[UP]
[1][TOP] >UniRef100_O22612 Dormancy-associated protein n=1 Tax=Pisum sativum RepID=O22612_PEA Length = 129 Score = 72.4 bits (176), Expect = 8e-11 Identities = 35/58 (60%), Positives = 36/58 (62%), Gaps = 11/58 (18%) Frame = +1 Query: 40 YGFRGRRYL*A*YRNGGGGYNGGGGYHNGG-----------GGGGYHNGGGGGGGGGG 180 YG G + Y NGGGGYNGGGGYHNGG GGGGYHNGGGG GGGG Sbjct: 47 YGRGGGYHNGGGYHNGGGGYNGGGGYHNGGGGYNGGGGYHNGGGGYHNGGGGYNGGGG 104 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/46 (69%), Positives = 32/46 (69%), Gaps = 11/46 (23%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGG-----------GGGGYHNGGGGGGGGGG 180 Y NGGGGYNGGGGYHNGG GGGGYHNGGGG GGGG Sbjct: 72 YHNGGGGYNGGGGYHNGGGGYHNGGGGYNGGGGYHNGGGGYHGGGG 117 Score = 65.9 bits (159), Expect = 8e-09 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 Y NGGGGYNGGGGYHN GGGGYH GGG GG GG Sbjct: 92 YHNGGGGYNGGGGYHN--GGGGYHGGGGHGGHGG 123 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 10/40 (25%) Frame = +1 Query: 91 GGYNGGGGYHNGG----------GGGGYHNGGGGGGGGGG 180 GGY GGGYHNGG GGGGYHNGGGG GGGG Sbjct: 45 GGYGRGGGYHNGGGYHNGGGGYNGGGGYHNGGGGYNGGGG 84 [2][TOP] >UniRef100_A0R4Q4 Putative uncharacterized protein n=1 Tax=Mycobacterium smegmatis str. MC2 155 RepID=A0R4Q4_MYCS2 Length = 93 Score = 70.5 bits (171), Expect = 3e-10 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP W PPPPPP+W PPPP PPPP Sbjct: 49 PPPPPPPPPPFWRPPPPPPIWLPPPP--PPPP 78 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 8/39 (20%) Frame = -3 Query: 176 PPPPPPPPPLW----*PPPPPPLW*PPPP----L*PPPP 84 PPPPPPPPP W PPPPPP W PPPP L PPPP Sbjct: 37 PPPPPPPPPFWGPPPPPPPPPPFWRPPPPPPIWLPPPPP 75 [3][TOP] >UniRef100_P37703 Glycine-rich protein DC9.1 n=1 Tax=Daucus carota RepID=GRP9_DAUCA Length = 144 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/39 (76%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 Y NGGGGYN GGGYHNGGG GGGYHNGGGG GGG Sbjct: 44 YHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 82 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/39 (76%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 Y NGGGGYN GGGYHNGGG GGGYHNGGGG GGG Sbjct: 57 YHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 95 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/39 (74%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 Y NGGGGYN GGGYHNGGG GGG+HNGGGG GGG Sbjct: 70 YHNGGGGYNNGGGYHNGGGGYNNGGGHHNGGGGYNNGGG 108 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 Y NGGGGYN GGG+HN GGGGY+NGGG GGGG Sbjct: 83 YHNGGGGYNNGGGHHN--GGGGYNNGGGHHGGGG 114 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 4/33 (12%) Frame = +1 Query: 94 GYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 GYN GGGYHNGGG GGGYHNGGGG GGG Sbjct: 37 GYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 69 [4][TOP] >UniRef100_P11898 Glycine-rich protein HC1 n=1 Tax=Chenopodium rubrum RepID=GRP1_CHERU Length = 144 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/39 (76%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 Y NGGGGYN GGGYHNGGG GGGYHNGGGG GGG Sbjct: 44 YHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 82 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/39 (76%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 Y NGGGGYN GGGYHNGGG GGGYHNGGGG GGG Sbjct: 57 YHNGGGGYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 95 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/39 (74%), Positives = 30/39 (76%), Gaps = 4/39 (10%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 Y NGGGGYN GGGYHNGGG GGG+HNGGGG GGG Sbjct: 70 YHNGGGGYNNGGGYHNGGGGYNNGGGHHNGGGGYNNGGG 108 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 Y NGGGGYN GGG+HN GGGGY+NGGG GGGG Sbjct: 83 YHNGGGGYNNGGGHHN--GGGGYNNGGGYHGGGG 114 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%), Gaps = 4/33 (12%) Frame = +1 Query: 94 GYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 GYN GGGYHNGGG GGGYHNGGGG GGG Sbjct: 37 GYNNGGGYHNGGGGYNNGGGYHNGGGGYNNGGG 69 [5][TOP] >UniRef100_B3MYN1 GF22178 n=1 Tax=Drosophila ananassae RepID=B3MYN1_DROAN Length = 223 Score = 69.3 bits (168), Expect = 7e-10 Identities = 29/40 (72%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGG--GGGGGGEIV 189 Y GGGGYNGGGGYH GGGGG Y GGGG GGGGGG+ + Sbjct: 74 YHGGGGGYNGGGGYHGGGGGGNYGGGGGGYHGGGGGGKTI 113 Score = 62.4 bits (150), Expect = 8e-08 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 7/42 (16%) Frame = +1 Query: 76 YRNGGGGYN-GGGGYHNGG----GGGGYHNGGGGG--GGGGG 180 + GGGGYN GGGGYH GG GGGGYH GGGGG GGGGG Sbjct: 60 FNGGGGGYNGGGGGYHGGGGGYNGGGGYHGGGGGGNYGGGGG 101 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = +1 Query: 85 GGGGY--NGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGGYH GGGGGG GGGGGGGGGG Sbjct: 152 GGGGYPGGGGGGYHGGGGGGGPQWGGGGGGGGGG 185 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG+NGGGG +N GGGGGYH GGGG GGGG Sbjct: 56 GGGGFNGGGGGYN-GGGGGYHGGGGGYNGGGG 86 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 4/36 (11%) Frame = +1 Query: 85 GGGGYNGGGGY-HNGGGGGGYHNGGGGGG---GGGG 180 GGGGY+GGGG + GGGGGGYH GGGGGG GGGG Sbjct: 144 GGGGYHGGGGGGYPGGGGGGYHGGGGGGGPQWGGGG 179 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/41 (65%), Positives = 30/41 (73%), Gaps = 6/41 (14%) Frame = +1 Query: 76 YRNGGGGYN----GGGGYHNGGGGGGYHNGGGGG--GGGGG 180 Y +GGGG + GGGG + GGGGGGYH GGGGG GGGGG Sbjct: 122 YSSGGGGGHRWGGGGGGGYGGGGGGGYHGGGGGGYPGGGGG 162 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/36 (77%), Positives = 28/36 (77%), Gaps = 4/36 (11%) Frame = +1 Query: 85 GGGGYNGGGG--YHNGGGGGGYHNGGGGG--GGGGG 180 GGGGY GGGG YH GGGGGGY GGGGG GGGGG Sbjct: 136 GGGGYGGGGGGGYH-GGGGGGYPGGGGGGYHGGGGG 170 [6][TOP] >UniRef100_B4H321 GL13352 n=1 Tax=Drosophila persimilis RepID=B4H321_DROPE Length = 191 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGGG+NGGGGY + GGGGG+HNGGGGGGGGGG Sbjct: 106 NGGGGHNGGGGYPS-GGGGGFHNGGGGGGGGGG 137 [7][TOP] >UniRef100_A7YFB9 Glycine-rich protein n=1 Tax=Lilium formosanum RepID=A7YFB9_9LILI Length = 135 Score = 66.2 bits (160), Expect = 6e-09 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 4/37 (10%) Frame = +1 Query: 82 NGGGGYNGGGGYHNG----GGGGGYHNGGGGGGGGGG 180 +GGGGY GGGGYHNG GGGGGYHNGGG GGGGG Sbjct: 53 SGGGGYPGGGGYHNGGGYQGGGGGYHNGGGYQGGGGG 89 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 4/34 (11%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNG----GGGGGYHNGGGGG 165 Y NGGG GGGGYHNG GGGGGYHNGGGGG Sbjct: 64 YHNGGGYQGGGGGYHNGGGYQGGGGGYHNGGGGG 97 [8][TOP] >UniRef100_B5DKG6 GA22867 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DKG6_DROPS Length = 191 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 NGGGG+NGGGGY + GGGGG+HNGGGGGGGGG Sbjct: 109 NGGGGHNGGGGYPS-GGGGGFHNGGGGGGGGG 139 [9][TOP] >UniRef100_B4M7I0 GJ16994 n=1 Tax=Drosophila virilis RepID=B4M7I0_DROVI Length = 205 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = +1 Query: 43 GFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 G++G Y Y+ GGGY GGGG+ GGG GGYH GGGGGGGGGG Sbjct: 124 GYQGGGYQSGGYQ--GGGYQGGGGHQGGGGIGGYHGGGGGGGGGGG 167 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/59 (50%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Frame = +1 Query: 7 MLQVDSRGLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNG---GGGGGYHNGGGGGGGG 174 +LQ+ + L +G G GGGGY GGGGY G GGGGGYH GGG GGGG Sbjct: 27 LLQLKKKLLFGHGGGG----------GGGGYGGGGGYGGGGGYGGGGGYHGGGGYGGGG 75 [10][TOP] >UniRef100_B4IZJ4 GH14508 n=1 Tax=Drosophila grimshawi RepID=B4IZJ4_DROGR Length = 272 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 GGGGY GGGGY GGGGGGY GGGGG GGGG+ Sbjct: 66 GGGGYGGGGGYGGGGGGGGYGGGGGGGYGGGGD 98 [11][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 T ++PPPPPPPPPP PPPPPP PPPP PPPP++ Sbjct: 39 TAVNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIK 76 [12][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 63.2 bits (152), Expect = 5e-08 Identities = 30/52 (57%), Positives = 33/52 (63%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRPL 24 PPPPPPPPPP PPPPPP PPPP PPPP R A + + +P D PL Sbjct: 69 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDA--WTQEPSPLDRDPL 118 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 [13][TOP] >UniRef100_C5CSB2 RNP-1 like RNA-binding protein n=1 Tax=Variovorax paradoxus S110 RepID=C5CSB2_VARPS Length = 181 Score = 63.2 bits (152), Expect = 5e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 R+GGGGY GGGG + GGGGGGY GGGGG GGGG Sbjct: 88 RSGGGGYGGGGGGYGGGGGGGYGGGGGGGYGGGG 121 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGG--GGGGG 180 Y GGGGY GGGG GGGGGG + GGGGG GGGGG Sbjct: 94 YGGGGGGYGGGGGGGYGGGGGGGYGGGGGGRSGGGGG 130 [14][TOP] >UniRef100_A6RXS7 Putative uncharacterized protein n=1 Tax=Botryotinia fuckeliana B05.10 RepID=A6RXS7_BOTFB Length = 197 Score = 63.2 bits (152), Expect = 5e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 +GGGGY+GGGGY+ GGGGGGY GGGGG GGG Sbjct: 147 SGGGGYSGGGGYNGGGGGGGYSGGGGGGYSGGG 179 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 5/38 (13%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGG---GGGGYHNGGGGGG--GGGG 180 N GGGY+GGGGY GG GGGGY+ GGGGGG GGGG Sbjct: 135 NSGGGYSGGGGYSGGGGYSGGGGYNGGGGGGGYSGGGG 172 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 7/40 (17%) Frame = +1 Query: 82 NGGGGYNGGGGY-----HNGGGGGGYHNGGGGGG--GGGG 180 +GGGGY+GGGGY +NGGGGGG ++GGGGGG GGGG Sbjct: 141 SGGGGYSGGGGYSGGGGYNGGGGGGGYSGGGGGGYSGGGG 180 [15][TOP] >UniRef100_UPI00016C3DAE RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C3DAE Length = 144 Score = 62.8 bits (151), Expect = 6e-08 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 R GGGGY GGGG + GGGGGGY GGG GGGGGG Sbjct: 86 RGGGGGYGGGGGGYGGGGGGGYGGGGGYGGGGGG 119 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/37 (70%), Positives = 26/37 (70%), Gaps = 5/37 (13%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGG-----GGYHNGGGGGGGGGG 180 GGGGY GGGGY GGGG GGY GGGG GGGGG Sbjct: 103 GGGGYGGGGGYGGGGGGRRGGGGGYGGGGGGYGGGGG 139 [16][TOP] >UniRef100_Q9VD49 CG5778, isoform A n=1 Tax=Drosophila melanogaster RepID=Q9VD49_DROME Length = 117 Score = 62.8 bits (151), Expect = 6e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGG 174 Y G GG GGGGY+ GGGGGGY+NGGGGGGGG Sbjct: 42 YTGGNGGRGGGGGYNAGGGGGGYYNGGGGGGGG 74 Score = 58.5 bits (140), Expect = 1e-06 Identities = 30/51 (58%), Positives = 31/51 (60%), Gaps = 17/51 (33%) Frame = +1 Query: 79 RNGGGGYN---GGGGYHNGGGGGG--------------YHNGGGGGGGGGG 180 R GGGGYN GGGGY+NGGGGGG Y NGGGGGGGG G Sbjct: 49 RGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYG 99 [17][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 62.4 bits (150), Expect = 8e-08 Identities = 34/64 (53%), Positives = 34/64 (53%), Gaps = 9/64 (14%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPR---------NPY 39 TT PPPPPPPPPP PPPPPP PPPP PPPP RRPR PY Sbjct: 74 TTPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPPRRRPRPYYGHGWWPRPY 130 Query: 38 DSRP 27 D P Sbjct: 131 DYYP 134 [18][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNP 42 PPPPPPPPPP PPPPP + PPPP PPPP AY Y P P Sbjct: 247 PPPPPPPPPPAAYGPPPPPAYGPPPP--PPPPPPPAAYAYGPPPPP 290 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRY 75 PPPPPPPPPP + PPPPP PPPP PPPP Y Sbjct: 141 PPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAY 175 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRY 75 PPPPPPPPPP + PPPPP PPPP PPPP Y Sbjct: 164 PPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAY 198 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRY 75 PPPPPPPPPP + PPPPP PPPP PPPP Y Sbjct: 187 PPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAY 221 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRY 75 PPPPPPPPPP + PPPPP PPPP PPPP Y Sbjct: 210 PPPPPPPPPPAYGPPPPPAYGPPPPPPPPPPPPAY 244 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/35 (68%), Positives = 25/35 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRY 75 PPPPPPPPPP + PPPPP PPPP PPPP Y Sbjct: 118 PPPPPPPPPPSYGPPPPPAYGPPPPPPPPPPPPAY 152 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 4/38 (10%) Frame = -3 Query: 176 PPPPPPPPPLW*PPPPPPLW*PPPP----L*PPPPLRY 75 PPPPPPPPP + PPPPPP + PPPP PPPP +Y Sbjct: 331 PPPPPPPPPAYAPPPPPPAYAPPPPPPAYAPPPPPPKY 368 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP + PPPP PPPP Sbjct: 117 PPPPPPPPPPPSYGPPPPPAYGPPPPPPPPPP 148 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP + PPPP PPPP Sbjct: 140 PPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPP 171 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP + PPPP PPPP Sbjct: 163 PPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPP 194 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP + PPPP PPPP Sbjct: 186 PPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPP 217 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP + PPPP PPPP Sbjct: 209 PPPPPPPPPPPAYGPPPPPAYGPPPPPPPPPP 240 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP + PPPP PPPP Sbjct: 287 PPPPPPPPPPPAYSPPPPPAYGPPPP--PPPP 316 [19][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYR 63 PPPPPPPPPP PPPPPP PPPP PPPP QA R Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQR 71 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 TRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +T PPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 STRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [20][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/57 (52%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRP-----RNPYDSRPL 24 PPPPPPPPPP PPPPPP PPPP PPPP + Y P R+ D+RP+ Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQADPPAVPDRHRRDARPV 57 [21][TOP] >UniRef100_Q7Y087 GBR5 n=1 Tax=Panax ginseng RepID=Q7Y087_PANGI Length = 123 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGG---GGGGYHNGGGGGGGG 174 +GGGGY+GGGGYH GG GGGGYH GGG GGGG Sbjct: 61 HGGGGYHGGGGYHGGGGYHGGGGYHGGGGHGGGG 94 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/37 (75%), Positives = 29/37 (78%), Gaps = 5/37 (13%) Frame = +1 Query: 85 GGGGYNGGGGYHNGG---GGGGYHNGGG--GGGGGGG 180 GGGGY+GGGGYH GG GGGGYH GGG GGGG GG Sbjct: 56 GGGGYHGGGGYHGGGGYHGGGGYHGGGGYHGGGGHGG 92 [22][TOP] >UniRef100_Q20BN3 GBR5-like protein n=1 Tax=Panax ginseng RepID=Q20BN3_PANGI Length = 129 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGG---GGGGYHNGGGGGGGG 174 +GGGGY+GGGGYH GG GGGGYH GGG GGGG Sbjct: 67 HGGGGYHGGGGYHGGGGYHGGGGYHGGGGHGGGG 100 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 5/38 (13%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGG---GGGGYHNGGG--GGGGGGG 180 +GGGGY+GGGGYH GG GGGGYH GGG GGGG GG Sbjct: 61 HGGGGYHGGGGYHGGGGYHGGGGYHGGGGYHGGGGHGG 98 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 3/34 (8%) Frame = +1 Query: 85 GGGGYNGGGGYHNGG---GGGGYHNGGGGGGGGG 177 GGGGY+GGGGYH GG GGGGYH GGG GGGG Sbjct: 56 GGGGYHGGGGYHGGGGYHGGGGYHGGGGYHGGGG 89 [23][TOP] >UniRef100_B4PLK3 GE24060 n=1 Tax=Drosophila yakuba RepID=B4PLK3_DROYA Length = 116 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/46 (63%), Positives = 30/46 (65%), Gaps = 14/46 (30%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGG--------------YHNGGGGGGGGGG 180 GGGGYNGGGG +NGGGGGG Y NGGGGGGGGGG Sbjct: 53 GGGGYNGGGGGYNGGGGGGGGRRPVYSGNFGPGYSNGGGGGGGGGG 98 [24][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPPP Q++R+ Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFRF 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 [25][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 PPPPPPPPPP PPPPPP PPPP PPPPLR Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLR 40 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/51 (56%), Positives = 30/51 (58%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRP 27 PPPPPPPPPP PPPPPP PPPP PPPP R + R P RP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPSAVRP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 [26][TOP] >UniRef100_B4NCX9 GK10119 n=1 Tax=Drosophila willistoni RepID=B4NCX9_DROWI Length = 201 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 5/40 (12%) Frame = +1 Query: 76 YRNGGGGYNGGGG---YHNGGGGGGYHNGGGGG--GGGGG 180 Y+ GGGG++GGGG YH GGGGGGY GGGGG GGGGG Sbjct: 97 YQGGGGGHHGGGGGGGYHGGGGGGGYPGGGGGGYHGGGGG 136 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 6/38 (15%) Frame = +1 Query: 85 GGGGYN--GGGGYHNGGGGGGYHNGGGGGGG----GGG 180 GGGGY+ GGGG + GGGGGGYH GGGGGGG GGG Sbjct: 109 GGGGYHGGGGGGGYPGGGGGGYHGGGGGGGGYPQWGGG 146 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/54 (51%), Positives = 30/54 (55%), Gaps = 19/54 (35%) Frame = +1 Query: 76 YRNGGGG-----------------YNGGGGYHNGGGGGGYHNGGGGGG--GGGG 180 Y +GGGG GGGG+H GGGGGGYH GGGGGG GGGG Sbjct: 74 YGHGGGGGGRGGTTIDVYVVKPVYQGGGGGHHGGGGGGGYHGGGGGGGYPGGGG 127 [27][TOP] >UniRef100_B4NC76 GK25807 n=1 Tax=Drosophila willistoni RepID=B4NC76_DROWI Length = 234 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/58 (60%), Positives = 35/58 (60%), Gaps = 5/58 (8%) Frame = +1 Query: 22 SRGLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGG---GGGGYHNGGG--GGGGGGG 180 S GLL G G Y NGGGGY GGGG H GG GGGGY GGG GGGGGGG Sbjct: 19 SAGLLGGGGGGGGYGGGGGGNGGGGYGGGGGSHGGGGGNGGGGYGGGGGSHGGGGGGG 76 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 6/39 (15%) Frame = +1 Query: 82 NGGGGYNG----GGGYHNGGGGGGYHNGGGGGGG--GGG 180 NGGGGY G GGG H GGGGGGY GGGGGG GGG Sbjct: 179 NGGGGYGGNGGGGGGKHGGGGGGGYGGNGGGGGGKHGGG 217 [28][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPPL PPPP Sbjct: 424 LPPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPP 457 [29][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYR 63 PPPPPPPPPPL PPPPPPL P PP PPPPL+ Q ++ Sbjct: 272 PPPPPPPPPPLPPPPPPPPL-PPQPPPPPPPPLQPQQHK 309 [30][TOP] >UniRef100_Q3ANN6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. CC9605 RepID=Q3ANN6_SYNSC Length = 173 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 R GGGGY GGGG GGGGGGY GGGGG GGGG Sbjct: 85 RRGGGGYGGGGGGGYGGGGGGYRGGGGGGYGGGG 118 [31][TOP] >UniRef100_Q41188 Glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q41188_ARATH Length = 203 Score = 61.2 bits (147), Expect = 2e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGGY GGGGGGY GG GGGGGGG Sbjct: 151 YGGGGGGYGGGGGY--GGGGGGYGGGGRGGGGGGG 183 [32][TOP] >UniRef100_Q2PF07 Putative uncharacterized protein (Fragment) n=1 Tax=Trifolium pratense RepID=Q2PF07_TRIPR Length = 149 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 5/40 (12%) Frame = +1 Query: 76 YRNGGGGYN--GGGGYHNGGG---GGGYHNGGGGGGGGGG 180 Y NGGG Y+ GG GYHNGGG GGGYH+GGG GG GGG Sbjct: 99 YHNGGGSYHNGGGSGYHNGGGYHNGGGYHHGGGHGGHGGG 138 [33][TOP] >UniRef100_Q09134 Abscisic acid and environmental stress-inducible protein n=1 Tax=Medicago sativa subsp. falcata RepID=GRPA_MEDFA Length = 159 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 6/41 (14%) Frame = +1 Query: 76 YRNGGGGYN-GGGGYHNGG-----GGGGYHNGGGGGGGGGG 180 Y NGGGGYN GGGGY+NGG GGGGY+NGGGG GGG Sbjct: 73 YNNGGGGYNHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGG 113 Score = 59.3 bits (142), Expect = 7e-07 Identities = 28/52 (53%), Positives = 33/52 (63%), Gaps = 5/52 (9%) Frame = +1 Query: 40 YGFRGRRYL*A*YRNGGGGYNGGGGYHNGG-----GGGGYHNGGGGGGGGGG 180 Y G Y Y +GGGGYN GGGY++GG GGGGY++GGGG GGG Sbjct: 41 YNHGGGGYNGGGYNHGGGGYNNGGGYNHGGGGYNNGGGGYNHGGGGYNNGGG 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 5/40 (12%) Frame = +1 Query: 76 YRNGGGGYN-GGGGYHNGGG----GGGYHNGGGGGGGGGG 180 Y NGGGGYN GGGGY+NGGG GGG +NGGG GGGG Sbjct: 87 YNNGGGGYNHGGGGYNNGGGGYNHGGGGYNGGGYNHGGGG 126 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 6/39 (15%) Frame = +1 Query: 82 NGGGGYN-GGGGYHNGG-----GGGGYHNGGGGGGGGGG 180 N GGGYN GGGGY+NGG GGGGY+NGGGG GGG Sbjct: 61 NNGGGYNHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGG 99 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/40 (65%), Positives = 31/40 (77%), Gaps = 6/40 (15%) Frame = +1 Query: 76 YRNGGGGY-NGGGGYHNGG-----GGGGYHNGGGGGGGGG 177 Y +GGGGY NGGGGY++GG GGGGY++GGGG GGG Sbjct: 80 YNHGGGGYNNGGGGYNHGGGGYNNGGGGYNHGGGGYNGGG 119 [34][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPPL PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 272 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 233 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 232 VVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPL---W*PPPPL*PPPP 84 PPPPPPPPPP PPPPPPL PPPPL PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 [35][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPP PPPPPL PPPPPP PPPPL PPPP Sbjct: 82 LPPPPPLPPPPPLPPPPPPPPPLPPPPPLPPPPP 115 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 ++ PPPP PPPPPL PPP PP PPPPL PPPPL Sbjct: 75 SVPPPPPLPPPPPLPPPPPLPPPPPPPPPLPPPPPL 110 [36][TOP] >UniRef100_A3WBS5 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBS5_9SPHN Length = 378 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 2/66 (3%) Frame = -3 Query: 275 DFEVDGID--KIEIEFGTRKKTKELV*D*GTTISPPPPPPPPPPLW*PPPPPPLW*PPPP 102 +FE+D + IE++ + L+ + G +PPPPPPPPPP PPPPPP PPP Sbjct: 197 EFEIDAANGNPIEVDCQSHSVMASLIWNLGGQAAPPPPPPPPPP---PPPPPPPPLPPPA 253 Query: 101 L*PPPP 84 PPPP Sbjct: 254 PPPPPP 259 [37][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP++ PPPPPP PPP PPPP Sbjct: 437 SPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Score = 60.5 bits (145), Expect = 3e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP++ PPPPPP PPPP+ PPP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 59.3 bits (142), Expect = 7e-07 Identities = 24/38 (63%), Positives = 28/38 (73%), Gaps = 6/38 (15%) Frame = -3 Query: 179 PPPPPPPPPPLW------*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP++ PPPPPP++ PPPP PPPP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/39 (58%), Positives = 29/39 (74%), Gaps = 4/39 (10%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPP----LW*PPPPL*PPPP 84 T++ PPPP PPPP++ PPPPPP ++ PPPP PPPP Sbjct: 422 TLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQA 69 PP PPPPPPP++ PPPPPP PPP PPPP Y + Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSS 520 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/51 (52%), Positives = 29/51 (56%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRP 27 PPPPPPPPPP++ PPPPP PPP PP P Y R P P S P Sbjct: 499 PPPPPPPPPPVYSPPPPPVYSSPPP---PPSPAPTPVYCTRPPPPPPHSPP 546 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/37 (64%), Positives = 26/37 (70%), Gaps = 5/37 (13%) Frame = -3 Query: 179 PPPPPPP-----PPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPP PPP PPPPPP++ PPPP PPPP Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = -3 Query: 179 PPPPPP------PPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPP PPPP PPPPPP++ PPPP PPPP Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 [38][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPPL PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 102 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 61 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 [39][TOP] >UniRef100_UPI0000E491FD PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E491FD Length = 116 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 Y +GGGG GGGG +GGGGGGY +GGGGGGGGGG+ Sbjct: 24 YSSGGGGSGGGGG-DSGGGGGGYSSGGGGGGGGGGD 58 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 Y +GGGG GGGG +GGGGGGY +GGGGGGGGGG+ Sbjct: 45 YSSGGGGGGGGGG-DSGGGGGGYSSGGGGGGGGGGD 79 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y +GGGG GGGG +GGGGGGY +GGGGGGGGGG Sbjct: 66 YSSGGGGGGGGGG-DSGGGGGGYSSGGGGGGGGGG 99 [40][TOP] >UniRef100_B2ICA8 Putative uncharacterized protein n=1 Tax=Beijerinckia indica subsp. indica ATCC 9039 RepID=B2ICA8_BEII9 Length = 152 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 +R GGGG++GGGG +GGGGGG+H GGGG GGGG Sbjct: 116 WRGGGGGWHGGGGGWHGGGGGGWHGGGGGHGGGG 149 [41][TOP] >UniRef100_Q062H8 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. BL107 RepID=Q062H8_9SYNE Length = 229 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG + GGGGGGY GGGGG GGGG Sbjct: 119 GGGGYGGGGGGYGGGGGGGYGGGGGGGYGGGG 150 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG GGGGGG + GGGGGG GGG Sbjct: 123 YGGGGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGG 157 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG GGGGGG + GGGGGG GGG Sbjct: 134 GGGGYGGGGGGGYGGGGGGGYGGGGGGGYGGG 165 [42][TOP] >UniRef100_Q0UIP7 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0UIP7_PHANO Length = 668 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 Y GGGGY GGGG ++GGGGGGY GG GGGGGG Sbjct: 258 YGGGGGGYGGGGGGYSGGGGGGYGGGGYGGGGGG 291 [43][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 TT PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 852 TTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 937 PPPPPPPPPPPPPPPPPPPPPPPPPPGAPPPP 968 [44][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/46 (60%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL--RYQAYRYRRPR 48 PPPPPPPPPP PPPPPP PPPP PPPPL +Y + PR Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKPPR 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 [45][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 486 LSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQA 69 PPPPPPPPPP PPPPPP PPPP PPPP +++ Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKS 534 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 [46][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 60.5 bits (145), Expect = 3e-07 Identities = 32/64 (50%), Positives = 35/64 (54%), Gaps = 5/64 (7%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRY-----QAYRYRRPRNPYDSRPLEST 15 PPPPPPPPPP PPPPPP PPPP PPPP + A ++ R R SR S Sbjct: 1 PPPPPPPPPPP--PPPPPPPPPPPPPPPPPPPTQEDLAGGNAPQHLRTRRRRRSRGRRSR 58 Query: 14 CSMH 3 C H Sbjct: 59 CETH 62 [47][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 60.5 bits (145), Expect = 3e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP+ PPPP PPPP Sbjct: 140 PPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPP 171 [48][TOP] >UniRef100_UPI0000DB7D2A PREDICTED: hypothetical protein, partial n=1 Tax=Apis mellifera RepID=UPI0000DB7D2A Length = 121 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +1 Query: 61 YL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIV 189 Y+ + + GGGG+NGGG + GGGGGG+ GGGGGGGGGG+I+ Sbjct: 27 YISSGWSGGGGGWNGGG-WSGGGGGGGWKYGGGGGGGGGGKII 68 [49][TOP] >UniRef100_Q7UA83 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Synechococcus sp. WH 8102 RepID=Q7UA83_SYNPX Length = 214 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 10/45 (22%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHN----------GGGGGGYHNGGGGGGGGGG 180 YR GGGGY GGGGY GGGGGGY GGGG GGGGG Sbjct: 91 YRGGGGGYGGGGGYGGGGGRDGGGGYGGGGGGYRGGGGGYGGGGG 135 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/47 (61%), Positives = 30/47 (63%) Frame = +1 Query: 40 YGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 YG G R Y GGGGY GGGG + GGGGGG GGG GGGGGG Sbjct: 104 YGGGGGRDGGGGYGGGGGGYRGGGGGYGGGGGGGRDGGGGYGGGGGG 150 [50][TOP] >UniRef100_B4UMN2 CHRD domain containing protein n=1 Tax=Anaeromyxobacter sp. K RepID=B4UMN2_ANASK Length = 411 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 GGGGY GGGG GGGGGGY +GGGGGGGGGG+ Sbjct: 24 GGGGYGGGGG---GGGGGGYGDGGGGGGGGGGD 53 [51][TOP] >UniRef100_Q07202 Cold and drought-regulated protein CORA n=1 Tax=Medicago sativa RepID=CORA_MEDSA Length = 204 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y +GGGGYNGGGG H G GGGGY+ GGG GG GGG Sbjct: 85 YNHGGGGYNGGGG-HGGHGGGGYNGGGGHGGHGGG 118 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 Y NGGGGYN GGG +NGGGG G H GGG GGGG Sbjct: 78 YHNGGGGYNHGGGGYNGGGGHGGHGGGGYNGGGG 111 Score = 58.9 bits (141), Expect = 9e-07 Identities = 31/52 (59%), Positives = 33/52 (63%), Gaps = 6/52 (11%) Frame = +1 Query: 43 GFRGRRYL*A*YRNGGGGYN-GGGGYHNGG-----GGGGYHNGGGGGGGGGG 180 G+ G Y N GGGYN GGGGYHNGG GGGGY+ GGG GG GGG Sbjct: 59 GYNGGGY------NHGGGYNHGGGGYHNGGGGYNHGGGGYNGGGGHGGHGGG 104 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIV 189 +GGGGYNGGGG H G GGGGY+ GGG GG GG E V Sbjct: 101 HGGGGYNGGGG-HGGHGGGGYNGGGGHGGHGGAESV 135 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/36 (72%), Positives = 26/36 (72%), Gaps = 3/36 (8%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGG---GGGGYHNGGGGGGGGGG 180 N GGGYNGGG H GG GGGGYHNGGGG GGG Sbjct: 55 NHGGGYNGGGYNHGGGYNHGGGGYHNGGGGYNHGGG 90 [52][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 SPPPPPPPPPP PPPPPP PPPP PPPP ++A + Sbjct: 305 SPPPPPPPPPPP--PPPPPPPPPPPPPPPPPPPPAFEAREF 343 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + + PPPPPPPPP PPPPPP PPPP PPPP Sbjct: 302 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [53][TOP] >UniRef100_A5VB72 Filamentous haemagglutinin family outer membrane protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5VB72_SPHWW Length = 1531 Score = 60.1 bits (144), Expect = 4e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 +SPPPPPPPPPP+ PPPPPP PPP PPPP+ Sbjct: 1262 VSPPPPPPPPPPVSPPPPPPPPPVSPPPPPPPPPV 1296 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 176 PPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPP+ PPPPPP+ PPPP PPPP Sbjct: 1287 PPPPPPPPPVSPPPPPPPVSPPPPP--PPPP 1315 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 +SPPPPPPPPP PPPPPP PPPP PPPP+ Sbjct: 1285 VSPPPPPPPPPVS--PPPPPPPVSPPPPPPPPPPV 1317 [54][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/48 (58%), Positives = 29/48 (60%), Gaps = 4/48 (8%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPP----L*PPPPLRYQAYRYRRP 51 SPPPPPP PPP PPPPPP PPPP + PPPP Q Y Y P Sbjct: 412 SPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 59.3 bits (142), Expect = 7e-07 Identities = 30/52 (57%), Positives = 30/52 (57%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRP 27 SPP PPPPPPP PPPPPP PPPP PPPP Y Y P P S P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-----YVYPSPPPPPPSPP 421 Score = 56.6 bits (135), Expect = 5e-06 Identities = 29/50 (58%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPP---PL*PPPPLRYQAYRYRRPRNPY 39 PPPPPPPPPP PPPPPP PPP P PPPP Y Y P PY Sbjct: 389 PPPPPPPPPP---PPPPPP---PPPYVYPSPPPPPPSPPPYVYPPPPPPY 432 [55][TOP] >UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO Length = 538 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/56 (50%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = -3 Query: 182 SPPPP----PPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRP 27 SPPPP PPPPPP++ PPPPPP++ PPPP PPP Y P +P P Sbjct: 273 SPPPPVYSPPPPPPPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPPPPPSPPPPSP 328 [56][TOP] >UniRef100_Q86BM9 CG33003, isoform A n=1 Tax=Drosophila melanogaster RepID=Q86BM9_DROME Length = 579 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPP R + Y Y Sbjct: 463 PPPPPPPPPP---PPPPPPPTEPPPPPPPPPEPRVKKYSY 499 [57][TOP] >UniRef100_B7Z017 CG33003, isoform B n=1 Tax=Drosophila melanogaster RepID=B7Z017_DROME Length = 604 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPP R + Y Y Sbjct: 488 PPPPPPPPPP---PPPPPPPTEPPPPPPPPPEPRVKKYSY 524 [58][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 60.1 bits (144), Expect = 4e-07 Identities = 27/41 (65%), Positives = 27/41 (65%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYR 57 PPPPPPPPPP PPPPPP PPPP PPPP R R R Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRR 49 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRR 54 PPPPPPPPPP PPPPPP PPPP PPPP ++ RR Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRR 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 [59][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 60.1 bits (144), Expect = 4e-07 Identities = 27/42 (64%), Positives = 27/42 (64%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRR 54 PPPPPPPPPP PPPPPP PPPP PPPP Y RR Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRR 57 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/36 (72%), Positives = 26/36 (72%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQ 72 PPPPPPPPPP PPPPPP PPPP PPPP R Q Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQ 50 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPPP RY Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRY 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [60][TOP] >UniRef100_B4NYJ9 GE18286 n=1 Tax=Drosophila yakuba RepID=B4NYJ9_DROYA Length = 622 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPP R + Y Y Sbjct: 506 PPPPPPPPPP---PPPPPPPTEPPPPPPPPPEPRVKKYSY 542 [61][TOP] >UniRef100_B3N3R7 GG25000 n=1 Tax=Drosophila erecta RepID=B3N3R7_DROER Length = 613 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPP R + Y Y Sbjct: 497 PPPPPPPPPP---PPPPPPPTEPPPPPPPPPEPRVKKYSY 533 [62][TOP] >UniRef100_B3MU38 GF21178 n=1 Tax=Drosophila ananassae RepID=B3MU38_DROAN Length = 608 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPP R + Y Y Sbjct: 491 PPPPPPPPPP---PPPPPPPTEPPPPPPPPPEPRVKKYSY 527 [63][TOP] >UniRef100_A5GHM5 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. WH 7803 RepID=A5GHM5_SYNPW Length = 207 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 GGGGY GGGG +N GGGGG + GGGGG GGGGE Sbjct: 96 GGGGYRGGGGGYNDGGGGGGYRGGGGGYGGGGE 128 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 10/43 (23%) Frame = +1 Query: 79 RNGGGGY----------NGGGGYHNGGGGGGYHNGGGGGGGGG 177 R GGGGY GGGGY++GGGGGGY GGGG GGGG Sbjct: 85 RRGGGGYGGGGGGGGYRGGGGGYNDGGGGGGYRGGGGGYGGGG 127 [64][TOP] >UniRef100_A6G1X8 Single-stranded DNA-binding protein n=1 Tax=Plesiocystis pacifica SIR-1 RepID=A6G1X8_9DELT Length = 198 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG GGGGY GGGGGGY GGGGGG GGG Sbjct: 115 GGGGRGGGGGYDGGGGGGGYGGGGGGGGYGGG 146 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 6/40 (15%) Frame = +1 Query: 79 RNGGGGYNGGGG---YHNGGGGGGYHNGGG---GGGGGGG 180 R GGGGY+GGGG Y GGGGGGY GGG GGGG GG Sbjct: 119 RGGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGG 158 [65][TOP] >UniRef100_B9PEE7 Predicted protein (Fragment) n=1 Tax=Populus trichocarpa RepID=B9PEE7_POPTR Length = 109 Score = 60.1 bits (144), Expect = 4e-07 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = +1 Query: 40 YGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 +GF G Y GGGG GGGG +GGGGGG +GGGGGGGGGGE Sbjct: 42 FGFGGGSY------GGGGGGGGGGGGGSGGGGGGGGSGGGGGGGGGGE 83 [66][TOP] >UniRef100_B9GMH2 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GMH2_POPTR Length = 152 Score = 60.1 bits (144), Expect = 4e-07 Identities = 29/48 (60%), Positives = 30/48 (62%) Frame = +1 Query: 40 YGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 +GF G Y GGGG GGGG GGGGGG GGGGGGGGGGE Sbjct: 85 FGFGGGSY------GGGGGGGGGGGGSGGGGGGGGSGGGGGGGGGGGE 126 [67][TOP] >UniRef100_B4JMZ8 GH24721 n=1 Tax=Drosophila grimshawi RepID=B4JMZ8_DROGR Length = 207 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 3/38 (7%) Frame = +1 Query: 76 YRNGGGGY-NGGGGYHNGGGGGGYHNGGGGG--GGGGG 180 Y GGGG+ GGGG H GGGGGGYH GGGGG GGGGG Sbjct: 53 YGGGGGGHPGGGGGGHPGGGGGGYHGGGGGGYHGGGGG 90 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGG--GGGGG 180 GGGGY GGGG H GGGGGG+ GGGGG GGGGG Sbjct: 49 GGGGYGGGGGGHPGGGGGGHPGGGGGGYHGGGGG 82 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/36 (77%), Positives = 29/36 (80%), Gaps = 4/36 (11%) Frame = +1 Query: 85 GGGGY--NGGGGYHNGGGGGGYHNGGGGG--GGGGG 180 GGGG+ GGGGYH GGGGGGYH GGGGG GGGGG Sbjct: 64 GGGGHPGGGGGGYH-GGGGGGYHGGGGGGYHGGGGG 98 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/43 (67%), Positives = 30/43 (69%), Gaps = 11/43 (25%) Frame = +1 Query: 85 GGGGYNGGG----GYHNGG---GGGGYHNGGGGGGG----GGG 180 GGGGY+GGG GYH GG GGGGYH GGGGGGG GGG Sbjct: 121 GGGGYHGGGAGGGGYHGGGGGVGGGGYHGGGGGGGGPQCCGGG 163 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 2/32 (6%) Frame = +1 Query: 85 GGGGYNGGGG--YHNGGGGGGYHNGGGGGGGG 174 GGGGY+GGGG YH GGGGGGYH GGGGGG G Sbjct: 72 GGGGYHGGGGGGYH-GGGGGGYHGGGGGGGYG 102 [68][TOP] >UniRef100_B3MYN0 GF22177 n=1 Tax=Drosophila ananassae RepID=B3MYN0_DROAN Length = 131 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 GGGG NGGGG H GGGGGG +GGGGGGGGG Sbjct: 95 GGGGGNGGGGKHGGGGGGGGKHGGGGGGGGG 125 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGG--GGGGGGGGE 183 GGGG NGGGG H GGGGGG GG GGGGGGGG+ Sbjct: 81 GGGGGNGGGGKHGGGGGGGNGGGGKHGGGGGGGGK 115 [69][TOP] >UniRef100_UPI00019841A9 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI00019841A9 Length = 525 Score = 59.7 bits (143), Expect = 5e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PP P PPPPP++ PPPPPP++ PPPP PPPP Sbjct: 450 PPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPP 481 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 5/43 (11%) Frame = -3 Query: 182 SPPPPP----PPPPPLW*PPPPPPLW*PPPPL-*PPPPLRYQA 69 SPPPPP PPPPP++ PPPPPP PPPP+ PPPP+ Y++ Sbjct: 454 SPPPPPVYSPPPPPPVYSPPPPPPPPPPPPPVXSPPPPIIYES 496 [70][TOP] >UniRef100_UPI000194BCD9 PREDICTED: similar to hCG38312 n=1 Tax=Taeniopygia guttata RepID=UPI000194BCD9 Length = 551 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 9 PPPPPPPPPPSGGPPPPPPSGGPPPP--PPPPL 39 [71][TOP] >UniRef100_UPI000069DAE3 FH1/FH2 domain-containing protein 1 (Formin homolog overexpressed in spleen 1) (FHOS) (Formin homology 2 domain-containing protein 1). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069DAE3 Length = 1340 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -3 Query: 194 GTTISPPPPPPPPP-PLW*PPPPPPLW*PPPPL*PPPP 84 G PPPPPPPPP P PPPPPP+ PPPP+ PPPP Sbjct: 741 GMPFPPPPPPPPPPLPGCLPPPPPPICPPPPPICPPPP 778 [72][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -3 Query: 194 GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 GT PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1406 GTAPPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 1439 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1405 TGTAPPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 1437 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPP PPPP Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PP P PPPP Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP P PP PPPP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPP P PPPP PPPP+ Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPI 1455 [73][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/55 (52%), Positives = 32/55 (58%) Frame = -3 Query: 248 IEIEFGTRKKTKELV*D*GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +E +F T L + G PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 202 LEGDFNTHSILGTLTYNFGGEAPPPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 253 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAY 66 PPPPPPPPPP PPPPPP PPPP PPPP Y Sbjct: 229 PPPPPPPPPP---PPPPPP---PPPPPPPPPPCNTGPY 260 [74][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 675 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 240 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 678 SPPPPPPPPPP---PPPPPPPPPPPPPPHPPPP 707 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPP PPPPL PPPPPP PPPP PPPP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPPL P PP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPPL PPP PPPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPPL PPPPP PPPP PPPP Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPP PPPPP PPPPPP PPPP PPPP Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP P PP PPPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP P PPPP PPPP PPPP Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 [75][TOP] >UniRef100_Q1PE26 Leucine-rich repeat family protein/extensin family protein n=1 Tax=Arabidopsis thaliana RepID=Q1PE26_ARATH Length = 218 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 5/60 (8%) Frame = -3 Query: 182 SPPPPPP---PPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNP--YDSRPLES 18 SPPPP P PPPP+ PPPPPP++ PPPP+ PPP + Y P P +S P++S Sbjct: 114 SPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQS 173 [76][TOP] >UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=O81765_ARATH Length = 699 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 5/60 (8%) Frame = -3 Query: 182 SPPPPPP---PPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNP--YDSRPLES 18 SPPPP P PPPP+ PPPPPP++ PPPP+ PPP + Y P P +S P++S Sbjct: 595 SPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQS 654 [77][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 T ++P PPPPPPPP PPPPPP PPPP PPPP++ Sbjct: 39 TAVNPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVK 76 [78][TOP] >UniRef100_A7PES6 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7PES6_VITVI Length = 486 Score = 59.7 bits (143), Expect = 5e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PP P PPPPP++ PPPPPP++ PPPP PPPP Sbjct: 450 PPSPSPPPPPVYSPPPPPPVYSPPPPPPPPPP 481 [79][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 44 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQ 72 PPPPPPPPPP PPPPPP PPPP PPPP +++ Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWE 101 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 [80][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/52 (55%), Positives = 32/52 (61%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRPL 24 PPPPPPPPPP PPPPPP PPPP PPPP R RP + +RP+ Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVT---SRPLSALFARPV 114 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 [81][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [82][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 98 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 Score = 56.2 bits (134), Expect = 6e-06 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPP----PLRYQAY 66 PPPPPPPPPP PPPPPP PPPPL PPP PLR Q + Sbjct: 76 PPPPPPPPPPP--PPPPPPP--PPPPLPPPPRNIIPLRTQFF 113 [83][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +++PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/43 (60%), Positives = 27/43 (62%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRP 51 PPPPPPPPPP PPPPPP PPPP PPPP R + P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIP 68 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [84][TOP] >UniRef100_UPI000186773D hypothetical protein BRAFLDRAFT_237208 n=1 Tax=Branchiostoma floridae RepID=UPI000186773D Length = 378 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 +GGGGY GGGGY GGGGGGY GGGG GGGGG Sbjct: 260 SGGGGYGGGGGY--GGGGGGYSGGGGGYGGGGG 290 [85][TOP] >UniRef100_UPI0001867639 hypothetical protein BRAFLDRAFT_237268 n=1 Tax=Branchiostoma floridae RepID=UPI0001867639 Length = 360 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 +GGGGY GGGGY GGGGGGY GGGG GGGGG Sbjct: 256 SGGGGYGGGGGY--GGGGGGYSGGGGGYGGGGG 286 [86][TOP] >UniRef100_B0S6Z1 Novel protein similar to vertebrate DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DHX9) n=1 Tax=Danio rerio RepID=B0S6Z1_DANRE Length = 1271 Score = 59.7 bits (143), Expect = 5e-07 Identities = 28/39 (71%), Positives = 28/39 (71%), Gaps = 4/39 (10%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGG----GGGGG 180 YR GGGGY GGGGY GGGGGY GGGGG GGGGG Sbjct: 1193 YRGGGGGYRGGGGYQ--GGGGGYRGGGGGGYRGYGGGGG 1229 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 6/38 (15%) Frame = +1 Query: 85 GGGGYNGGGGYHNGG----GGGGYHNGGGG--GGGGGG 180 GGGGY GGGGY GG GGGGY GGGG GGGGGG Sbjct: 1183 GGGGYRGGGGYRGGGGGYRGGGGYQGGGGGYRGGGGGG 1220 [87][TOP] >UniRef100_Q1BU84 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia AU 1054 RepID=Q1BU84_BURCA Length = 517 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGGG GGG+ NGGGGGG GGGGGGGGGG Sbjct: 307 NGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGGG 339 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%), Gaps = 4/37 (10%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 +GGGG+ GGG+ NGGG GGG+ NGGGGGGGGGG Sbjct: 294 DGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGGGGGG 330 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGG NGGGG GGGGGG GGGGGGGGGG Sbjct: 314 NGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGG 346 [88][TOP] >UniRef100_Q127H7 Putative uncharacterized protein n=1 Tax=Polaromonas sp. JS666 RepID=Q127H7_POLSJ Length = 261 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGGG NGGGG GGGGGG GGGGGGGGGG Sbjct: 217 NGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGG 249 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 223 NGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 255 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 G GG NGGGG + GGGGGG GGGGGGGGGG Sbjct: 212 GNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGG 243 [89][TOP] >UniRef100_A0K9V3 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia HI2424 RepID=A0K9V3_BURCH Length = 509 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGGG GGG+ NGGGGGG GGGGGGGGGG Sbjct: 307 NGGGGNGNGGGHGNGGGGGGGGGGGGGGGGGGG 339 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%), Gaps = 4/37 (10%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 +GGGG+ GGG+ NGGG GGG+ NGGGGGGGGGG Sbjct: 294 DGGGGHGNGGGHGNGGGGNGNGGGHGNGGGGGGGGGG 330 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGG NGGGG GGGGGG GGGGGGGGGG Sbjct: 314 NGGGHGNGGGGGGGGGGGGGGGGGGGGGGGGGG 346 [90][TOP] >UniRef100_D0CMI9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. WH 8109 RepID=D0CMI9_9SYNE Length = 190 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGG--GGGGGG 180 Y GGGGY GGGGY GGGGGG GGGG GGGGGG Sbjct: 96 YGGGGGGYRGGGGYGGGGGGGGGGGGGGGYAGGGGGG 132 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/38 (73%), Positives = 28/38 (73%), Gaps = 4/38 (10%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGG----GGGGYHNGGGGGGGGGG 180 R GGGGY GGGGY GG GGGGY GGGGGGGGGG Sbjct: 85 RRGGGGY-GGGGYGGGGGGYRGGGGYGGGGGGGGGGGG 121 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG + GGGG G GGGGGGGGGG Sbjct: 92 GGGGYGGGGGGYRGGGGYGGGGGGGGGGGGGG 123 [91][TOP] >UniRef100_A8HQ72 SR protein factor n=1 Tax=Chlamydomonas reinhardtii RepID=A8HQ72_CHLRE Length = 338 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 + GGGGY GGGGY GGGGGGY GGGG GGGGG Sbjct: 98 FGGGGGGYGGGGGY-GGGGGGGYGGGGGGYGGGGG 131 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 119 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGSGGGGG 152 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG GGGGGGY GGGG GGGGG Sbjct: 107 GGGGYGGGGGGGYGGGGGGYGGGGGGYGGGGG 138 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 115 GGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 145 [92][TOP] >UniRef100_B3P7N4 GG12540 n=1 Tax=Drosophila erecta RepID=B3P7N4_DROER Length = 115 Score = 59.7 bits (143), Expect = 5e-07 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 14/45 (31%) Frame = +1 Query: 88 GGGYNGGGGYHNGGGGGG--------------YHNGGGGGGGGGG 180 GGGYNGGGG +NGGGGGG Y NGGGGGGGGGG Sbjct: 53 GGGYNGGGGGYNGGGGGGGGRRPVYSGNFGPGYSNGGGGGGGGGG 97 [93][TOP] >UniRef100_P84064 Glycine-rich protein GWK isoform 4 n=1 Tax=Cucumis melo RepID=GRP1_CUCME Length = 36 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y+ GGGG+ GGGG+ GGGGGG GGGGGG GGG Sbjct: 1 YKRGGGGWGGGGGWKGGGGGGGGWKGGGGGGKGGG 35 [94][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 I PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 I PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 IIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 PPPPPPPPPP PPPPPP PPPP PPPP R Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 PPPPPPPPPP PPPPPP PPPP PPPP R Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPP 77 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 55 PPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 PPPPPPPPPP PPPPPP PP P PPPP R Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPAR 112 [95][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 59.3 bits (142), Expect = 7e-07 Identities = 28/42 (66%), Positives = 28/42 (66%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYR 57 SPPPPPPPPPP PPPPPP PPPP PPPP AY R Sbjct: 258 SPPPPPPPPPP---PPPPPP---PPPPPPPPPPPPPPAYEAR 293 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 + + PPPPPPPPP PPPPPP PPPP PPPP Y+A + Sbjct: 255 SFASPPPPPPPPPP--PPPPPPPPPPPPPPPPPPPPAYEAREF 295 [96][TOP] >UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis thaliana RepID=Q9XIL9_ARATH Length = 727 Score = 59.3 bits (142), Expect = 7e-07 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 6/58 (10%) Frame = -3 Query: 182 SPPPPPP-----PPPPLW*PPPPPPLW*PPPPL-*PPPPLRYQAYRYRRPRNPYDSRP 27 SPPPPPP PPPP++ PPPPPP+ PPPP+ PPPP+ P P S P Sbjct: 517 SPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 574 Score = 58.9 bits (141), Expect = 9e-07 Identities = 29/59 (49%), Positives = 34/59 (57%), Gaps = 7/59 (11%) Frame = -3 Query: 182 SPPPPP----PPPPPLW*PPPPPPLW*PPPP---L*PPPPLRYQAYRYRRPRNPYDSRP 27 SPPPPP PPPPP++ PPPPPP++ PPPP PPPP+ P P S P Sbjct: 509 SPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 567 [97][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 216 SPPPPPPPPPPPSPPPPPPP---PPPPSPPPPP 245 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 228 SPPPPPPPPPPPSPPPPPPP---PPPPSPPPPP 257 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 205 PPPPPPPPPPPSPPPPPPP---PPPPSPPPPP 233 [98][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 59.3 bits (142), Expect = 7e-07 Identities = 29/56 (51%), Positives = 32/56 (57%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRPLESTC 12 PPPPPPPPPP PPPP P PPPP PPPPL P P+ ++P S C Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPL-------LPPLPPFPAKPPMSPC 296 [99][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 226 SPPPPPPPPPPPSPPPPPPP---PPPPSPPPPP 255 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPP PPPP PPPPPP PPPP PPPP Sbjct: 220 SPPPPPSPPPP---PPPPPPPSPPPPPPPPPPP 249 [100][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 I PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 76 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 75 VIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [101][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 59.3 bits (142), Expect = 7e-07 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 ++PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 70 LTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 71 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPP+ Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 116 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 I PPPPPPPPP PPPPPP PPPP PPPP Sbjct: 69 ILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 [102][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 PPPPPPPPPP PPPPPP PPPP PPPP R Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQR 108 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 105 [103][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 59.3 bits (142), Expect = 7e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 366 PPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPP 397 [104][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 2/36 (5%) Frame = -3 Query: 185 ISPPPPPP--PPPPLW*PPPPPPLW*PPPPL*PPPP 84 +SPPPPPP PPPPL PPPPPP PPPP PPPP Sbjct: 126 LSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPPP 161 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 P PPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPP 36 Score = 56.2 bits (134), Expect = 6e-06 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 6/40 (15%) Frame = -3 Query: 182 SPPPP---PPPPPPLW*PPPPPPL---W*PPPPL*PPPPL 81 SPPPP PPPPPPL PPPPPPL PPPP PPPPL Sbjct: 87 SPPPPLPSPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPL 126 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 5/38 (13%) Frame = -3 Query: 182 SPPPPPP-----PPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPP PPPPL PPPPP PPPPL PPPP Sbjct: 94 SPPPPPPLPSPPPPPPLPSSPPPPPPSPPPPPLSPPPP 131 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PP PPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPP 35 [105][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 T + PPPPPPPPPP PPPPPP PPPP PPPP+ Sbjct: 1030 TAVPPPPPPPPPPP---PPPPPP---PPPPPPPPPPM 1060 [106][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 983 LSPPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 1013 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -3 Query: 194 GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 G + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 982 GLSPPPPPPPPPPPP---PPPPPP---PPPPPPPPPP 1012 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 989 PPPPPPPPPP---PPPPPP---PPPPPPPPPP 1014 [107][TOP] >UniRef100_A2C5L0 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9303 RepID=A2C5L0_PROM3 Length = 202 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 Y GGGGY GGGG + GGGGGGY GGGGGGGGG Sbjct: 106 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGGGGGG 138 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGG G GGGGGGGG Sbjct: 113 YGGGGGGYGGGGGGYGGGGGGGGGGGYGGGGGGGG 147 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 R GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 86 RGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 118 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 92 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 125 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 99 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 132 [108][TOP] >UniRef100_C1E508 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E508_9CHLO Length = 867 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGGY GGGGGGY GGGGGG GGG Sbjct: 834 GGGGYGGGGGY--GGGGGGYGGGGGGGGWGGG 863 [109][TOP] >UniRef100_A8W7L0 Putative RNA helicase n=1 Tax=Phytophthora infestans RepID=A8W7L0_PHYIN Length = 544 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY+GGGG + GGGGGGY GG GGGGGGG Sbjct: 43 YGGGGGGYSGGGGGY-GGGGGGYSGGGRGGGGGGG 76 [110][TOP] >UniRef100_B4PJH5 GE19933 n=1 Tax=Drosophila yakuba RepID=B4PJH5_DROYA Length = 347 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 NGGGG NGGGG + GGGG G GGGGGGGGGG+ Sbjct: 305 NGGGGGNGGGGGNGGGGGNGGGGGGGGGGGGGGD 338 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 2/34 (5%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGG--GGYHNGGGGGGGGGG 180 GGGG NGGGG + GGGG GG NGGGGGGGGGG Sbjct: 300 GGGGGNGGGGGNGGGGGNGGGGGNGGGGGGGGGG 333 [111][TOP] >UniRef100_P17816 Glycine-rich cell wall structural protein n=1 Tax=Hordeum vulgare RepID=GRP1_HORVU Length = 200 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 +GGGGY GGGGY GGGGGGY GGGG GGGGG Sbjct: 57 HGGGGYGGGGGY--GGGGGGYPGGGGGYGGGGG 87 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 9/41 (21%) Frame = +1 Query: 85 GGGGYNGGGGYHN---------GGGGGGYHNGGGGGGGGGG 180 GGGGY GGGGYH GGGGGGY GGGGG GGG Sbjct: 130 GGGGYGGGGGYHGHGGEGGGGYGGGGGGYPGHGGGGGHGGG 170 [112][TOP] >UniRef100_UPI0001B58635 hypothetical protein StAA4_25414 n=1 Tax=Streptomyces sp. AA4 RepID=UPI0001B58635 Length = 326 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -3 Query: 200 D*GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 D T PPPPPPPPPP PPPPPP+ PPPP PPP Sbjct: 233 DSNTPKPPPPPPPPPPPPTPPPPPPPVTAPPPPPVSPPP 271 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP PPPP+ PPPP Sbjct: 241 PPPPPPPPPPTPPPPPPPVTAPPPPPVSPPPP 272 [113][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 SPPPPPPPPPP PPPPPP PPPP PPPP+ Sbjct: 173 SPPPPPPPPPP---PPPPPPPPPPPPPPPPPPPV 203 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPP PP PPPPPP PPPP PPPP Sbjct: 165 SPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPP PPP PPPPPP PPPP PPPP Sbjct: 139 PPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPP 170 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPP PPPP PPPPPP PPPP PPPP Sbjct: 154 PPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPP 185 [114][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 58.9 bits (141), Expect = 9e-07 Identities = 29/57 (50%), Positives = 31/57 (54%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRPLESTCS 9 PPPPPPPPPP PPPPPP PPPP PPPP P P P ++CS Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCS 415 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 379 SPPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 408 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 389 [115][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 ++ PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 PPPPPPPPPP PPPPPP PPPP PPPP R Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 [116][TOP] >UniRef100_Q2NNS2 1629capsid n=1 Tax=Hyphantria cunea nucleopolyhedrovirus RepID=Q2NNS2_NPVHC Length = 539 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/36 (66%), Positives = 25/36 (69%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T + PPP PPPPPP PPPPPP PPPP PPPP Sbjct: 237 TNVPPPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPP 272 [117][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPP 524 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -3 Query: 194 GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 G + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 483 GVSPPPPPPPPPPPP---PPPPPPSPPPPPPPSPPPP 516 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 [118][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 224 SPPPPPPPPPP---PPPPPPPSPPPPPPPPPPP 253 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 226 PPPPPPPPPP---PPPPPPSPPPPPPPPPPPP 254 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 231 PPPPPPPPPPPSPPPPPPP---PPPPPPPPPP 259 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 232 PPPPPPPPPPSPPPPPPPP---PPPPPPPPPP 260 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 230 PPPPPPPPPPPPSPPPPPP---PPPPPPPPPP 258 [119][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 252 SPPPPPPPPPP---PPPPPPPPPPPPPSPPPPP 281 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 SPPPPPPPPPP PPPPPP PPPP PPPP+ Sbjct: 276 SPPPPPPPPPP---PPPPPP---PPPPPPPPPPV 303 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP P PPPP PPPP PPPP Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPP PPPPPP PPPPPP PPPP PPPP Sbjct: 248 SPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 [120][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 Query: 176 PPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPL PPPPPP PPPP PPPP Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPPPPP 1245 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPP PPPPPPL PPPP PPPP+ Sbjct: 1215 PPPPPPPPPLPPPPPPPPPLPPPPPPPPPPPPV 1247 [121][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 58.9 bits (141), Expect = 9e-07 Identities = 27/48 (56%), Positives = 32/48 (66%) Frame = -3 Query: 227 RKKTKELV*D*GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 R +T+ D +++ PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 84 RNRTRNRNGDGVSSLQPPPPPPPPPP---PPPPPP---PPPPPPPPPP 125 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 101 PPPPPPPPPP---PPPPPP---PPPPPPPPPP 126 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 102 PPPPPPPPPP---PPPPPP---PPPPPPPPPP 127 [122][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 58.9 bits (141), Expect = 9e-07 Identities = 30/55 (54%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL-RYQAYRYRRPRNPYDSRP 27 T +PPPPPPPPPP PPPPPP PPPP PPPPL + + NPY P Sbjct: 117 TPAPPPPPPPPPP---PPPPPP---PPPPPPPPPPLFTTRGVSFPPHGNPYPYPP 165 [123][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 58.9 bits (141), Expect = 9e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 Query: 176 PPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPL PPPPPP PPPP PPPP Sbjct: 307 PPPPPPPPPLPSPPPPPPTPPPPPPPPPPPP 337 [124][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 194 GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 G ++ PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 837 GASLPPPPPPPPPPP---PPPPPP---PPPPPPPPPP 867 [125][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 194 GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 G ++ PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 915 GASLPPPPPPPPPPP---PPPPPP---PPPPPPPPPP 945 [126][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 194 GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 G ++ PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 915 GASLPPPPPPPPPPP---PPPPPP---PPPPPPPPPP 945 [127][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 58.9 bits (141), Expect = 9e-07 Identities = 38/91 (41%), Positives = 42/91 (46%), Gaps = 12/91 (13%) Frame = -3 Query: 320 VETPP-----IEFSLGPRKSDFEVDGIDKIEIEFGTRKKTKELV*D*GTTISPPPPPP-- 162 VETPP I L +D +GI + TR+ T SPPPPPP Sbjct: 96 VETPPSANPTIPIDLPTAPTDLGANGITSTQTVIVTRQPPH-------TPSSPPPPPPSS 148 Query: 161 -----PPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPP PPPPPP PPPP PPPP Sbjct: 149 APLPQPPPP---PPPPPPASAPPPPPPPPPP 176 [128][TOP] >UniRef100_UPI0000D57012 PREDICTED: similar to cabeza CG3606-PB n=1 Tax=Tribolium castaneum RepID=UPI0000D57012 Length = 357 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 + GGGGYN GGGY N GGGGGY N GG GGGGGG Sbjct: 61 QGGGGGYNQGGGY-NSGGGGGYGNSGGYGGGGGG 93 [129][TOP] >UniRef100_B5DGC5 Cold-inducible RNA-binding protein n=1 Tax=Salmo salar RepID=B5DGC5_SALSA Length = 154 Score = 58.9 bits (141), Expect = 9e-07 Identities = 31/58 (53%), Positives = 32/58 (55%), Gaps = 12/58 (20%) Frame = +1 Query: 43 GFRGRRYL*A*YRNGGGGYNGGGGYHNGGG------------GGGYHNGGGGGGGGGG 180 GFRG R GGGGY GGGGY GGG GGGY +GGGGGG GGG Sbjct: 94 GFRGSR--------GGGGYGGGGGYGGGGGRSYGGEDRGYGGGGGYRSGGGGGGRGGG 143 [130][TOP] >UniRef100_B6UB95 Glycine-rich RNA-binding protein 7 n=1 Tax=Zea mays RepID=B6UB95_MAIZE Length = 252 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGGY GGGGGGY GGG GGGGGG Sbjct: 120 GGGGYGGGGGY--GGGGGGYGGGGGYGGGGGG 149 [131][TOP] >UniRef100_B6TI13 Glycine-rich RNA-binding protein 7 n=1 Tax=Zea mays RepID=B6TI13_MAIZE Length = 276 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGGY GGGGGGY GGG GGGGGG Sbjct: 120 GGGGYGGGGGY--GGGGGGYGGGGGYGGGGGG 149 [132][TOP] >UniRef100_Q7QIN6 AGAP006967-PA n=1 Tax=Anopheles gambiae RepID=Q7QIN6_ANOGA Length = 352 Score = 58.9 bits (141), Expect = 9e-07 Identities = 31/47 (65%), Positives = 34/47 (72%), Gaps = 9/47 (19%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGG-GGGYHNGGGGG---GGG-----GGEIVVP 195 NGGGGY+GGGG +NGGG GG +NGGGGG GGG GG IVVP Sbjct: 154 NGGGGYSGGGGSYNGGGAGGSSYNGGGGGAYNGGGQFDGAGGNIVVP 200 [133][TOP] >UniRef100_B3MW45 GF22329 n=1 Tax=Drosophila ananassae RepID=B3MW45_DROAN Length = 207 Score = 58.9 bits (141), Expect = 9e-07 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 5/38 (13%) Frame = +1 Query: 82 NGGGGYNGG---GGYHNGGGGGGYHNGGGGGGG--GGG 180 +GGGGY GG GG+H GGGGGG H+GGGGGGG GGG Sbjct: 165 SGGGGYGGGNQGGGHHGGGGGGGGHHGGGGGGGKYGGG 202 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 4/37 (10%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGY--HNGGGG--GGGGGGE 183 GGGGY GGGG H GGGGGG + GGGG GGGGGG+ Sbjct: 52 GGGGYGGGGGKHGGGGGGGQGGYGGGGGKHGGGGGGQ 88 [134][TOP] >UniRef100_B3M2B3 GF17078 n=1 Tax=Drosophila ananassae RepID=B3M2B3_DROAN Length = 599 Score = 46.2 bits (108), Expect(2) = 1e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 170 PPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNP 42 PPPPPPP PPPPPP PPPP PPPP + + P P Sbjct: 157 PPPPPPP---PPPPPP---PPPP--PPPPPPPPHHPHHHPSPP 191 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 181 HHHHHHHHHHHY 146 HH HH HHHHH+ Sbjct: 145 HHDHHDHHHHHH 156 [135][TOP] >UniRef100_UPI0001552F36 PREDICTED: similar to SH3 domain binding protein n=1 Tax=Mus musculus RepID=UPI0001552F36 Length = 455 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRP 51 PPPPPPPPPP PPPPPL PPPP P PP+ R+P Sbjct: 10 PPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSLRKP 52 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPP---L*PPPP 84 + PPPPPPPPPP PPPPPPL PPPP PPPP Sbjct: 3 VPPPPPPPPPPP---PPPPPPLGAPPPPPLGAPPPPP 36 [136][TOP] >UniRef100_UPI0001552DAA PREDICTED: similar to CR16 n=1 Tax=Mus musculus RepID=UPI0001552DAA Length = 483 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRP 51 PPPPPPPPPP PPPPPL PPPP P PP+ R+P Sbjct: 10 PPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSLRKP 52 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPP---L*PPPP 84 + PPPPPPPPPP PPPPPPL PPPP PPPP Sbjct: 3 VPPPPPPPPPPP---PPPPPPLGAPPPPPLGAPPPPP 36 [137][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 1475 PPPPPPPPPP---PPPPPPPPPPPPPPPPPPPL 1504 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1474 LPPPPPPPPPPP---PPPPPP---PPPPPPPPPP 1501 [138][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 Query: 176 PPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPL PPPPPP PPPP PPPP Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPP 235 [139][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 651 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 683 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 684 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 ++ PPPPPPPPP PPPPPP PPPP PPPP Sbjct: 648 SVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 682 [140][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 467 SPPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 496 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 469 PPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 497 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPP+ Sbjct: 473 PPPPPPPPPP---PPPPPP---PPPPPPPPPPV 499 [141][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 98 PPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 112 PPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SP PPPPPPPP+ PPPPPP PPPP PPPP Sbjct: 84 SPSPPPPPPPPV--PPPPPPPPPPPPPPSPPPP 114 [142][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 432 TPPPPPPPPPP---PPPPPPTPPPPPPRPPPPP 461 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 +T PPPPPPPPPP P PPPP PPPP PPPP+ Sbjct: 431 STPPPPPPPPPPPPPPPPTPPPPPPRPPPPPPPPPPV 467 [143][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 MEPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [144][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 Query: 176 PPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPL PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [145][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 58.5 bits (140), Expect = 1e-06 Identities = 30/56 (53%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRP--RNPYDSRP 27 T +PPPPPPPPPP PPPPPP PPPP PPP R+ P NPY P Sbjct: 117 TPAPPPPPPPPPP---PPPPPPPPPPPPPPPPPPTPRFTTRGVSFPPHGNPYPYPP 169 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 117 TPAPPPPPPPPPPP---PPPPPP---PPPPPPPPPP 146 [146][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRY 75 PPPPPPPPPP PPPPPP PPPP PPPP Y Sbjct: 38 PPPPPPPPPP---PPPPPPPPPPPPPPPPPPPAPY 69 [147][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRPLES 18 PPPPPPPPP PPPPPP PPPP PPPP P P S+P +S Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETPSQSQPQQS 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T++PPPPPPPPPP PPPPPP PPP PPPP Sbjct: 1947 TLAPPPPPPPPPPTEDPPPPPP---PPPAEAPPPP 1978 [148][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/54 (51%), Positives = 30/54 (55%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRPLES 18 PPPPPPPPP PPPPPP PPPP PPPP P P S+P +S Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETPSQSQPQQS 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T++PPPPPPPPPP PPPPPP PPP PPPP Sbjct: 1850 TLAPPPPPPPPPPTEDPPPPPP---PPPAEAPPPP 1881 [149][TOP] >UniRef100_P0C7L0-2 Isoform 2 of WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=P0C7L0-2 Length = 451 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRP 51 PPPPPPPPPP PPPPPL PPPP P PP+ R+P Sbjct: 10 PPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSLRKP 52 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPP---L*PPPP 84 + PPPPPPPPPP PPPPPPL PPPP PPPP Sbjct: 3 VPPPPPPPPPPP---PPPPPPLGAPPPPPLGAPPPPP 36 [150][TOP] >UniRef100_P0C7L0 WAS/WASL-interacting protein family member 3 n=1 Tax=Mus musculus RepID=WIPF3_MOUSE Length = 485 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRP 51 PPPPPPPPPP PPPPPL PPPP P PP+ R+P Sbjct: 10 PPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSLRKP 52 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/37 (67%), Positives = 26/37 (70%), Gaps = 3/37 (8%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPP---L*PPPP 84 + PPPPPPPPPP PPPPPPL PPPP PPPP Sbjct: 3 VPPPPPPPPPPP---PPPPPPLGAPPPPPLGAPPPPP 36 [151][TOP] >UniRef100_Q15637-5 Isoform 5 of Splicing factor 1 n=1 Tax=Homo sapiens RepID=Q15637-5 Length = 764 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/56 (51%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*P----PPPL*PPPPLRYQAYRYRRPRNPYDSR 30 + PPPPPPPPPP PPPPPP P PPP PPPP YQ +P P R Sbjct: 68 LPPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPPR 123 [152][TOP] >UniRef100_Q7V9D6 RNA-binding region RNP-1 (RNA recognition motif) n=1 Tax=Prochlorococcus marinus str. MIT 9313 RepID=Q7V9D6_PROMM Length = 199 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGG--GGGGYHNGGGGGGGGGGE 183 Y GGGGY GGGG + GG GGGGY GG GGGGGGG+ Sbjct: 109 YGGGGGGYGGGGGGYGGGGYGGGGYGGGGYGGGGGGGD 146 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 GGGGY GGGG GGGGGGY GGGG GGGG Sbjct: 97 GGGGYGGGGGGGYGGGGGGYGGGGGGYGGGG 127 [153][TOP] >UniRef100_Q1IRT5 Putative uncharacterized protein n=1 Tax=Candidatus Koribacter versatilis Ellin345 RepID=Q1IRT5_ACIBL Length = 315 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 28/34 (82%), Gaps = 2/34 (5%) Frame = +1 Query: 85 GGGGYNGGGG--YHNGGGGGGYHNGGGGGGGGGG 180 GGGG++GGGG +H GGGGGG+H GGGG GGGG Sbjct: 51 GGGGFHGGGGGGFHGGGGGGGFHGGGGGFHGGGG 84 [154][TOP] >UniRef100_A8LXH2 Glycosyl transferase family 51 n=1 Tax=Salinispora arenicola CNS-205 RepID=A8LXH2_SALAI Length = 979 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 4/42 (9%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGG--GGGYHNGGGG--GGGGGGEIVVP 195 NGGGG NGGGG + GGG GGG +NGGGG GGGGGG+I P Sbjct: 925 NGGGGNNGGGGNNGGGGNNGGGGNNGGGGNNGGGGGGDIGFP 966 [155][TOP] >UniRef100_A5GPV8 RNA-binding protein, RRM domain n=1 Tax=Synechococcus sp. RCC307 RepID=A5GPV8_SYNR3 Length = 204 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/38 (73%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGG--GGGGGGGE 183 Y GGGGY GGGG + GGGGGGY GGG GGGGGGGE Sbjct: 111 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGGGGE 147 [156][TOP] >UniRef100_C1ZIK1 RRM domain-containing RNA-binding protein n=1 Tax=Planctomyces limnophilus DSM 3776 RepID=C1ZIK1_PLALI Length = 146 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG + GGGGGG + GGGGG GGGG Sbjct: 111 GGGGYGGGGGGYGGGGGGGGYGGGGGGYGGGG 142 [157][TOP] >UniRef100_B7PQ78 H/ACA ribonucleoprotein complex protein, putative n=1 Tax=Ixodes scapularis RepID=B7PQ78_IXOSC Length = 126 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/59 (52%), Positives = 36/59 (61%) Frame = +1 Query: 4 CMLQVDSRGLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 C + S +L+ G GRR ++GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 37 CFTSIQSPEMLA-GISGRRLG---SKDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 [158][TOP] >UniRef100_B7PFE7 Cement protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PFE7_IXOSC Length = 254 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/45 (64%), Positives = 30/45 (66%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIVVP*S*TSSFV 219 GGGG GGGG GGGGGG GGGGGGGGGG IV T +FV Sbjct: 114 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAIVSNPELTLTFV 158 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIVV 192 GGGG GGGG GGGGGG GGGGGGGGGG +V Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAIV 148 [159][TOP] >UniRef100_B7P671 Cement protein, putative n=1 Tax=Ixodes scapularis RepID=B7P671_IXOSC Length = 324 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y+ GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 32 YKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 66 [160][TOP] >UniRef100_B4ND25 GK10144 n=1 Tax=Drosophila willistoni RepID=B4ND25_DROWI Length = 413 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG GGGG GGGGGG+ +GGGGGGGGGG Sbjct: 24 GGGGGGGGGGSSGGGGGGGWSSGGGGGGGGGG 55 [161][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP ++ PPPP PPPP Sbjct: 148 PPPPPPPPPPPPPPPPPPVVFCPPPPPCPPPP 179 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PP P PPPP Sbjct: 196 PPPPPPPPPPCPLPPPPPPCPPPPAPCPPPPP 227 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 137 APPPPPPPPPP---PPPPPP---PPPPPPPPPP 163 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPP+ Sbjct: 140 PPPPPPPPPP---PPPPPP---PPPPPPPPPPV 166 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/34 (70%), Positives = 25/34 (73%), Gaps = 2/34 (5%) Frame = -3 Query: 179 PPPPP--PPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPP PPPPP+ PPPPPP PPPP PPPP Sbjct: 123 PPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPPP 156 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 139 PPPPPPPPPP---PPPPPP---PPPPPPPPPP 164 [162][TOP] >UniRef100_UPI000161FB4F predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=UPI000161FB4F Length = 616 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = -3 Query: 185 ISPPPPPP---PPPPLW*PPPPPPLW*PPPPL*PPPPL 81 ISPPPPPP PPPP PPPPPP+ PPPP PPPPL Sbjct: 422 ISPPPPPPSETPPPPPSSPPPPPPM--PPPPSSPPPPL 457 [163][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 + PPPPPPPPP PPPPPP PPPP PPPP Sbjct: 318 VEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 [164][TOP] >UniRef100_B9LBU3 Putative uncharacterized protein n=1 Tax=Chloroflexus sp. Y-400-fl RepID=B9LBU3_CHLSY Length = 340 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP + PPPP PPPP Sbjct: 286 PPPPPPPPPPTVAPPPPPTVAPPPPPPPPPPP 317 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T PPPPPPPPPP PPPPP PPPP PPPP Sbjct: 282 TEPPPPPPPPPPPPTVAPPPPPTVAPPPPPPPPPP 316 [165][TOP] >UniRef100_A9WHI6 Putative uncharacterized protein n=1 Tax=Chloroflexus aurantiacus J-10-fl RepID=A9WHI6_CHLAA Length = 344 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPP + PPPP PPPP Sbjct: 290 PPPPPPPPPPTVAPPPPPTVAPPPPPPPPPPP 321 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/35 (68%), Positives = 24/35 (68%) Frame = -3 Query: 188 TISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 T PPPPPPPPPP PPPPP PPPP PPPP Sbjct: 286 TEPPPPPPPPPPPPTVAPPPPPTVAPPPPPPPPPP 320 [166][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 46 PPPPPPPPPP---PPPPPP---PPPPTPPPPPL 72 [167][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 46 PPPPPPPPPP---PPPPPP---PPPPTPPPPPL 72 [168][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 [169][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 [170][TOP] >UniRef100_Q29LJ4 GA17232 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=Q29LJ4_DROPS Length = 596 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPP R + Y Y Sbjct: 482 PPPPPPPPPP---PPPPPPTEPPPPP--PPPEPRVKKYSY 516 [171][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 [172][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 [173][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 [174][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [175][TOP] >UniRef100_B4GPV6 GL15122 n=1 Tax=Drosophila persimilis RepID=B4GPV6_DROPE Length = 596 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 PPPPPPPPPP PPPPPP PPPP PPP R + Y Y Sbjct: 482 PPPPPPPPPP---PPPPPPTEPPPPP--PPPEPRVKKYSY 516 [176][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 58.2 bits (139), Expect = 2e-06 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 2/77 (2%) Frame = -3 Query: 308 PIEFS--LGPRKSDFEVDGIDKIEIEFGTRKKTKELV*D*GTTISPPPPPPPPPPLW*PP 135 P+E + LG R ++ ++D D FG KK ++ +PPPPPPPPPP PP Sbjct: 9 PVEATGGLGTRPAELDIDIDDDY---FGGGKKQEQ---------APPPPPPPPPP---PP 53 Query: 134 PPPPLW*PPPPL*PPPP 84 PPPP PPPP PPPP Sbjct: 54 PPPP---PPPP--PPPP 65 [177][TOP] >UniRef100_B2AKS1 Translation initiation factor IF-2 n=1 Tax=Podospora anserina RepID=B2AKS1_PODAN Length = 1038 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/53 (49%), Positives = 31/53 (58%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRPLE 21 PPPPPPPPPP PPPP PPPP PPPP ++Q R ++ S P + Sbjct: 121 PPPPPPPPPPPPPPPPPKASTPPPPPPPPPPPRQWQPSPARDQKSERSSTPFQ 173 [178][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/78 (39%), Positives = 42/78 (53%) Frame = -3 Query: 317 ETPPIEFSLGPRKSDFEVDGIDKIEIEFGTRKKTKELV*D*GTTISPPPPPPPPPPLW*P 138 ETP + GP+ ++ E I++ ++E ++K PPPPPPPPPP P Sbjct: 988 ETP----TTGPQIANDEAQTIEEAKLESESKKPVS------APAPPPPPPPPPPPPPPPP 1037 Query: 137 PPPPPLW*PPPPL*PPPP 84 PPP + PPPP PPPP Sbjct: 1038 PPPGAIGVPPPPPPPPPP 1055 [179][TOP] >UniRef100_UPI0001982DB4 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982DB4 Length = 214 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGGY GGGG GY+ GGG GGG GG Sbjct: 89 GGGGYGGGGGYGGGGGGYGYNGGGGRGGGRGG 120 [180][TOP] >UniRef100_UPI000180C465 PREDICTED: similar to cold-inducible RNA-binding protein n=1 Tax=Ciona intestinalis RepID=UPI000180C465 Length = 167 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 102 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 135 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GGG GGGGGG Sbjct: 109 YGGGGGGYGGGGGGY-GGGGGGYGGGGGYGGGGGG 142 [181][TOP] >UniRef100_UPI00017466C4 RNA-binding protein (RRM domain) n=1 Tax=Verrucomicrobium spinosum DSM 4136 RepID=UPI00017466C4 Length = 158 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGG 174 R GGG GGGGY GGGGGGY GGGGGGGG Sbjct: 77 RPAGGGAGGGGGYKGGGGGGGYSGGGGGGGGG 108 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/37 (72%), Positives = 27/37 (72%), Gaps = 2/37 (5%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGG--GGG 180 Y GGGG GGGGY GGGGGGY GGGGGGG GGG Sbjct: 98 YSGGGGG--GGGGYKGGGGGGGYKGGGGGGGGYKGGG 132 [182][TOP] >UniRef100_UPI00016C5334 RNA-binding region RNP-1 n=1 Tax=Gemmata obscuriglobus UQM 2246 RepID=UPI00016C5334 Length = 137 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 100 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 133 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 96 GGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 126 [183][TOP] >UniRef100_UPI0000D9F577 PREDICTED: similar to leucine-rich repeats and calponin homology (CH) domain containing 2 isoform 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9F577 Length = 745 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIVVP 195 GGGG +GGGG GGGGGG GGGGGGGGGG +VVP Sbjct: 17 GGGGSSGGGGTA-GGGGGGAGGGGGGGGGGGGTLVVP 52 [184][TOP] >UniRef100_UPI0000D9F576 PREDICTED: similar to leucine-rich repeats and calponin homology (CH) domain containing 2 isoform 2 n=1 Tax=Macaca mulatta RepID=UPI0000D9F576 Length = 768 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIVVP 195 GGGG +GGGG GGGGGG GGGGGGGGGG +VVP Sbjct: 17 GGGGSSGGGGTA-GGGGGGAGGGGGGGGGGGGTLVVP 52 [185][TOP] >UniRef100_UPI0000DBF1EE UPI0000DBF1EE related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DBF1EE Length = 101 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 GGGG GGGG + GGGGGG GGGGGGGGGG+ Sbjct: 18 GGGGGGGGGGRYGGGGGGGGDGGGGGGGGGGGD 50 [186][TOP] >UniRef100_C3MDJ7 Putative uncharacterized protein n=1 Tax=Rhizobium sp. NGR234 RepID=C3MDJ7_RHISN Length = 209 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 +GGGG GGGG GGGGGG NGGGGGGGGGG Sbjct: 102 SGGGGSGGGGGGGGGGGGGGGGNGGGGGGGGGG 134 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG GGGG NGGGGGG GGGGGGGGGG Sbjct: 112 GGGGGGGGGGGGNGGGGGGGGGGGGGGGGGGG 143 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG GGGG + GGGGGG GGGGGGGGGG Sbjct: 113 GGGGGGGGGGGNGGGGGGGGGGGGGGGGGGGG 144 [187][TOP] >UniRef100_Q8GVD4 Glycine-rich protein n=1 Tax=Lilium hybrid division VII RepID=Q8GVD4_9LILI Length = 138 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/39 (69%), Positives = 27/39 (69%), Gaps = 4/39 (10%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNG----GGGGGYHNGGGGGGGGGG 180 Y NGGG GGGGYHNG GGGGGY GGGG GGGG Sbjct: 53 YNNGGGYPGGGGGYHNGGGYPGGGGGYPGGGGGYPGGGG 91 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +1 Query: 88 GGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGYN GGGY GGGGGYHNGGG GGGGG Sbjct: 50 GGGYNNGGGY--PGGGGGYHNGGGYPGGGGG 78 [188][TOP] >UniRef100_Q75QN8 Cold shock domain protein 3 n=1 Tax=Triticum aestivum RepID=Q75QN8_WHEAT Length = 231 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GG GGGGGGG Sbjct: 102 YGGGGGGYGGGGGGY-GGGGGGYGGGGYGGGGGGG 135 [189][TOP] >UniRef100_Q42448 Abscisic acid-and environmental stress-inducible protein protein (Fragment) n=1 Tax=Medicago sativa RepID=Q42448_MEDSA Length = 191 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIV 189 +GGGGYNGGGG H G GGGGY+ GGG GG GG E V Sbjct: 4 HGGGGYNGGGG-HGGHGGGGYNGGGGHGGHGGAESV 38 [190][TOP] >UniRef100_Q2V4A0 Putative uncharacterized protein At2g05440.5 n=1 Tax=Arabidopsis thaliana RepID=Q2V4A0_ARATH Length = 140 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = +1 Query: 28 GLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGY----HNGGGGGGGGGG 180 GL YG G Y GGGG+ GGGG H GGGGGG+ H GGGGGG GGG Sbjct: 71 GLDGYGGGGGHY------GGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 119 [191][TOP] >UniRef100_B9PV72 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9PV72_TOXGO Length = 488 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 65 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 98 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG + GGGGGGY GGGG GGGGG Sbjct: 61 GGGGYGGGGGGY-GGGGGGYGGGGGGYGGGGG 91 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY GGGG + GGGGGGY GGGG G GGG Sbjct: 72 YGGGGGGYGGGGGGY-GGGGGGYGGGGGGYGAGGG 105 [192][TOP] >UniRef100_B7QJ84 Glycine-rich RNA-binding protein GRP1A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJ84_IXOSC Length = 105 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG+ GGGG H GGGGGG H GGGGG GGGG Sbjct: 49 GGGGHGGGGGGHGGGGGGG-HGGGGGGHGGGG 79 [193][TOP] >UniRef100_A7EC48 Glycine-rich RNA-binding protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7EC48_SCLS1 Length = 193 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 5/38 (13%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGG---GGGGYHNGGGGG--GGGGG 180 N GGGY+GGGGY GG GGGGY+ GGGGG GGGGG Sbjct: 133 NSGGGYSGGGGYSGGGGYSGGGGYNGGGGGGYSGGGGG 170 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 +GGGGY+GGGGY NGGGGGGY GGGGG GG Sbjct: 145 SGGGGYSGGGGY-NGGGGGGYSGGGGGGYSSGG 176 [194][TOP] >UniRef100_A4QSS5 ATP-dependent RNA helicase DBP2 n=1 Tax=Magnaporthe grisea RepID=DBP2_MAGGR Length = 548 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 4/40 (10%) Frame = +1 Query: 76 YRNG----GGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 Y NG GGGY GGGG GGGGGGY GGGGG GGGG+ Sbjct: 24 YSNGHGSHGGGYGGGGGGGYGGGGGGYGGGGGGGFGGGGD 63 [195][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPPL PP+ PPPP Sbjct: 552 SPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 584 [196][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPPL PP+ PPPP Sbjct: 564 SPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 596 [197][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPPL PP+ PPPP Sbjct: 451 SPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 483 [198][TOP] >UniRef100_UPI00004D6F7F Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7F Length = 555 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPPL PP+ PPPP Sbjct: 23 SPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 55 [199][TOP] >UniRef100_UPI00004D6F7D Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7D Length = 1054 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 SPPPPPPPPPP PPPPPPL PP+ PPPP Sbjct: 533 SPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 565 [200][TOP] >UniRef100_Q9Q5L3 EBNA-2 n=1 Tax=Macacine herpesvirus 4 RepID=Q9Q5L3_9GAMA Length = 605 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/56 (53%), Positives = 33/56 (58%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRPL 24 T PPPPPPPPPL PPPPPPL PPPP PPP + + P +P D PL Sbjct: 60 TVPGAPPPPPPPPPL-PPPPPPPLPPPPPPPVQPPPPERRDVGTQEP-DPRDRNPL 113 [201][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 194 GTTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 G + +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 493 GPSSTPPPPPPPPPP---PPPPPP---PPPPPPPPPP 523 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 499 PPPPPPPPPP---PPPPPP---PPPPPPPPPP 524 [202][TOP] >UniRef100_A0CS42 Chromosome undetermined scaffold_26, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CS42_PARTE Length = 417 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 284 PPPPPPPPPPP--PPPPPPKGVPPPPRGPPPP 313 [203][TOP] >UniRef100_UPI0000DB6C07 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6C07 Length = 431 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 3/38 (7%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGG---YHNGGGGGGGGGG 180 + GGGGY GGGG + GGGGGG +H GGGG GGGGG Sbjct: 244 FGGGGGGYGGGGGGYGGGGGGGIIEHHGGGGGFGGGGG 281 [204][TOP] >UniRef100_Q3B0Y9 RNA-binding region RNP-1 n=1 Tax=Synechococcus sp. CC9902 RepID=Q3B0Y9_SYNS9 Length = 196 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = +1 Query: 85 GGGGYNGGGG---YHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG Y GGGGGGY GGGGGG GGG Sbjct: 89 GGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGG 123 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 3/35 (8%) Frame = +1 Query: 85 GGGGYNGGGG---YHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG Y GGGGGGY GGGGGG GGG Sbjct: 98 GGGGYGGGGGGGGYGGGGGGGGYGGGGGGGGYGGG 132 [205][TOP] >UniRef100_B5IMX1 RNA-binding protein RbpD n=1 Tax=Cyanobium sp. PCC 7001 RepID=B5IMX1_9CHRO Length = 119 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +1 Query: 79 RNGGGGYNGG-GGYHNGGGGGGYHNGGGGGGGGGG 180 R GGGG GG GG + GGGGGGY GGGGGGGGGG Sbjct: 80 REGGGGNRGGYGGGNRGGGGGGYGGGGGGGGGGGG 114 [206][TOP] >UniRef100_Q9ZRI2 Environmental stress-induced protein (Fragment) n=1 Tax=Medicago sativa RepID=Q9ZRI2_MEDSA Length = 133 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIV 189 +GGGGYNGGGG H G GGGGY+ GGG GG GG E V Sbjct: 11 HGGGGYNGGGG-HGGYGGGGYNGGGGHGGHGGAESV 45 [207][TOP] >UniRef100_Q8S8J7 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8S8J7_ARATH Length = 127 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/50 (58%), Positives = 30/50 (60%) Frame = +1 Query: 28 GLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 GL YG G Y GGGG+ GGGG H GGGGGGY GGG GGGG Sbjct: 71 GLDGYGGGGGHY------GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGG 114 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG+ GGGG H GGGGG Y GGGG GGGGG Sbjct: 77 GGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 [208][TOP] >UniRef100_Q8LGC0 Putative glycine-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q8LGC0_ARATH Length = 127 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/50 (58%), Positives = 30/50 (60%) Frame = +1 Query: 28 GLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 GL YG G Y GGGG+ GGGG H GGGGGGY GGG GGGG Sbjct: 71 GLDGYGGGGGHY------GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGG 114 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG+ GGGG H GGGGG Y GGGG GGGGG Sbjct: 77 GGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 [209][TOP] >UniRef100_Q2V4A1 Putative uncharacterized protein At2g05440.4 n=1 Tax=Arabidopsis thaliana RepID=Q2V4A1_ARATH Length = 147 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/50 (58%), Positives = 30/50 (60%) Frame = +1 Query: 28 GLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 GL YG G Y GGGG+ GGGG H GGGGG Y GGGG GGGG Sbjct: 71 GLDGYGGGGGHY------GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGG 114 Score = 55.8 bits (133), Expect = 8e-06 Identities = 29/51 (56%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = +1 Query: 40 YGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGY----HNGGGGGGGGGG 180 YG G Y GGGG+ GGGG H GGGGGG+ H GGGGGG GGG Sbjct: 82 YGGGGGHY------GGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 126 [210][TOP] >UniRef100_C5YG12 Putative uncharacterized protein Sb06g028510 n=1 Tax=Sorghum bicolor RepID=C5YG12_SORBI Length = 1092 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/62 (53%), Positives = 33/62 (53%), Gaps = 8/62 (12%) Frame = +1 Query: 19 DSRGLLSYGFRGRRYL*A*YRNGGGGYN------GGGGYHNGGGGGGYHNGGGGG--GGG 174 D RG YG RG Y GGGGY GGGGY G GGGGYH G GG GGG Sbjct: 44 DDRGGGGYGSRGGEY------GGGGGYGPRGGEYGGGGYGGGSGGGGYHQGPRGGEYGGG 97 Query: 175 GG 180 GG Sbjct: 98 GG 99 [211][TOP] >UniRef100_A9U2M5 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9U2M5_PHYPA Length = 219 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 175 YHRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 209 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 +R GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 176 HRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 210 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y +G G +G GGYH GGGGGG GGGGGGGGGG Sbjct: 162 YGDGSGYGHGPGGYHRGGGGGGGGGGGGGGGGGGG 196 [212][TOP] >UniRef100_C3Z6D8 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3Z6D8_BRAFL Length = 325 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/74 (39%), Positives = 38/74 (51%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIVVP*S*TSSFVFFLVPNSISILSIPS 264 GGG GGGGY GGGGGGY GG GGGGGGG P + + ++ ++ Sbjct: 28 GGGRGGGGGGYRQGGGGGGYGGGGRGGGGGGGRSSGPKPIPTEAPYTAFVGNLPFETVQG 87 Query: 265 TSKSDFRGPRLNSM 306 FRG ++ S+ Sbjct: 88 DLDQIFRGLKVKSV 101 [213][TOP] >UniRef100_B7PVB4 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PVB4_IXOSC Length = 226 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 25/35 (71%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 157 YNKGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 191 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 + GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 159 KGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 192 [214][TOP] >UniRef100_B7P9J8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P9J8_IXOSC Length = 107 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 +R GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 58 HRRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 R GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 60 RGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 [215][TOP] >UniRef100_Q1A1A5 Forkhead box protein G1 n=1 Tax=Chlorocebus pygerythrus RepID=FOXG1_CERPY Length = 489 Score = 38.9 bits (89), Expect(2) = 2e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -3 Query: 167 PPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPP P PPPPP PPPP PPPP Sbjct: 58 PPPPAP---QPPPPPQQQPPPP--PPPP 80 Score = 38.5 bits (88), Expect(2) = 2e-06 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 181 HHHHHHHHHHH 149 HHHHHHHHHHH Sbjct: 47 HHHHHHHHHHH 57 [216][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPPL Sbjct: 460 PPPPPPPPPP---PPPPPP---PPPPPPPPPPL 486 [217][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 231 APPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 260 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 PPPPPPPPPP PPPPPP PPPP PPPP + Sbjct: 233 PPPPPPPPPPPPPPPPPPP---PPPPPPPPPPFQ 263 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYR 63 PPPPPPPPPP PPPPPP PPPP PPPP +Q R Sbjct: 234 PPPPPPPPPP---PPPPPP---PPPPPPPPPPPPFQPPR 266 [218][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 215 APPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 244 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 220 PPPPPPPPPP---PPPPPP---PPPPPPPPPP 245 [219][TOP] >UniRef100_A4TEZ3 Putative uncharacterized protein n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4TEZ3_MYCGI Length = 177 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP+ PPPL Sbjct: 126 PPPPPPPPPPGAPPPPPPPPPPPPPPVYIPPPL 158 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPL 81 PPPPPPPPPP PPPPPP PPPP PPPP+ Sbjct: 125 PPPPPPPPPPPGAPPPPPP---PPPP--PPPPV 152 [220][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRY 60 +PPPPPPPPPP PPPPPP PPPP PPPP + A ++ Sbjct: 244 APPPPPPPPPP---PPPPPP---PPPPPPPPPPAKPAARQF 278 [221][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLR 78 PPPPPPPPPP PPPPPP PPPP PPPP R Sbjct: 420 PPPPPPPPPP---PPPPPP---PPPPTPPPPPPR 447 Score = 56.2 bits (134), Expect = 6e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP P PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPTPPPPPPRPPSPP 452 [222][TOP] >UniRef100_Q4DD51 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi RepID=Q4DD51_TRYCR Length = 603 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 +PPPPPPPPPP PPPPP PPPP+ PPPP Sbjct: 382 APPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPP 414 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/50 (48%), Positives = 30/50 (60%) Frame = -3 Query: 191 TTISPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNP 42 + + PPPPPPPPP PPPPPP PPP PPPP +++ + P P Sbjct: 378 SALEAPPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPP 427 [223][TOP] >UniRef100_C5JYR8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis SLH14081 RepID=C5JYR8_AJEDS Length = 1704 Score = 57.4 bits (137), Expect = 3e-06 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 11/92 (11%) Frame = -3 Query: 326 GYVETPPIEFSLGPRKSDFEVDG--------IDKIEIEFGTRKKTKELV*D*GTTISPPP 171 G VE P + PR + + G + KI+ + ++K+ + TT PPP Sbjct: 844 GVVERPRLVEIKRPRMNPMQATGLLGEIASRVQKIDESDDEKDESKKPKPEPTTTPKPPP 903 Query: 170 PPPPPPPLW*PPPPPPLW*PPPP---L*PPPP 84 PPPPPP + P PPPP PPPP L PPPP Sbjct: 904 PPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPP 935 [224][TOP] >UniRef100_C5GLX8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GLX8_AJEDR Length = 1750 Score = 57.4 bits (137), Expect = 3e-06 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 11/92 (11%) Frame = -3 Query: 326 GYVETPPIEFSLGPRKSDFEVDG--------IDKIEIEFGTRKKTKELV*D*GTTISPPP 171 G VE P + PR + + G + KI+ + ++K+ + TT PPP Sbjct: 916 GVVERPRLVEIKRPRMNPMQATGLLGEIASRVQKIDESDDEKDESKKPKPEPTTTPKPPP 975 Query: 170 PPPPPPPLW*PPPPPPLW*PPPP---L*PPPP 84 PPPPPP + P PPPP PPPP L PPPP Sbjct: 976 PPPPPPAVGGPLPPPPPPPPPPPGVGLPPPPP 1007 [225][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/52 (53%), Positives = 28/52 (53%) Frame = -3 Query: 182 SPPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPPLRYQAYRYRRPRNPYDSRP 27 SP PPPPPPPP PPPPPP PPPP PPPP PR P P Sbjct: 257 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSP 308 [226][TOP] >UniRef100_UPI0000F2C6D3 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2C6D3 Length = 149 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEIVV 192 R G GG GGGG GGGGGG GGGGGGGGGGE + Sbjct: 31 RGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGEYAI 68 [227][TOP] >UniRef100_UPI0000E4A916 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4A916 Length = 416 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y +GGGG GGGG +GGGGG Y +GGGGGGGGGG Sbjct: 368 YSSGGGGSGGGGG-DSGGGGGDYSSGGGGGGGGGG 401 [228][TOP] >UniRef100_UPI0000E49ED0 PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E49ED0 Length = 337 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y +GGGG GGGG +GGGGG Y +GGGGGGGGGG Sbjct: 289 YSSGGGGSGGGGG-DSGGGGGDYSSGGGGGGGGGG 322 [229][TOP] >UniRef100_UPI0000DB7202 PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB7202 Length = 344 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 Y GGGGY+GGG ++GGGGGGY G GGG GGG Sbjct: 227 YSGGGGGYSGGGNGYSGGGGGGYSGGNGGGYSGGG 261 [230][TOP] >UniRef100_Q2IEA3 CHRD n=1 Tax=Anaeromyxobacter dehalogenans 2CP-C RepID=Q2IEA3_ANADE Length = 413 Score = 57.4 bits (137), Expect = 3e-06 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGG--GGGGEIVVP*S*TSSFVFFLVPNSISILS 255 GGGGY GGGG GGGGGGY +GGGGGG GGGGE + ++VP S LS Sbjct: 24 GGGGYGGGGG---GGGGGGYGDGGGGGGGGGGGGE-------PGAAALWVVPESAPALS 72 [231][TOP] >UniRef100_Q0BCI9 Putative uncharacterized protein n=1 Tax=Burkholderia ambifaria AMMD RepID=Q0BCI9_BURCM Length = 529 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 401 NGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 433 [232][TOP] >UniRef100_B8JHF8 CHRD domain containing protein n=1 Tax=Anaeromyxobacter dehalogenans 2CP-1 RepID=B8JHF8_ANAD2 Length = 412 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 GGGGY GGGG GGGGGGY +GGGGGGGGG Sbjct: 24 GGGGYGGGGG---GGGGGGYGDGGGGGGGGG 51 [233][TOP] >UniRef100_B1JXE0 Putative uncharacterized protein n=1 Tax=Burkholderia cenocepacia MC0-3 RepID=B1JXE0_BURCC Length = 505 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGGG GGGG NG GGGG GGGGGGGGGG Sbjct: 328 NGGGGGGGGGGGGNGNGGGGGGGGGGGGGGGGG 360 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/37 (67%), Positives = 28/37 (75%), Gaps = 4/37 (10%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGG----GGGYHNGGGGGGGGGG 180 +GGGG+ GGG+ NGGG GGG NGGGGGGGGGG Sbjct: 302 DGGGGHGNGGGHGNGGGGNGNGGGPGNGGGGGGGGGG 338 [234][TOP] >UniRef100_Q8LPA7 Cold shock protein-1 n=1 Tax=Triticum aestivum RepID=Q8LPA7_WHEAT Length = 229 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = +1 Query: 79 RNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 R G GGY GGGGY GGGGGGY GGGG GGGGG Sbjct: 89 RGGRGGY-GGGGYGGGGGGGGYGGGGGGYGGGGG 121 [235][TOP] >UniRef100_C1N2F3 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N2F3_9CHLO Length = 379 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGG+ GGGG+ GGGGGG GGGGG GGGG Sbjct: 57 GGGGFGGGGGFGGGGGGGGGRGGGGGGRGGGG 88 [236][TOP] >UniRef100_C1E9S3 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E9S3_9CHLO Length = 461 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 6/38 (15%) Frame = +1 Query: 85 GGGGYNG------GGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY G GGGY GGGGGGY GGGG GGGGG Sbjct: 398 GGGGYGGRGGGGRGGGYRGGGGGGGYGGGGGGYGGGGG 435 Score = 56.6 bits (135), Expect = 5e-06 Identities = 34/58 (58%), Positives = 35/58 (60%), Gaps = 6/58 (10%) Frame = +1 Query: 25 RGLLSYGFRGRRYL*A*YRNGGGG--YNGGGGYHNGGGGGGYHNGG--GG--GGGGGG 180 RG YG RG YR GGGG Y GGGG + GGGGGGY GG GG GGGGGG Sbjct: 397 RGGGGYGGRGGGGRGGGYRGGGGGGGYGGGGGGYGGGGGGGYGGGGDRGGYRGGGGGG 454 [237][TOP] >UniRef100_A9SDN8 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SDN8_PHYPA Length = 1271 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGE 183 + GGGG GGGG GGGGGG GGGGGGGGGGE Sbjct: 143 HSRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGE 178 [238][TOP] >UniRef100_A8JAG8 Argonaute-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=A8JAG8_CHLRE Length = 1037 Score = 57.4 bits (137), Expect = 3e-06 Identities = 34/62 (54%), Positives = 35/62 (56%), Gaps = 5/62 (8%) Frame = +1 Query: 25 RGLLSYGFRGRRYL*A*YRNGGGGYNGGGGY--HNGGGGGGYHNG---GGGGGGGGGEIV 189 RG YG GR GGGGY GGGG GGGGGGY G GGGGGGGGG +V Sbjct: 38 RGGGGYGGGGRG------GGGGGGYGGGGGGGGRGGGGGGGYGGGGGRGGGGGGGGGGVV 91 Query: 190 VP 195 P Sbjct: 92 SP 93 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 4/38 (10%) Frame = +1 Query: 79 RNGGGGYNGGGGY----HNGGGGGGYHNGGGGGGGGGG 180 R GGGG GGGGY GGGGGGY GGGGGG GGG Sbjct: 31 RGGGGGDRGGGGYGGGGRGGGGGGGYGGGGGGGGRGGG 68 [239][TOP] >UniRef100_Q9VX67 CG5172, isoform D n=1 Tax=Drosophila melanogaster RepID=Q9VX67_DROME Length = 172 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/57 (52%), Positives = 34/57 (59%) Frame = +1 Query: 7 MLQVDSRGLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 ++ + S GLL G G Y GGGGY GGGG +G GGGG NGGGG GGGG Sbjct: 14 LIALTSAGLLGGGGGGGGY----GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 66 [240][TOP] >UniRef100_Q8MYW0 RH06401p n=1 Tax=Drosophila melanogaster RepID=Q8MYW0_DROME Length = 93 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/57 (52%), Positives = 34/57 (59%) Frame = +1 Query: 7 MLQVDSRGLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 ++ + S GLL G G Y GGGGY GGGG +G GGGG NGGGG GGGG Sbjct: 14 LIALTSAGLLGGGGGGGGY----GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 66 [241][TOP] >UniRef100_Q7KUW8 CG5172, isoform C n=1 Tax=Drosophila melanogaster RepID=Q7KUW8_DROME Length = 106 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/57 (52%), Positives = 34/57 (59%) Frame = +1 Query: 7 MLQVDSRGLLSYGFRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 ++ + S GLL G G Y GGGGY GGGG +G GGGG NGGGG GGGG Sbjct: 14 LIALTSAGLLGGGGGGGGY----GGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 66 [242][TOP] >UniRef100_O96853 ORF 1 n=1 Tax=Schistosoma haematobium RepID=O96853_SCHHA Length = 194 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/38 (68%), Positives = 26/38 (68%), Gaps = 3/38 (7%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGG---GGYHNGGGGGGGGGG 180 Y GGGGY GGGGY G G GGY GGGGGGGGGG Sbjct: 76 YGGGGGGYEGGGGYGGGCNGDDCGGYGGGGGGGGGGGG 113 [243][TOP] >UniRef100_B7Q768 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q768_IXOSC Length = 230 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +1 Query: 82 NGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 NGGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 157 NGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 189 [244][TOP] >UniRef100_B7PNW2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNW2_IXOSC Length = 142 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = +1 Query: 46 FRGRRYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 FRG+R GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 85 FRGKR-------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122 [245][TOP] >UniRef100_B7PDJ8 SGRP-1, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ8_IXOSC Length = 166 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/41 (68%), Positives = 28/41 (68%) Frame = +1 Query: 58 RYL*A*YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 R L A R GGGG GGGG GGGGGG GGGGGGGGGG Sbjct: 92 RTLPAMTRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 132 [246][TOP] >UniRef100_B4JLJ8 GH12877 n=1 Tax=Drosophila grimshawi RepID=B4JLJ8_DROGR Length = 96 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/44 (63%), Positives = 28/44 (63%), Gaps = 12/44 (27%) Frame = +1 Query: 85 GGGGYNGGGGYHNGG-GGGGY-----------HNGGGGGGGGGG 180 GGGGY GGGGY GG GGGGY H GGGGGGGGGG Sbjct: 27 GGGGYGGGGGYGGGGHGGGGYGGGHGGGHGGGHGGGGGGGGGGG 70 [247][TOP] >UniRef100_B3M8D6 GF25019 n=1 Tax=Drosophila ananassae RepID=B3M8D6_DROAN Length = 164 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 88 GGGYNGGGGYHNGGGGGGYHNGGGGGGGGGGEI 186 GGG GGGG +GGGGGG +GGGGGGGGGGEI Sbjct: 55 GGGGGGGGGGSSGGGGGGGGSGGGGGGGGGGEI 87 [248][TOP] >UniRef100_C9SP10 ATP-dependent RNA helicase DBP2 n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9SP10_9PEZI Length = 577 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +1 Query: 76 YRNGGGGYNGGGGYHNGGGGGGYHNGGGGGGGGG 177 Y GGGGY GGGG + GGGGGGY GG GG GGG Sbjct: 10 YGGGGGGYGGGGGGYGGGGGGGYGGGGRGGYGGG 43 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 85 GGGGYNGGGGYHNGGGGGGYHNGGGGGGGGGG 180 GGGGY GGGG + GGGGGGY GGGGG GGGG Sbjct: 6 GGGGYGGGGGGY-GGGGGGYGGGGGGGYGGGG 36 [249][TOP] >UniRef100_UPI00005A3748 PREDICTED: similar to Splicing factor 1 (Zinc finger protein 162) (Transcription factor ZFM1) (Zinc finger gene in MEN1 locus) (Mammalian branch point binding protein mBBP) (BBP) isoform 8 n=1 Tax=Canis lupus familiaris RepID=UPI00005A3748 Length = 758 Score = 57.0 bits (136), Expect = 4e-06 Identities = 29/55 (52%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = -3 Query: 185 ISPPPPPPPPPPLW*PPPPP-PLW*PPPPL*PPPPLRYQAYRYRRPRNPY-DSRP 27 + PPPPPPPPPP PPPPP P PPP PPPP YQ +P P+ D +P Sbjct: 68 LPPPPPPPPPPPQQPPPPPPSPGSSYPPPQPPPPPPLYQRVSPPQPPPPHQDQQP 122 [250][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 270 PPPPPPPPPP---PPPPPPPPPPPPPPPPPPP 298 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 179 PPPPPPPPPPLW*PPPPPPLW*PPPPL*PPPP 84 PPPPPPPPPP PPPPPP PPPP PPPP Sbjct: 274 PPPPPPPPPP---PPPPPP---PPPPPPPPPP 299