[UP]
[1][TOP] >UniRef100_B7NH13 Regulator of the 4HPA-hydroxylase operon n=1 Tax=Escherichia coli UMN026 RepID=B7NH13_ECOLU Length = 296 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAALEHYWQLIERE Sbjct: 117 ETFGLPGICLSLADKPDELAALEHYWQLIERE 148 [2][TOP] >UniRef100_B7LQK2 Regulator of the 4HPA-hydroxylase operon n=1 Tax=Escherichia fergusonii ATCC 35469 RepID=B7LQK2_ESCF3 Length = 296 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAALEHYWQLIERE Sbjct: 117 ETFGLPGICLSLADKPDELAALEHYWQLIERE 148 [3][TOP] >UniRef100_B6I2M9 4-hydroxyphenylacetate 3-monooxygenase operon regulator n=1 Tax=Escherichia coli SE11 RepID=B6I2M9_ECOSE Length = 296 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAALEHYWQLIERE Sbjct: 117 ETFGLPGICLSLADKPDELAALEHYWQLIERE 148 [4][TOP] >UniRef100_Q6TMH8 HpaA n=1 Tax=Escherichia coli RepID=Q6TMH8_ECOLX Length = 297 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAALEHYWQLIERE Sbjct: 117 ETFGLPGICLSLADKPDELAALEHYWQLIERE 148 [5][TOP] >UniRef100_Q46985 Regulator of the 4HPA-hydroxylase operon n=2 Tax=Escherichia coli RepID=Q46985_ECOLX Length = 295 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAALEHYWQLIERE Sbjct: 116 ETFGLPGICLSLADKPDELAALEHYWQLIERE 147 [6][TOP] >UniRef100_B3X633 4-hydroxyphenylacetate catabolism regulatory protein HpaA n=1 Tax=Shigella dysenteriae 1012 RepID=B3X633_SHIDY Length = 296 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAALEHYWQLIERE Sbjct: 117 ETFGLPGICLSLADKPDELAALEHYWQLIERE 148 [7][TOP] >UniRef100_C6EBM3 HpaA n=7 Tax=Escherichia coli RepID=C6EBM3_ECOBD Length = 296 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAALEHYWQLIERE Sbjct: 117 ETFGLPGICLSLADKPDELAALEHYWQLIERE 148 [8][TOP] >UniRef100_C8TQ98 Regulator of the 4HPA-hydroxylase operon n=4 Tax=Escherichia coli RepID=C8TQ98_ECOLX Length = 296 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAALEHYWQLIERE Sbjct: 117 ETFGLPGICLSLADKPDELAALEHYWQLIERE 148 [9][TOP] >UniRef100_B5Y2D4 4-hydroxyphenylacetate catabolism regulatory protein HpaA n=1 Tax=Klebsiella pneumoniae 342 RepID=B5Y2D4_KLEP3 Length = 296 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAAL HYWQLI RE Sbjct: 117 ETFGLPGICLSLADKPDELAALAHYWQLIRRE 148 [10][TOP] >UniRef100_A6THU3 4-hydroxyphenylacetate catabolism n=1 Tax=Klebsiella pneumoniae subsp. pneumoniae MGH 78578 RepID=A6THU3_KLEP7 Length = 296 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAAL HYWQLI RE Sbjct: 117 ETFGLPGICLSLADKPDELAALAHYWQLIRRE 148 [11][TOP] >UniRef100_C8TBV3 4-hydroxyphenylacetate catabolism regulatory protein HpaA n=1 Tax=Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884 RepID=C8TBV3_KLEPR Length = 296 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAAL HYWQLI RE Sbjct: 117 ETFGLPGICLSLADKPDELAALAHYWQLIRRE 148 [12][TOP] >UniRef100_C4X2T4 4-hydroxyphenylacetate catabolism regulatory protein n=1 Tax=Klebsiella pneumoniae NTUH-K2044 RepID=C4X2T4_KLEPN Length = 296 Score = 66.6 bits (161), Expect = 8e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 ETFGLPGICLSLADKPDELAAL HYWQLI RE Sbjct: 117 ETFGLPGICLSLADKPDELAALAHYWQLIRRE 148 [13][TOP] >UniRef100_UPI0001AF4B03 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein n=1 Tax=Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191 RepID=UPI0001AF4B03 Length = 298 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADKP+ELAAL+HYWQLIERE Sbjct: 117 EAFGLPGICLSLADKPNELAALKHYWQLIERE 148 [14][TOP] >UniRef100_C0Q898 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein n=1 Tax=Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 RepID=C0Q898_SALPC Length = 298 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADKP+ELAAL+HYWQLIERE Sbjct: 117 EAFGLPGICLSLADKPNELAALKHYWQLIERE 148 [15][TOP] >UniRef100_B5R6F9 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein n=1 Tax=Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 RepID=B5R6F9_SALG2 Length = 298 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADKP+ELAAL+HYWQLIERE Sbjct: 117 EAFGLPGICLSLADKPNELAALKHYWQLIERE 148 [16][TOP] >UniRef100_A9MH56 Putative uncharacterized protein n=1 Tax=Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- RepID=A9MH56_SALAR Length = 298 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADKP+ELAAL+HYWQLIERE Sbjct: 117 EAFGLPGICLSLADKPNELAALKHYWQLIERE 148 [17][TOP] >UniRef100_Q9RPV2 HpaA n=1 Tax=Salmonella enterica subsp. enterica serovar Dublin RepID=Q9RPV2_SALDU Length = 298 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADKP+ELAAL+HYWQLIERE Sbjct: 117 EAFGLPGICLSLADKPNELAALKHYWQLIERE 148 [18][TOP] >UniRef100_B4T2U1 4-hydroxyphenylacetate catabolism regulatory protein HpaA n=24 Tax=Salmonella enterica RepID=B4T2U1_SALNS Length = 298 Score = 65.5 bits (158), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADKP+ELAAL+HYWQLIERE Sbjct: 117 EAFGLPGICLSLADKPNELAALKHYWQLIERE 148 [19][TOP] >UniRef100_UPI00018266FA hypothetical protein ENTCAN_00689 n=1 Tax=Enterobacter cancerogenus ATCC 35316 RepID=UPI00018266FA Length = 310 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADKPDEL+AL+HYWQLI+RE Sbjct: 117 EAFGLPGICLSLADKPDELSALKHYWQLIKRE 148 [20][TOP] >UniRef100_UPI0001913A02 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein n=1 Tax=Salmonella enterica subsp. enterica serovar Typhi str. AG3 RepID=UPI0001913A02 Length = 231 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADK +ELAAL+HYWQLIERE Sbjct: 50 EAFGLPGICLSLADKLNELAALKHYWQLIERE 81 [21][TOP] >UniRef100_UPI000190FBC6 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein n=1 Tax=Salmonella enterica subsp. enterica serovar Typhi str. E01-6750 RepID=UPI000190FBC6 Length = 187 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADK +ELAAL+HYWQLIERE Sbjct: 6 EAFGLPGICLSLADKLNELAALKHYWQLIERE 37 [22][TOP] >UniRef100_Q8Z7P7 4-hydroxyphenylacetate 3-monooxygenase operon regulatory protein n=2 Tax=Salmonella enterica subsp. enterica serovar Typhi RepID=Q8Z7P7_SALTI Length = 298 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 96 ETFGLPGICLSLADKPDELAALEHYWQLIERE 1 E FGLPGICLSLADK +ELAAL+HYWQLIERE Sbjct: 117 EAFGLPGICLSLADKLNELAALKHYWQLIERE 148