame = -3 Query: 256 PLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPGAESYLVSP 89 P+ PPPPPP PPPPPPPPPPPP P PM+ S + R P L +P Sbjct: 778 PVSAPPPPPPPRPPPPPPPPPPPPPPPALKNVENPMIPSPPIRRPVPLKPPALTTP 833 [209][TOP] >UniRef100_UPI000155382B PREDICTED: hypothetical protein n=1 Tax=Mus musculus RepID=UPI000155382B Length = 492 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/45 (66%), Positives = 31/45 (68%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGGS G GGGGGGGGGGGG GGGGGG +GGGGG SG Sbjct: 47 GGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSG 91 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +3 Query: 150 IGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 +GGG + G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 119 VGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG R G Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 213 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGGR G Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 215 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG + G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 159 GGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG + G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 160 GGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/46 (63%), Positives = 29/46 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG GGGGG GS Sbjct: 302 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGS 347 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG SG Sbjct: 304 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSG 348 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG S G Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGG 351 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGGS G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 344 GGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 382 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG R G+GGGGGGGGGGGG GGGGGG GGGGG G Sbjct: 42 GGGGRG-GGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGG 85 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = +3 Query: 150 IGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 +GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 125 VGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = +3 Query: 150 IGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 +GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 165 VGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 58.9 bits (141), Expect = 8e-07 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG + G Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG 349 Score = 58.9 bits (141), Expect = 8e-07 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G+GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 338 GGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 376 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG +GGGGG Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGG 95 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGG 96 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGG 172 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGGG 181 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 156 GGGGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 178 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 216 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG +GGGGGG GGGGG Sbjct: 220 GGGGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGG 258 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 341 GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 379 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 342 GGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 380 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG + G Sbjct: 52 GGGG----GGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGG 92 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG G Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 212 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 217 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGG G R G Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGG 232 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 235 GGGGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 273 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 237 GGGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 275 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG G Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGG 350 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG G Sbjct: 308 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGG 352 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 315 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGG 353 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 316 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGG 354 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG +GGGGGG GGGGG Sbjct: 323 GGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGG 361 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 324 GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGG 362 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 325 GGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGG 363 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 343 GGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 381 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/51 (58%), Positives = 30/51 (58%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQE 305 GGG G GGGGGGGGGGGG GGGGGG GGGGG G QE Sbjct: 394 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGQE 444 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 28/47 (59%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSP 293 GGG G GGGGGGGGGGGG GGGGGG GGGGG P Sbjct: 399 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGQEP 445 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGGS G GGG GGGGGGGG GGGGGG GGGGG G Sbjct: 77 GGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGG 121 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 158 GGGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 224 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 222 GGGDGGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGG 260 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 238 GGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 276 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 239 GGGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 277 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 240 GGGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 278 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 241 GGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 279 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 245 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 283 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 246 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 284 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 247 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 285 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 248 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 286 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 249 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 287 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 250 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 288 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 251 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 289 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 252 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 290 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 253 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 291 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 254 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 292 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 255 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 293 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 256 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 294 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 257 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 295 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 258 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 296 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 259 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 297 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 260 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 298 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 261 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 299 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 262 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 300 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 263 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 301 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 264 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 302 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 265 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 303 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 266 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 304 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 267 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 305 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 268 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 306 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 269 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 307 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 270 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 308 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 271 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 309 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 272 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 310 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 273 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 311 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 274 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 312 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 275 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 313 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 276 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 314 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 277 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 315 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 278 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 316 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 279 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 317 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 280 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 318 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 281 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 319 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 282 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 320 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 283 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 321 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 284 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 322 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 285 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 323 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 286 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 324 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 287 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 325 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 288 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 289 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 327 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 290 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 291 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 329 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 292 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 293 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 294 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 332 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 295 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 296 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 297 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 335 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 298 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 336 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 299 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 337 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 300 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 338 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 301 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 339 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 348 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 386 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 349 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 387 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 350 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 388 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 351 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 389 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 352 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 390 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 353 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 391 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 354 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 392 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 355 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 393 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 356 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 394 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 357 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 395 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 358 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 396 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 359 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 397 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 360 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 398 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 361 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 399 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 362 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 400 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 363 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 401 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 364 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 402 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 365 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 403 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 366 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 404 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 367 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 405 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 368 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 406 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 369 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 407 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 370 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 408 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 371 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 409 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 372 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 410 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 373 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 411 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 374 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 412 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 375 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 413 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 376 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 414 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 377 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 415 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 378 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 416 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 379 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 417 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 380 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 418 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 381 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 419 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 382 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 420 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 383 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 421 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 384 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 422 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 385 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 423 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 386 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 424 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 387 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 425 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 388 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 426 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 389 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 427 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 390 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 428 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 391 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 429 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 392 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 430 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 393 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 431 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG G Sbjct: 53 GGGG----GGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGG 93 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 121 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGG 171 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGGG 180 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 161 GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 86 GGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG 124 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G+GGGGGGGGG GG GGGGGG GGGGG Sbjct: 71 GGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 109 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGG 170 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGGGGGGG 179 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGG GGGGG GGGGGG GGGGG Sbjct: 74 GGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGG 112 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGG GGGGGG GGGGGG GGGGG Sbjct: 75 GGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG + G GG GGGGGGGGG GGGGGG GGGGG Sbjct: 113 GGGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG 151 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG + G G GGGGGGGGGG GGGGGG GGGGG Sbjct: 114 GGGGGVGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGG 152 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGG 266 GGG R G GGGGGGGGG GG GGGGGG GGGG Sbjct: 206 GGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGG 243 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGG GGGGG S G Sbjct: 54 GGGG----GGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGG 94 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGG GGGGGG GGGGG Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGG 97 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGG GGGGGGG +GGGGGG GGGGG Sbjct: 66 GGGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGG 104 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGG GGGGGGGG GGGGGG GGGGG Sbjct: 67 GGGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGG 105 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GG GGGGGGGGG GGGGGG GGGGG Sbjct: 68 GGGGGGGGGGGGSGGGGGGGGGSGGGGGGGGGGGGGGGG 106 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGG GGGGGGG GGGGGG GGGGG Sbjct: 76 GGGGSGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/48 (58%), Positives = 28/48 (58%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 GGG G GGGGGGGGGGGG GGG GG GGGGG G R Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGDGGGR 229 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGG G GGGGGG GGGGG Sbjct: 205 GGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGGGGGG 243 Score = 55.5 bits (132), Expect = 9e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGGS G GGGGGGGGGGGG GGGGGG GG GG G Sbjct: 87 GGGS----GGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGVGG 127 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG +GGG GG GGGGG Sbjct: 201 GGGGGGGGGRGGGGGGGGGGGGGGDGGGRGGGGGGGGGG 239 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = +3 Query: 156 GGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GG R G GGGGGGGGG GG GGGGGG GGGGG Sbjct: 226 GGGRGGGGGGGGGGGGGGDGGGGGGGGGGGGGGGGGGG 263 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGG GGGGG Sbjct: 317 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGG 355 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGG G GGGGG Sbjct: 318 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGG 356 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGG GG GGGGG Sbjct: 319 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGG 357 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GG GGG GGGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGG 358 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG G GGGG GGGGG Sbjct: 321 GGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGG 359 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGG GGGGG Sbjct: 322 GGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGG 360 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGG GGGGGG GGGGG Sbjct: 326 GGGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGG 364 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGG G GGGGGG GGGGG Sbjct: 327 GGGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGG 365 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGG GG GGGGGG GGGGG Sbjct: 328 GGGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGG 366 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGG GGG GGGGGG GGGGG Sbjct: 329 GGGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGG 367 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGG GGGG GGGGGG GGGGG Sbjct: 330 GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGG 368 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGG GGGGG GGGGGG GGGGG Sbjct: 331 GGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGG 369 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGG GGGGGG GGGGGG GGGGG Sbjct: 332 GGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGG 370 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGG GGGGGGG GGGGGG GGGGG Sbjct: 333 GGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGG 371 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGG GGGGGGGG GGGGGG GGGGG Sbjct: 334 GGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGG 372 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GG GGGGGGGGG GGGGGG GGGGG Sbjct: 335 GGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGG 373 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G G GGGGGGGGGG GGGGGG GGGGG Sbjct: 336 GGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGG 374 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGG GGGGGG GGGGG Sbjct: 337 GGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 375 [210][TOP] >UniRef100_UPI0000DA20D4 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA20D4 Length = 166 Score = 61.2 bits (147), Expect = 2e-07 Identities = 31/49 (63%), Positives = 32/49 (65%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRL 299 GGG G GGGGGGGGGGGG GGGGGG GGGGG R S + RL Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRRISMTIRL 104 Score = 60.1 bits (144), Expect = 4e-07 Identities = 31/57 (54%), Positives = 32/57 (56%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRIL 323 GGG G GGGGGGGGGGGG GGGGGG GGGGG G R R+L Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRRISMTIRLL 105 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 35 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65 [211][TOP] >UniRef100_UPI0000DA1F29 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA1F29 Length = 170 Score = 61.2 bits (147), Expect = 2e-07 Identities = 31/49 (63%), Positives = 32/49 (65%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRL 299 GGG G GGGGGGGGGGGG GGGGGG GGGGG R S + RL Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRRISMTIRL 108 Score = 60.1 bits (144), Expect = 4e-07 Identities = 31/57 (54%), Positives = 32/57 (56%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRIL 323 GGG G GGGGGGGGGGGG GGGGGG GGGGG G R R+L Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRRISMTIRLL 109 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 35 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65 [212][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVP 176 PPPPP PPPPPP PPPPPPPPPPPP+P Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 1505 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPM 149 PPPPP PPPPPP PPPPPPPPPPPP P PPP+ Sbjct: 1476 PPPPP---PPPPPP---PPPPPPPPPPPPPP-----PPPL 1504 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/47 (59%), Positives = 29/47 (61%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMAST 137 L PPPPP PPPPPP PPPPPPPPPPPP PPP + T Sbjct: 1474 LPPPPPPP---PPPPPP---PPPPPPPPPPPP-------PPPPLPRT 1507 [213][TOP] >UniRef100_UPI000069E6FF UPI000069E6FF related cluster n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069E6FF Length = 823 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 4/47 (8%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPP----PPPPPVPGRSLDPP 155 L++E+PPPPP PPPPPP PPPPP P PPPPP+PG PP Sbjct: 25 LMVEQPPPPPPQPPPPPPP---PPPPPLPFQNVPPPPPLPGAPPPPP 68 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 244 PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPPP PPPPPPPPPPPP+P +++ PPP Sbjct: 30 PPPPPPQ--PPPPPPPPPPPPLPFQNVPPPP 58 [214][TOP] >UniRef100_UPI0001B7B45F Fnbp4 protein. n=1 Tax=Rattus norvegicus RepID=UPI0001B7B45F Length = 1076 Score = 61.2 bits (147), Expect = 2e-07 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 11/105 (10%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSL------- 164 ++L N L PL LE PPPPP PPP P PPPPPPPPPPPP+ + Sbjct: 745 TLLQSNVPVLQPPLPLEMPPPPP---PPPESP---PPPPPPPPPPPPLEDGEIQEVEMED 798 Query: 163 ---DPPPMMASTVLARREPGAESYLVSPVCSI-SSLSIPSTSKSI 41 + PP + +P ++ +V+ S+ S+ S P ++K++ Sbjct: 799 EGSEEPPAPGTEEDTPLKPSTQTTVVTSQSSVDSTASSPPSTKAV 843 [215][TOP] >UniRef100_UPI00016E6B75 UPI00016E6B75 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E6B75 Length = 511 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = -3 Query: 274 ERPPPPPLW*--PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPG 113 + PPPPP PPPPPP PPPPPPPPPPP P PPP +S L G Sbjct: 350 QAPPPPPCGGGPPPPPPPGGGGPPPPPPPPPPPPPTTDFPPPPPPSSGPLPPTSSG 405 [216][TOP] >UniRef100_Q28BK7 Novel protein (Fragment) n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q28BK7_XENTR Length = 823 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 4/47 (8%) Frame = -3 Query: 283 LVLERPPPPPLW*PPPPPPLW*PPPPPPP----PPPPPVPGRSLDPP 155 L++E+PPPPP PPPPPP PPPPP P PPPPP+PG PP Sbjct: 25 LMVEQPPPPPPQPPPPPPP---PPPPPLPFQNVPPPPPLPGAPPPPP 68 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 244 PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPPP PPPPPPPPPPPP+P +++ PPP Sbjct: 30 PPPPPPQ--PPPPPPPPPPPPLPFQNVPPPP 58 [217][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/38 (68%), Positives = 26/38 (68%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPPPPPPPP P PP Sbjct: 234 PPPPP---PPPPPP---PPPPPPPPPPPPPPPPPFQPP 265 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPPPPPPP P PPP Sbjct: 233 PPPPP---PPPPPP---PPPPPPPPPPPPPP-----PPP 260 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPP 182 PPPPP PPPPPP PPPPPPPPPPPP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 260 [218][TOP] >UniRef100_Q9GP44 NONA protein (Fragment) n=1 Tax=Drosophila virilis RepID=Q9GP44_DROVI Length = 165 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = +3 Query: 183 GGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGGGGGGGGGGG GGGGGG GGGGGR R GS Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGS 104 [219][TOP] >UniRef100_Q95UX4 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95UX4_DROVI Length = 163 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = +3 Query: 183 GGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGGGGGGGGGGG GGGGGG GGGGGR R GS Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGS 102 [220][TOP] >UniRef100_Q95NR6 No on or off transient A (Fragment) n=1 Tax=Drosophila virilis RepID=Q95NR6_DROVI Length = 165 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/36 (75%), Positives = 27/36 (75%) Frame = +3 Query: 183 GGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGGGGGGGGGGG GGGGGG GGGGGR R GS Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRDRNRGS 104 [221][TOP] >UniRef100_Q5TU53 AGAP002965-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=Q5TU53_ANOGA Length = 212 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/62 (51%), Positives = 35/62 (56%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRILTWQ 332 GGG G GGGGGGGGGGGG GGGGGG GGGGG G + +G+ T Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGAYGSVRSTSS 113 Query: 333 DR 338 DR Sbjct: 114 DR 115 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 13 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 14 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 52 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 15 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 53 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 16 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 17 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 18 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 19 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 20 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 21 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 22 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 25 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 30 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 31 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GG + G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 5 GGRGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 43 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G G G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 6 GRGKGKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 44 [222][TOP] >UniRef100_D0A779 Formin, putative (Formin-like protein) n=1 Tax=Trypanosoma brucei gambiense DAL972 RepID=D0A779_TRYBG Length = 987 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/50 (60%), Positives = 31/50 (62%), Gaps = 8/50 (16%) Frame = -3 Query: 277 LERPPPPPLW*PPPPPP----LW*PPPPPP----PPPPPPVPGRSLDPPP 152 L PPPPP+ PPPPPP L PPPPPP PPPPPP PG PPP Sbjct: 477 LPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPPGGKGAPPP 526 [223][TOP] >UniRef100_C4QFT9 Diaphanous, putative n=1 Tax=Schistosoma mansoni RepID=C4QFT9_SCHMA Length = 1068 Score = 61.2 bits (147), Expect = 2e-07 Identities = 34/62 (54%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Frame = -3 Query: 319 ILVPNSCSLGDPLVLERPPPPPLW*--PPPPPPLW*PPPPPPPP----PPPPVPGRSLDP 158 IL P S S P PPPPP+ PPPPPP PPPPPPPP PPPP P S+ P Sbjct: 480 ILPPPSLSSSIPPPPGIPPPPPMEGVPPPPPPP---PPPPPPPPMGGIPPPPPPMGSIPP 536 Query: 157 PP 152 PP Sbjct: 537 PP 538 [224][TOP] >UniRef100_B7Q5W9 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q5W9_IXOSC Length = 90 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/49 (59%), Positives = 31/49 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRL 299 GGG G GGGGGGGGGGGG GGGGGG GGGGG G+P + Sbjct: 12 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGTPNV 60 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 41 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 42 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 43 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 6 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 44 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 45 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 8 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 46 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 47 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 10 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 48 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 11 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 49 [225][TOP] >UniRef100_B7PJU5 GGY domain-containing protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PJU5_IXOSC Length = 200 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG GGGGG R GS Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGIRVIGS 73 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/54 (53%), Positives = 32/54 (59%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGT 314 GGG G GGGGGGGGGGGG GGGGGG GGGGG G ++ G+ Sbjct: 20 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGIRVIGS 73 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G G+ G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 160 GAGAAYCEGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 41 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 42 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 43 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 6 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 44 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 45 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 8 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 46 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 47 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 10 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 48 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 11 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 49 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 12 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 50 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 13 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 14 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 52 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 15 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 53 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 16 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 17 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 18 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 19 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 [226][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 61.2 bits (147), Expect = 2e-07 Identities = 35/101 (34%), Positives = 48/101 (47%), Gaps = 24/101 (23%) Frame = -3 Query: 274 ERPPPPPL------------------------W*PPPPPPLW*PPPPPPPPPPPPVPGRS 167 +RPPPPP PPPPPP PPPPPPPPPPPP P Sbjct: 465 KRPPPPPTPPDEESKKNSECSSQDSTRGGPSSTPPPPPPP---PPPPPPPPPPPPPP--- 518 Query: 166 LDPPPMMASTVLARREPGAESYLVSPVCSISSLSIPSTSKS 44 PPP + T+ +++ G L+S + S++ + T++S Sbjct: 519 -PPPPPPSVTLSSQKMAGLRELLLSEKLNTSAIQLQVTAQS 558 [227][TOP] >UniRef100_B4QB57 GD25930 n=1 Tax=Drosophila simulans RepID=B4QB57_DROSI Length = 617 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/47 (61%), Positives = 30/47 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSP 293 GGGS G GGGG GGG GGG GGGGGY +GGGGGR G P Sbjct: 263 GGGS----GFGGGGAGGGSGGGGGGAGGGGGYGSGGGGGRGGAPGGP 305 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +3 Query: 171 LPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 L G GGG GGGGGGGG+ GG GGGY GGGGG Sbjct: 42 LQGPGGGFGGGGGGGGFGGGGAGGGYGAGGGGG 74 [228][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/63 (47%), Positives = 36/63 (57%), Gaps = 7/63 (11%) Frame = -3 Query: 343 YCLSCHVSILVPNS----CSLGDPLVLER---PPPPPLW*PPPPPPLW*PPPPPPPPPPP 185 +CL+ +++P C P V + PPPPP PPPPPP PPPPPPPPPPP Sbjct: 6 FCLALFSFVILPTDSYFCCVPFLPFVCQCLCCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Query: 184 PVP 176 P P Sbjct: 66 PAP 68 Score = 58.5 bits (140), Expect = 1e-06 Identities = 30/50 (60%), Positives = 30/50 (60%) Frame = -3 Query: 262 PPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPPMMASTVLARREPG 113 PPP PPPPPP PPPPPPPPPPPP P PPP A V RR G Sbjct: 38 PPP---PPPPPP---PPPPPPPPPPPPPP----PPPPPPAPYVYPRRPIG 77 [229][TOP] >UniRef100_Q4WCV2 Actin associated protein Wsp1, putative n=1 Tax=Aspergillus fumigatus RepID=Q4WCV2_ASPFU Length = 643 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/61 (52%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPPP----PPPPPPVPGRSLDPPPMMA 143 P S G P PPPPP PPPPP PPPP P PPPPPP PG PPP A Sbjct: 492 PPPVSSGPPAPPPPPPPPPSIGGPPPPP---PPPPAPGGSAPPPPPPPPGAGAPPPPPPA 548 Query: 142 S 140 S Sbjct: 549 S 549 [230][TOP] >UniRef100_Q9FLQ7 Formin-like protein 20 n=1 Tax=Arabidopsis thaliana RepID=FH20_ARATH Length = 1615 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/60 (53%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Frame = -3 Query: 322 SILVPNSCSLGDPLVLERPPPPPLW*PPPPPPLW*PPPPP---PPPPPPPVPGRSLDPPP 152 S+L P S G P PPPPP + PPPPP PPPP PPPPPPP PG PPP Sbjct: 931 SVLSPPPPSYGSPP--PPPPPPPSYGSPPPPP---PPPPSYGSPPPPPPPPPGYGSPPPP 985 [231][TOP] >UniRef100_UPI0001982BF9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982BF9 Length = 394 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/68 (50%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRILT-W 329 GGG G+G GGGGGGGGGG +GGGGGG GGGGG S ++ P + TRI W Sbjct: 220 GGGYSSGSGSGSGGGGGGGGGGGGSGGGGGGGGGGGGGGGSGSNIKP--SNWKTRICNKW 277 Query: 330 QDRQYIRF 353 + Y F Sbjct: 278 ELTGYCPF 285 [232][TOP] >UniRef100_UPI0001926BC7 PREDICTED: similar to mini-collagen isoform 3 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC7 Length = 148 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P+ PPPPP PPPPPP PPPPPPPPPPPP+P PP Sbjct: 45 PICCVPPPPPP---PPPPPP---PPPPPPPPPPPPLPLPGNPGPP 83 [233][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PPPPPPPPPPPP+PG + D P Sbjct: 259 PMPPP---PPPPPP---PPPPPPPPPPPPLPGPAADTVP 291 Score = 59.7 bits (143), Expect = 5e-07 Identities = 36/87 (41%), Positives = 44/87 (50%), Gaps = 6/87 (6%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPP------VPGRSLDPPPMMASTVLAR 125 P+ PPPPP PPPPPP PPPPPPPPPP P VP L PPP ++ L Sbjct: 255 PVTPPMPPPPP---PPPPPP---PPPPPPPPPPLPGPAADTVPAPPLPPPPPPSAPPL-- 306 Query: 124 REPGAESYLVSPVCSISSLSIPSTSKS 44 PG S V ++++ I K+ Sbjct: 307 --PGTSSPTVVFNSGLAAVKIKKPIKT 331 [234][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PPPPPPPPPPPP+PG + D P Sbjct: 547 PMPPP---PPPPPP---PPPPPPPPPPPPLPGPAADTVP 579 Score = 58.9 bits (141), Expect = 8e-07 Identities = 36/87 (41%), Positives = 43/87 (49%), Gaps = 6/87 (6%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPP------VPGRSLDPPPMMASTVLAR 125 P PPPPP PPPPPP PPPPPPPPPP P VP L PPP ++ L Sbjct: 543 PATPPMPPPPP---PPPPPP---PPPPPPPPPPLPGPAADTVPAPPLPPPPPPSAPPL-- 594 Query: 124 REPGAESYLVSPVCSISSLSIPSTSKS 44 PG S V ++++ I K+ Sbjct: 595 --PGTSSPTVVFNSGLAAVKIKKPIKT 619 [235][TOP] >UniRef100_UPI0000F2CB43 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2CB43 Length = 252 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/46 (65%), Positives = 31/46 (67%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG GG GG S +SGS Sbjct: 190 GGGG----GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGS 231 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 27/38 (71%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 G GGGGGGGGGGGG GGGGGG GGGGG + GS Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGS 225 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 186 GAGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 216 [236][TOP] >UniRef100_UPI0000EBE712 PREDICTED: similar to MYST histone acetyltransferase (monocytic leukemia) 3 n=1 Tax=Bos taurus RepID=UPI0000EBE712 Length = 2018 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/65 (46%), Positives = 37/65 (56%), Gaps = 4/65 (6%) Frame = -3 Query: 334 SCHVSILVPNSCSLGDPLVLERPPPP-PLW*PPPP---PPLW*PPPPPPPPPPPPVPGRS 167 + + I P SC++ P ++PPPP P PPPP PP PPP PPPPPPP P + Sbjct: 1645 AANCGIKSPQSCAVERPPSTQQPPPPQPSQQPPPPQPQPPAPPPPPAQPPPPPPPPPQQP 1704 Query: 166 LDPPP 152 PPP Sbjct: 1705 QPPPP 1709 [237][TOP] >UniRef100_UPI0000E491FD PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E491FD Length = 116 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 4/49 (8%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGG----GGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGG GGGGY +GGGGGG GGGGG SG Sbjct: 61 GGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGGGGGGGGGGGGGGDSG 109 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/42 (66%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = +3 Query: 153 GGGSRLLPGTGGG---GGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGG GGGGGGGGG +GGGGGGY +GGGGG Sbjct: 32 GGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGG 73 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/42 (66%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = +3 Query: 153 GGGSRLLPGTGGG---GGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGG GGGGGGGGG +GGGGGGY +GGGGG Sbjct: 53 GGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGG 94 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/67 (50%), Positives = 37/67 (55%), Gaps = 5/67 (7%) Frame = +3 Query: 102 YDSAPGSLLASTVDAIIGGGSRLLPGTGGGGGGG---GGGGGYHNGGGGGGYHNG--GGG 266 Y S G D+ GGG G GGGGGGG GGGGGY +GGGGGG G GGG Sbjct: 24 YSSGGGGSGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGGGGGYSSGGGGGGGGGGDSGGG 83 Query: 267 GRSRTSG 287 G +SG Sbjct: 84 GGGYSSG 90 [238][TOP] >UniRef100_UPI0000E1F764 PREDICTED: formin-like 2 isoform 6 n=1 Tax=Pan troglodytes RepID=UPI0000E1F764 Length = 1032 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P+ PPPPP PPPPP PPPPPPPPPPPP+PG + + P Sbjct: 515 PVTPPMPPPPP----PPPPP---PPPPPPPPPPPPLPGPAAETGP 552 [239][TOP] >UniRef100_UPI0000DB6D2F PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6D2F Length = 143 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/46 (63%), Positives = 29/46 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG G GGGR GS Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGS 54 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 4 GGGG----GGGGGGGGGGGGGGGGGGGGGGGVGGGGGGG 38 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = +3 Query: 150 IGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 +GGG G GGGGGGGGGGGG GGGGGG GGGGG G Sbjct: 1 MGGGG----GGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGG 42 [240][TOP] >UniRef100_UPI00000216EF glyceraldehyde-3-phosphate dehydrogenase, spermatogenic n=1 Tax=Mus musculus RepID=UPI00000216EF Length = 440 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/57 (52%), Positives = 32/57 (56%), Gaps = 11/57 (19%) Frame = -3 Query: 286 PLVLERPPPPPLW*PPPPPPLW*PPPPP-----------PPPPPPPVPGRSLDPPPM 149 P V E+PPPPP PPPPPP PPPPP PPPPPPP P PPP+ Sbjct: 48 PTVEEQPPPPP---PPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPPL 101 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/63 (49%), Positives = 33/63 (52%), Gaps = 10/63 (15%) Frame = -3 Query: 310 PNSCSLGDPLVLERPPPPPLW*PPP-----PPPLW*PPPPPPPPPPPPVPGRSLD----- 161 P C P + RPPPP + PPP PPP PPPPPPPPPPPP P D Sbjct: 24 PCPCPCPCPCPVIRPPPPKVEDPPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEPDKFEEA 83 Query: 160 PPP 152 PPP Sbjct: 84 PPP 86 [241][TOP] >UniRef100_UPI000179CEFB UPI000179CEFB related cluster n=1 Tax=Bos taurus RepID=UPI000179CEFB Length = 2012 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/65 (46%), Positives = 37/65 (56%), Gaps = 4/65 (6%) Frame = -3 Query: 334 SCHVSILVPNSCSLGDPLVLERPPPP-PLW*PPPP---PPLW*PPPPPPPPPPPPVPGRS 167 + + I P SC++ P ++PPPP P PPPP PP PPP PPPPPPP P + Sbjct: 1639 AANCGIKSPQSCAVERPPSTQQPPPPQPSQQPPPPQPQPPAPPPPPAQPPPPPPPPPQQP 1698 Query: 166 LDPPP 152 PPP Sbjct: 1699 QPPPP 1703 [242][TOP] >UniRef100_Q0BCI9 Putative uncharacterized protein n=1 Tax=Burkholderia ambifaria AMMD RepID=Q0BCI9_BURCM Length = 529 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/45 (66%), Positives = 30/45 (66%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG S SG Sbjct: 406 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSG 450 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG GGGGG + GS Sbjct: 404 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGS 449 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG SG Sbjct: 403 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSG 447 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGGG + G Sbjct: 407 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGG 451 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/45 (64%), Positives = 29/45 (64%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGGGGG GGGG S SG Sbjct: 415 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGSG 459 Score = 58.9 bits (141), Expect = 8e-07 Identities = 28/46 (60%), Positives = 30/46 (65%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGG +GGGGG + GS Sbjct: 416 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGSGGS 461 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/46 (60%), Positives = 30/46 (65%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG +GG GG + GS Sbjct: 413 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGS 458 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 402 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 440 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/46 (60%), Positives = 28/46 (60%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG GG GG GS Sbjct: 410 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGS 455 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/45 (62%), Positives = 28/45 (62%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG G GGGGGGGGGGGG GGG GG GGG G S SG Sbjct: 418 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGSGGSG 462 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG +GG GGG +GG GG GS Sbjct: 422 GGGGGGGGGGGGGGGGGGGGGGGGSGGSGGGGGSGGSGGSGGAGGS 467 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G G+ G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 394 GNGNGNGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 432 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 G G+ G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 396 GNGNGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 434 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +3 Query: 153 GGGSRLLPGTGGGGG-GGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 GGG+ + G G GGG GGGGGGG H GG GGG+ G GGG SG Sbjct: 279 GGGNGVGNGGGHGGGHGGGGGGGGHGGGNGGGHGGGNGGGNGGGSG 324 [243][TOP] >UniRef100_B9LBU3 Putative uncharacterized protein n=1 Tax=Chloroflexus sp. Y-400-fl RepID=B9LBU3_CHLSY Length = 340 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPPPP P PPP Sbjct: 290 PPPPPPTVAPPPPPTVAPPPPPPPPPPPPPP-----PPP 323 [244][TOP] >UniRef100_A9WHI6 Putative uncharacterized protein n=1 Tax=Chloroflexus aurantiacus J-10-fl RepID=A9WHI6_CHLAA Length = 344 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPPPPPPP P PPP Sbjct: 294 PPPPPPTVAPPPPPTVAPPPPPPPPPPPPPP-----PPP 327 [245][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 269 PPPPPPSPPPPPPPR--PPPPPPPSPPPPSPPPPSPPPP 305 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/41 (65%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPPPP PPPPPP P PPP Sbjct: 260 PPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPP 300 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PPPPPPP PPPP P R PPP Sbjct: 253 PSPPPPSPPPPPPPS--PPPPPPPSPPPPPPPRPPPPPP 289 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 277 PPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 315 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPPPP PPPPP P PPP Sbjct: 252 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPP 290 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPPP PPPPPPP P PPP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPP 360 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPP 155 PPPPP PPPPPP PPPPPP PPPP P S PP Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPP PPPP PPP P S PPP Sbjct: 346 PPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 384 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPPP PPPP PP P PPP Sbjct: 373 PPPPPPSPPPPPPPR--PPPPSPPPPSPPPPSPPPPPPP 409 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PP PP PPPPPP PPP PPPP PPP P S PPP Sbjct: 304 PPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPP PPPPPP PPPPP P PPP Sbjct: 245 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 282 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPP PPPPPPP PPPP P PPP Sbjct: 330 PPPPPPPSPPPPPS---PPPPPPPRPPPPSPPPPSPPPP 365 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 365 PSPPPPSPPPPPPPS--PPPPPPPRPPPPSPPPPSPPPP 401 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 396 PSPPPPSPPPPPPPS--PPPPPPPRPPPPSPPPPSPPPP 432 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/46 (58%), Positives = 27/46 (58%), Gaps = 6/46 (13%) Frame = -3 Query: 271 RPPPPPLW*PPPP------PPLW*PPPPPPPPPPPPVPGRSLDPPP 152 RPPPPP PPPP PP PPPP PPPPPPP P PPP Sbjct: 283 RPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPP 328 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 338 PPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPP 375 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PP PPPPPPP P P S PPP Sbjct: 313 PPPPPPRPPPPSPP---PPSPPPPPPPSPPPPPSPPPPP 348 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 404 PPPPPPSPPPPPPPRPPPPSPPPPSPPPPSP-----PPP 437 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 243 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 281 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPPPPPP PPP P PPP Sbjct: 312 PPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPP 350 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPP PPPP PP P PPP Sbjct: 345 PPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 383 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPP P PPP PPPP PPP P S PPP Sbjct: 380 PPPPPPPRPPPPSP---PPPSPPPPSPPPPPPPSPPPPP 415 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -3 Query: 271 RPPPPPLW*PPPPPPLW*PPPPP-PPPPPPPVPGRSLDPPP 152 RPPPP P PPPP PPPPP PPPPPPP P PPP Sbjct: 387 RPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPP 427 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 295 PSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPP 333 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PP PPPP PPPP P PPP Sbjct: 332 PPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 370 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP P PPPP PPPP P S PPP Sbjct: 372 PPPPPPPSPPPPPP---PRPPPPSPPPPSPPPPSPPPPP 407 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = -3 Query: 265 PPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPP PP PPP PPP PPPP PPP P S PPP Sbjct: 235 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 272 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P R P P Sbjct: 355 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSP 393 [246][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 26/39 (66%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PPP PPPP PPP P S PPP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 213 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 176 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 214 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPPPPP PP PPPP PPPP P PPP Sbjct: 202 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPP--PPPPPPVPGRSLDPPP 152 PPPPP PP PPP PPPPPP PPPPPP P PPP Sbjct: 185 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 225 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPPPPP PPPPPPP PPPP P PPP Sbjct: 194 PSPPPPSPPPPPPPS--PPPPPPPSPPPPSPPPPSPPPP 230 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 PPPPP PPP PP PPPP PPPP PP P PPP Sbjct: 210 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPP PPPPPPP P PPP Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = -3 Query: 268 PPPPPLW*PPPPPPLW*PPPPPPPPPPPPVPGRSLDPPP 152 P PPP PPP PP PPPPPPP PPPP P PPP Sbjct: 220 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 [247][TOP] >UniRef100_B8AP37 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AP37_ORYSI Length = 139 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = +3 Query: 162 SRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSG 287 SR G GGGGG GGGGGGY G GGGGY GGGGG R G Sbjct: 86 SRRSGGGGGGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREG 127 [248][TOP] >UniRef100_B7QNG2 Glycine-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QNG2_IXOSC Length = 138 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/47 (61%), Positives = 30/47 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSP 293 GGG G GGGGGGGGGGGG GGGGGG GGGGG G+P Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAP 50 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 41 [249][TOP] >UniRef100_B7QAD8 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QAD8_IXOSC Length = 164 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/62 (51%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSP----RLQEFGTRI 320 GGG G GGGGGGGGGGGG GGGGGG GGGGG + SP R+ F + Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGTGPQRSPKSTRRIHPFTAKT 103 Query: 321 LT 326 +T Sbjct: 104 IT 105 Score = 60.1 bits (144), Expect = 4e-07 Identities = 31/56 (55%), Positives = 33/56 (58%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTRI 320 GGG G GGGGGGGGGGGG GGGGGG GGGGG +G R + RI Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGTGPQRSPKSTRRI 96 Score = 59.3 bits (142), Expect = 6e-07 Identities = 30/55 (54%), Positives = 31/55 (56%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQEFGTR 317 GGG G GGGGGGGGGGGG GGGGGG GGGGG P+ TR Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGTGPQRSPKSTR 94 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGS 290 GGG G GGGGGGGGGGGG GGGGGG GGGGG G+ Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGT 84 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 40 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 41 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 42 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 43 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 6 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 44 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 45 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 8 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 46 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 47 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 10 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 48 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 11 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 49 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 12 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 50 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 13 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 14 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 52 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 15 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 53 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 16 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 54 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 17 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 55 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 18 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 56 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 19 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 57 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 20 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 58 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 21 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 59 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 22 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 60 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 23 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 24 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 62 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 25 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 65 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 30 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 68 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 31 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 71 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 [250][TOP] >UniRef100_B7PYQ7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PYQ7_IXOSC Length = 209 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/55 (56%), Positives = 34/55 (61%) Frame = +3 Query: 105 DSAPGSLLASTVDAIIGGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 DS ++L S+ GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 122 DSCRETILGSSRGKAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 176 Score = 59.7 bits (143), Expect = 5e-07 Identities = 28/40 (70%), Positives = 28/40 (70%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGR 272 GGG G GGGGGGGGGGGG GGGGGG GGGGGR Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 41 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 39 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 177 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 178 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 179 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 180 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 181 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 182 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 145 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 183 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 146 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 184 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 147 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 185 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 148 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 186 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 149 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 187 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 150 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 188 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 151 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 189 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 152 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 153 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 191 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 192 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 163 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 164 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 165 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 169 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 170 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = +3 Query: 153 GGGSRLLPGTGGGGGGGGGGGGYHNGGGGGGYHNGGGGG 269 GGG G GGGGGGGGGGGG GGGGGG GGGGG Sbjct: 171 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 209 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPR 296 G GGGGGGGGGGGG GGGGGG GGGGG G R Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 41 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +3 Query: 177 GTGGGGGGGGGGGGYHNGGGGGGYHNGGGGGRSRTSGSPRLQ 302 G GGGGGGGGGGGG GGGGGG GGGGG G ++ Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGREIR 44