[UP]
[1][TOP] >UniRef100_Q7XY84 Histone H2B n=1 Tax=Griffithsia japonica RepID=Q7XY84_GRIJA Length = 124 Score = 80.5 bits (197), Expect = 7e-14 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E+ + YN SKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS Sbjct: 76 EAAKLATYNNSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 123 [2][TOP] >UniRef100_UPI00015B4251 PREDICTED: similar to SJCHGC01604 protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B4251 Length = 131 Score = 78.2 bits (191), Expect = 3e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ S YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 82 EASRLSGYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYNS 129 [3][TOP] >UniRef100_UPI0000DB6C2D PREDICTED: similar to Histone H2B n=1 Tax=Apis mellifera RepID=UPI0000DB6C2D Length = 126 Score = 78.2 bits (191), Expect = 3e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS S YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 72 RIASEASRLSHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 123 [4][TOP] >UniRef100_C1C013 Histone H2B n=1 Tax=Caligus clemensi RepID=C1C013_9MAXI Length = 124 Score = 78.2 bits (191), Expect = 3e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 ESSRPAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [5][TOP] >UniRef100_P35067 Histone H2B n=1 Tax=Acropora formosa RepID=H2B_ACRFO Length = 125 Score = 78.2 bits (191), Expect = 3e-13 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +2 Query: 386 LRIESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 + +ES+ S YNK T++SREIQTA+RLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 IAVESSRLSLYNKKATISSREIQTAIRLLLPGELAKHAVSEGTKAVTKYTS 123 [6][TOP] >UniRef100_UPI000186CBA7 histone H2B.3, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186CBA7 Length = 156 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ S YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 107 EASRLSHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 154 [7][TOP] >UniRef100_UPI000186C9F1 histone H2B.3, putative n=1 Tax=Pediculus humanus corporis RepID=UPI000186C9F1 Length = 123 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ S YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLSHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [8][TOP] >UniRef100_UPI000185FB0C hypothetical protein BRAFLDRAFT_56905 n=1 Tax=Branchiostoma floridae RepID=UPI000185FB0C Length = 122 Score = 77.8 bits (190), Expect = 5e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 69 RIASEASRLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 120 [9][TOP] >UniRef100_UPI00017C36E0 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Bos taurus RepID=UPI00017C36E0 Length = 67 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS Sbjct: 18 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 65 [10][TOP] >UniRef100_UPI000179293E PREDICTED: similar to Histone H2B n=1 Tax=Acyrthosiphon pisum RepID=UPI000179293E Length = 126 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 ESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [11][TOP] >UniRef100_UPI00017916BA PREDICTED: similar to late histone H2B.L4 n=1 Tax=Acyrthosiphon pisum RepID=UPI00017916BA Length = 126 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 ESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [12][TOP] >UniRef100_UPI0001791437 PREDICTED: similar to histone H2B-3 n=1 Tax=Acyrthosiphon pisum RepID=UPI0001791437 Length = 126 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 ESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [13][TOP] >UniRef100_UPI0000EBEB77 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Bos taurus RepID=UPI0000EBEB77 Length = 126 Score = 77.8 bits (190), Expect = 5e-13 Identities = 42/59 (71%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = +2 Query: 368 CFSTLCLRIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 C S + RI AS + YNKS T+ SREIQTA+RLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 66 CVSDIFERISGEASRLAHYNKSSTIISREIQTAMRLLLPGELAKHAVSEGTKAVTKYTS 124 [14][TOP] >UniRef100_C1BXC0 Histone H2B n=1 Tax=Esox lucius RepID=C1BXC0_ESOLU Length = 124 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 ESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [15][TOP] >UniRef100_C1BLJ0 Histone H2B n=1 Tax=Osmerus mordax RepID=C1BLJ0_OSMMO Length = 124 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 ESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [16][TOP] >UniRef100_Q29574 Histone H2B (Fragment) n=1 Tax=Sus scrofa RepID=Q29574_PIG Length = 69 Score = 77.8 bits (190), Expect = 5e-13 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +2 Query: 392 IESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 +E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 19 VEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 67 [17][TOP] >UniRef100_Q17ER2 Histone H2B n=1 Tax=Aedes aegypti RepID=Q17ER2_AEDAE Length = 124 Score = 77.8 bits (190), Expect = 5e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [18][TOP] >UniRef100_C3YWC7 Histone H2B n=1 Tax=Branchiostoma floridae RepID=C3YWC7_BRAFL Length = 122 Score = 77.8 bits (190), Expect = 5e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 69 RIASEASRLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 120 [19][TOP] >UniRef100_C1BTT0 Histone H2B n=1 Tax=Lepeophtheirus salmonis RepID=C1BTT0_9MAXI Length = 123 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 ESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [20][TOP] >UniRef100_C1BPS2 Histone H2B n=1 Tax=Caligus rogercresseyi RepID=C1BPS2_9MAXI Length = 125 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 76 ESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 123 [21][TOP] >UniRef100_P69069 Histone H2B n=2 Tax=Salmoninae RepID=H2B_ONCMY Length = 124 Score = 77.8 bits (190), Expect = 5e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 ESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [22][TOP] >UniRef100_UPI00017F0810 PREDICTED: similar to histone H2B n=1 Tax=Sus scrofa RepID=UPI00017F0810 Length = 248 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 195 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 246 [23][TOP] >UniRef100_UPI0000F2C498 PREDICTED: similar to LReO_3 n=1 Tax=Monodelphis domestica RepID=UPI0000F2C498 Length = 126 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [24][TOP] >UniRef100_A0JLV3 Histone H2B (Fragment) n=2 Tax=Euarchontoglires RepID=A0JLV3_MOUSE Length = 123 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 70 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [25][TOP] >UniRef100_UPI00004F0F3F PREDICTED: similar to Hist1h2bj protein n=1 Tax=Bos taurus RepID=UPI00004F0F3F Length = 126 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [26][TOP] >UniRef100_UPI00017B548B UPI00017B548B related cluster n=1 Tax=Tetraodon nigroviridis RepID=UPI00017B548B Length = 259 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 206 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 257 [27][TOP] >UniRef100_Q4T729 Histone H2B (Fragment) n=2 Tax=Tetraodon nigroviridis RepID=Q4T729_TETNG Length = 124 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [28][TOP] >UniRef100_P10853 Histone H2B type 1-F/J/L n=2 Tax=Mus musculus RepID=H2B1F_MOUSE Length = 126 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [29][TOP] >UniRef100_Q8CGP1 Histone H2B type 1-K n=3 Tax=Mus musculus RepID=H2B1K_MOUSE Length = 126 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [30][TOP] >UniRef100_UPI00015DEABC histone cluster 1, H2bk n=1 Tax=Mus musculus RepID=UPI00015DEABC Length = 134 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [31][TOP] >UniRef100_UPI00015DEAB5 histone cluster 1, H2bn n=1 Tax=Mus musculus RepID=UPI00015DEAB5 Length = 134 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [32][TOP] >UniRef100_UPI00015DEAB2 histone cluster 1, H2bn n=1 Tax=Mus musculus RepID=UPI00015DEAB2 Length = 134 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [33][TOP] >UniRef100_UPI00016DFE27 UPI00016DFE27 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016DFE27 Length = 133 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [34][TOP] >UniRef100_UPI00016DFAE2 UPI00016DFAE2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016DFAE2 Length = 132 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [35][TOP] >UniRef100_UPI00016DF9BF UPI00016DF9BF related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016DF9BF Length = 132 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [36][TOP] >UniRef100_UPI00016DF942 UPI00016DF942 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016DF942 Length = 133 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [37][TOP] >UniRef100_UPI00016DF941 UPI00016DF941 related cluster n=2 Tax=Takifugu rubripes RepID=UPI00016DF941 Length = 132 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [38][TOP] >UniRef100_UPI00016DF8D6 UPI00016DF8D6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016DF8D6 Length = 129 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 76 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 127 [39][TOP] >UniRef100_UPI00016DF8D5 UPI00016DF8D5 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016DF8D5 Length = 121 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 68 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 119 [40][TOP] >UniRef100_UPI00016DF8D4 UPI00016DF8D4 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016DF8D4 Length = 125 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 72 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 123 [41][TOP] >UniRef100_UPI00016DF8AC UPI00016DF8AC related cluster n=2 Tax=Takifugu rubripes RepID=UPI00016DF8AC Length = 133 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [42][TOP] >UniRef100_UPI00016DF82C UPI00016DF82C related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016DF82C Length = 132 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [43][TOP] >UniRef100_UPI00003622D9 UPI00003622D9 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00003622D9 Length = 125 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 72 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 123 [44][TOP] >UniRef100_UPI000179D260 UPI000179D260 related cluster n=1 Tax=Bos taurus RepID=UPI000179D260 Length = 67 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 14 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 65 [45][TOP] >UniRef100_Q4SU62 Histone H2B (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SU62_TETNG Length = 124 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [46][TOP] >UniRef100_Q4SU60 Chromosome undetermined SCAF14010, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4SU60_TETNG Length = 258 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 205 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 256 [47][TOP] >UniRef100_Q4SKP4 Histone H2B n=1 Tax=Tetraodon nigroviridis RepID=Q4SKP4_TETNG Length = 67 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 14 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 65 [48][TOP] >UniRef100_Q4SKJ9 Histone H2B n=1 Tax=Tetraodon nigroviridis RepID=Q4SKJ9_TETNG Length = 124 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [49][TOP] >UniRef100_Q4SKJ4 Histone H2B n=2 Tax=Tetraodon nigroviridis RepID=Q4SKJ4_TETNG Length = 124 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [50][TOP] >UniRef100_B6F103 Histone H2B n=1 Tax=Oryzias latipes RepID=B6F103_ORYLA Length = 124 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [51][TOP] >UniRef100_Q921L4 Histone H2B n=1 Tax=Mus musculus RepID=Q921L4_MOUSE Length = 135 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [52][TOP] >UniRef100_Q8CBB6 Histone H2B n=2 Tax=Mus musculus RepID=Q8CBB6_MOUSE Length = 134 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [53][TOP] >UniRef100_A0JNS9 Histone H2B n=1 Tax=Mus musculus RepID=A0JNS9_MOUSE Length = 127 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 125 [54][TOP] >UniRef100_O18643 Histone H2B n=1 Tax=Chaetopterus variopedatus RepID=O18643_CHAVR Length = 123 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 70 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [55][TOP] >UniRef100_B4HDP3 Histone H2B n=1 Tax=Drosophila persimilis RepID=B4HDP3_DROPE Length = 204 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 44/52 (84%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 151 RIASEASRLGHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 202 [56][TOP] >UniRef100_B5DNJ2 Histone H2B n=2 Tax=pseudoobscura subgroup RepID=B5DNJ2_DROPS Length = 127 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 44/52 (84%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 RIASEASRLGHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 125 [57][TOP] >UniRef100_B2ZF89 Histone H2B n=1 Tax=Adineta vaga RepID=B2ZF89_ADIVA Length = 128 Score = 77.4 bits (189), Expect = 6e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 ES+ S YNK T++SREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 79 ESSRLSHYNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 126 [58][TOP] >UniRef100_P35069 Histone H2B.3 n=1 Tax=Tigriopus californicus RepID=H2B3_TIGCA Length = 123 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 70 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [59][TOP] >UniRef100_P35068 Histone H2B.1/H2B.2 n=1 Tax=Tigriopus californicus RepID=H2B1_TIGCA Length = 123 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 70 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [60][TOP] >UniRef100_Q8CGP2 Histone H2B type 1-P n=2 Tax=Mus musculus RepID=H2B1P_MOUSE Length = 126 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [61][TOP] >UniRef100_Q99880 Histone H2B type 1-L n=1 Tax=Homo sapiens RepID=H2B1L_HUMAN Length = 126 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [62][TOP] >UniRef100_Q64475 Histone H2B type 1-B n=1 Tax=Mus musculus RepID=H2B1B_MOUSE Length = 126 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [63][TOP] >UniRef100_P70696 Histone H2B type 1-A n=1 Tax=Mus musculus RepID=H2B1A_MOUSE Length = 127 Score = 77.4 bits (189), Expect = 6e-13 Identities = 42/52 (80%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 RIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 125 [64][TOP] >UniRef100_UPI0001797167 PREDICTED: similar to histone cluster 3, H2bb n=1 Tax=Equus caballus RepID=UPI0001797167 Length = 380 Score = 77.0 bits (188), Expect = 8e-13 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 327 RIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 378 [65][TOP] >UniRef100_UPI0001797166 PREDICTED: similar to histone cluster 3, H2bb n=1 Tax=Equus caballus RepID=UPI0001797166 Length = 126 Score = 77.0 bits (188), Expect = 8e-13 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [66][TOP] >UniRef100_UPI0000D99CD9 PREDICTED: similar to histone 3, H2ba n=1 Tax=Macaca mulatta RepID=UPI0000D99CD9 Length = 126 Score = 77.0 bits (188), Expect = 8e-13 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [67][TOP] >UniRef100_UPI000036D5A6 PREDICTED: hypothetical protein isoform 2 n=1 Tax=Pan troglodytes RepID=UPI000036D5A6 Length = 126 Score = 77.0 bits (188), Expect = 8e-13 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +2 Query: 386 LRIESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 L E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 LASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [68][TOP] >UniRef100_UPI00015A44DD PREDICTED: similar to histone cluster 1, H2bb n=1 Tax=Danio rerio RepID=UPI00015A44DD Length = 124 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASCLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [69][TOP] >UniRef100_UPI0000EB1C35 UPI0000EB1C35 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB1C35 Length = 133 Score = 77.0 bits (188), Expect = 8e-13 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 80 RIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 131 [70][TOP] >UniRef100_UPI000179E7F9 UPI000179E7F9 related cluster n=1 Tax=Bos taurus RepID=UPI000179E7F9 Length = 135 Score = 77.0 bits (188), Expect = 8e-13 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [71][TOP] >UniRef100_UPI000057EDD8 PREDICTED: similar to histone 3, H2ba n=2 Tax=Laurasiatheria RepID=UPI000057EDD8 Length = 126 Score = 77.0 bits (188), Expect = 8e-13 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [72][TOP] >UniRef100_B0X774 Histone H2B n=1 Tax=Culex quinquefasciatus RepID=B0X774_CULQU Length = 127 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 78 EASRLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 125 [73][TOP] >UniRef100_A7SHX4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SHX4_NEMVE Length = 222 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 173 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 220 [74][TOP] >UniRef100_A7SGX3 Histone H2B (Fragment) n=1 Tax=Nematostella vectensis RepID=A7SGX3_NEMVE Length = 119 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 70 EASRLANYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 117 [75][TOP] >UniRef100_A7S708 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S708_NEMVE Length = 220 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 171 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 218 [76][TOP] >UniRef100_A7S6Z7 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S6Z7_NEMVE Length = 219 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 170 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 217 [77][TOP] >UniRef100_A7S4X9 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S4X9_NEMVE Length = 213 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 164 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 211 [78][TOP] >UniRef100_A7RPY4 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RPY4_NEMVE Length = 123 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [79][TOP] >UniRef100_A7RPX4 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RPX4_NEMVE Length = 123 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [80][TOP] >UniRef100_A7RJP7 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RJP7_NEMVE Length = 123 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [81][TOP] >UniRef100_A7RJP4 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RJP4_NEMVE Length = 123 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [82][TOP] >UniRef100_A7RJM8 Histone H2B n=2 Tax=Nematostella vectensis RepID=A7RJM8_NEMVE Length = 67 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 18 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 65 [83][TOP] >UniRef100_A7RJL3 Histone H2B n=1 Tax=Nematostella vectensis RepID=A7RJL3_NEMVE Length = 123 Score = 77.0 bits (188), Expect = 8e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [84][TOP] >UniRef100_Q8N257 Histone H2B type 3-B n=3 Tax=Euarchontoglires RepID=H2B3B_HUMAN Length = 126 Score = 77.0 bits (188), Expect = 8e-13 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [85][TOP] >UniRef100_Q9D2U9 Histone H2B type 3-A n=2 Tax=Mus musculus RepID=H2B3A_MOUSE Length = 126 Score = 77.0 bits (188), Expect = 8e-13 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = +2 Query: 389 RIESTAS--SPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 RI S AS + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 RIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [86][TOP] >UniRef100_UPI00017C2DB4 PREDICTED: similar to histone cluster 1, H2bd, partial n=1 Tax=Bos taurus RepID=UPI00017C2DB4 Length = 160 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 111 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 158 [87][TOP] >UniRef100_UPI0001797587 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Equus caballus RepID=UPI0001797587 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [88][TOP] >UniRef100_A6QQ28 Histone H2B n=5 Tax=Coelomata RepID=A6QQ28_BOVIN Length = 67 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 18 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 65 [89][TOP] >UniRef100_UPI00015B604D PREDICTED: similar to histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B604D Length = 300 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 251 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 298 [90][TOP] >UniRef100_UPI00015B54BC PREDICTED: similar to histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B54BC Length = 103 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 54 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 101 [91][TOP] >UniRef100_UPI00015B4E7C PREDICTED: similar to putative Rho1 n=1 Tax=Nasonia vitripennis RepID=UPI00015B4E7C Length = 277 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 228 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 275 [92][TOP] >UniRef100_UPI00015B4641 PREDICTED: similar to histone H2B, partial n=1 Tax=Nasonia vitripennis RepID=UPI00015B4641 Length = 276 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 227 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 274 [93][TOP] >UniRef100_UPI00015B42A8 PREDICTED: similar to histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B42A8 Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [94][TOP] >UniRef100_UPI00015B4250 PREDICTED: similar to histone H2B n=1 Tax=Nasonia vitripennis RepID=UPI00015B4250 Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [95][TOP] >UniRef100_UPI000155FF60 PREDICTED: similar to histone cluster 1, H2bb n=1 Tax=Equus caballus RepID=UPI000155FF60 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [96][TOP] >UniRef100_UPI000155FD82 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Equus caballus RepID=UPI000155FD82 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [97][TOP] >UniRef100_UPI000155C35B PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C35B Length = 286 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 237 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 284 [98][TOP] >UniRef100_UPI000155C04A PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C04A Length = 266 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 217 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 264 [99][TOP] >UniRef100_UPI000155C044 PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C044 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [100][TOP] >UniRef100_UPI000155C042 PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C042 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [101][TOP] >UniRef100_UPI000155C016 PREDICTED: similar to histone H2B isoform 2 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C016 Length = 264 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 215 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 262 [102][TOP] >UniRef100_UPI000155C015 PREDICTED: similar to histone H2B isoform 1 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C015 Length = 296 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 247 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 294 [103][TOP] >UniRef100_UPI000155C011 PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C011 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [104][TOP] >UniRef100_UPI0000F2BE9D PREDICTED: similar to histone 1, H2bn, n=1 Tax=Monodelphis domestica RepID=UPI0000F2BE9D Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [105][TOP] >UniRef100_UPI0000F21656 PREDICTED: similar to histone cluster 2, H2be n=1 Tax=Danio rerio RepID=UPI0000F21656 Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [106][TOP] >UniRef100_UPI0000EDA60B PREDICTED: similar to histone H2B n=1 Tax=Ornithorhynchus anatinus RepID=UPI0000EDA60B Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [107][TOP] >UniRef100_UPI0000EBCD45 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Bos taurus RepID=UPI0000EBCD45 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [108][TOP] >UniRef100_UPI0000E2EDEC PREDICTED: similar to histone 1, H2bn (predicted) n=1 Tax=Equus caballus RepID=UPI0000E2EDEC Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [109][TOP] >UniRef100_UPI0000E20E07 PREDICTED: similar to histone H2B n=1 Tax=Pan troglodytes RepID=UPI0000E20E07 Length = 152 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 103 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 150 [110][TOP] >UniRef100_UPI0000E20DF2 PREDICTED: similar to histone H2b-616 n=1 Tax=Pan troglodytes RepID=UPI0000E20DF2 Length = 148 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 99 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 146 [111][TOP] >UniRef100_UPI0000E20DF1 PREDICTED: hypothetical protein n=1 Tax=Pan troglodytes RepID=UPI0000E20DF1 Length = 150 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 101 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 148 [112][TOP] >UniRef100_UPI0000DB6C2B PREDICTED: similar to Histone H2B n=1 Tax=Apis mellifera RepID=UPI0000DB6C2B Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [113][TOP] >UniRef100_UPI0000D9B70B PREDICTED: similar to H2B histone family, member T n=1 Tax=Macaca mulatta RepID=UPI0000D9B70B Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [114][TOP] >UniRef100_UPI0000D9AB93 PREDICTED: similar to H2B histone family, member F n=1 Tax=Macaca mulatta RepID=UPI0000D9AB93 Length = 154 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 105 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 152 [115][TOP] >UniRef100_UPI0000D99B9B PREDICTED: similar to Histone H2B 291B n=1 Tax=Macaca mulatta RepID=UPI0000D99B9B Length = 191 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 142 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 189 [116][TOP] >UniRef100_UPI0000D91EDB PREDICTED: similar to histone H2B n=1 Tax=Monodelphis domestica RepID=UPI0000D91EDB Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [117][TOP] >UniRef100_UPI0000D57942 PREDICTED: similar to Histone H2B n=1 Tax=Tribolium castaneum RepID=UPI0000D57942 Length = 165 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 116 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 163 [118][TOP] >UniRef100_UPI0000D578A5 PREDICTED: similar to Histone H2B n=1 Tax=Tribolium castaneum RepID=UPI0000D578A5 Length = 621 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 572 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 619 [119][TOP] >UniRef100_UPI00006D237A PREDICTED: similar to H2B histone family, member E n=1 Tax=Macaca mulatta RepID=UPI00006D237A Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [120][TOP] >UniRef100_UPI00005A5830 PREDICTED: similar to H2B histone family, member T n=2 Tax=Canis lupus familiaris RepID=UPI00005A5830 Length = 137 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [121][TOP] >UniRef100_UPI00005A5828 PREDICTED: similar to H2B histone family, member F n=1 Tax=Canis lupus familiaris RepID=UPI00005A5828 Length = 170 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 100 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 147 [122][TOP] >UniRef100_UPI00005A5823 PREDICTED: similar to H2B histone family, member T n=1 Tax=Canis lupus familiaris RepID=UPI00005A5823 Length = 166 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [123][TOP] >UniRef100_UPI00005A57D9 PREDICTED: similar to histone 1, H2bh isoform 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A57D9 Length = 113 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 64 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 111 [124][TOP] >UniRef100_UPI00005A57CD PREDICTED: similar to histone 1, H2ai (predicted) isoform 1 n=1 Tax=Canis lupus familiaris RepID=UPI00005A57CD Length = 259 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 210 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 257 [125][TOP] >UniRef100_UPI000057D1D2 PREDICTED: similar to histone H2B n=1 Tax=Bos taurus RepID=UPI000057D1D2 Length = 127 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 78 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 125 [126][TOP] >UniRef100_UPI00004EF351 PREDICTED: similar to histone H2B n=1 Tax=Bos taurus RepID=UPI00004EF351 Length = 127 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 78 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 125 [127][TOP] >UniRef100_UPI00003C0EF7 PREDICTED: similar to Histone H2B n=1 Tax=Apis mellifera RepID=UPI00003C0EF7 Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [128][TOP] >UniRef100_UPI00003C0C38 PREDICTED: similar to Histone H2B n=1 Tax=Apis mellifera RepID=UPI00003C0C38 Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [129][TOP] >UniRef100_UPI000019D4F1 PREDICTED: similar to histone cluster 1, H2bc n=1 Tax=Danio rerio RepID=UPI000019D4F1 Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [130][TOP] >UniRef100_UPI000017EAA6 histone cluster 1, H2bm n=1 Tax=Rattus norvegicus RepID=UPI000017EAA6 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [131][TOP] >UniRef100_UPI000017E508 PREDICTED: similar to Histone H2B 291B n=1 Tax=Rattus norvegicus RepID=UPI000017E508 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [132][TOP] >UniRef100_UPI00000706E6 PREDICTED: similar to histone H2b-616 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI00000706E6 Length = 166 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [133][TOP] >UniRef100_Q05AK8 Histone H2B n=2 Tax=Danio rerio RepID=Q05AK8_DANRE Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [134][TOP] >UniRef100_UPI000019E4AD PREDICTED: similar to histone cluster 1, H2bb n=2 Tax=Danio rerio RepID=UPI000019E4AD Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [135][TOP] >UniRef100_UPI00001A1920 PREDICTED: similar to histone cluster 2, H2be n=2 Tax=Danio rerio RepID=UPI00001A1920 Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [136][TOP] >UniRef100_UPI0001A2DC96 UPI0001A2DC96 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2DC96 Length = 133 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [137][TOP] >UniRef100_UPI0001A2DC94 UPI0001A2DC94 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2DC94 Length = 132 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [138][TOP] >UniRef100_UPI0001A2BE55 UPI0001A2BE55 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2BE55 Length = 223 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 174 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 221 [139][TOP] >UniRef100_UPI0001A2BC0F UPI0001A2BC0F related cluster n=1 Tax=Danio rerio RepID=UPI0001A2BC0F Length = 223 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 174 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 221 [140][TOP] >UniRef100_UPI0001A2BC0E UPI0001A2BC0E related cluster n=1 Tax=Danio rerio RepID=UPI0001A2BC0E Length = 155 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 106 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 153 [141][TOP] >UniRef100_UPI0001A2BC0D UPI0001A2BC0D related cluster n=1 Tax=Danio rerio RepID=UPI0001A2BC0D Length = 224 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 175 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 222 [142][TOP] >UniRef100_UPI0001A2BBF5 UPI0001A2BBF5 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2BBF5 Length = 223 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 174 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 221 [143][TOP] >UniRef100_UPI0001A2BBF3 UPI0001A2BBF3 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2BBF3 Length = 223 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 174 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 221 [144][TOP] >UniRef100_UPI0001A2BBEE UPI0001A2BBEE related cluster n=1 Tax=Danio rerio RepID=UPI0001A2BBEE Length = 223 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 174 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 221 [145][TOP] >UniRef100_UPI0001A2B862 UPI0001A2B862 related cluster n=1 Tax=Danio rerio RepID=UPI0001A2B862 Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [146][TOP] >UniRef100_UPI0000549337 UPI0000549337 related cluster n=1 Tax=Danio rerio RepID=UPI0000549337 Length = 223 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 174 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 221 [147][TOP] >UniRef100_UPI00001A18AF PREDICTED: similar to histone cluster 2, H2be n=1 Tax=Danio rerio RepID=UPI00001A18AF Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [148][TOP] >UniRef100_UPI00001A1151 Histone H2B 1/2. n=1 Tax=Danio rerio RepID=UPI00001A1151 Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [149][TOP] >UniRef100_UPI00006A20D7 UPI00006A20D7 related cluster n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A20D7 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [150][TOP] >UniRef100_UPI00006A1E66 UPI00006A1E66 related cluster n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A1E66 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [151][TOP] >UniRef100_UPI00006A13CB UPI00006A13CB related cluster n=2 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A13CB Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [152][TOP] >UniRef100_UPI00006A139C UPI00006A139C related cluster n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00006A139C Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [153][TOP] >UniRef100_UPI00004DB2CA UPI00004DB2CA related cluster n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004DB2CA Length = 120 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 118 [154][TOP] >UniRef100_UPI00004D92E8 UPI00004D92E8 related cluster n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D92E8 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [155][TOP] >UniRef100_UPI000011153F HISTONE H2B n=1 Tax=Xenopus laevis RepID=UPI000011153F Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [156][TOP] >UniRef100_UPI00017B0938 UPI00017B0938 related cluster n=1 Tax=Tetraodon nigroviridis RepID=UPI00017B0938 Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 85 EASRLAQYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 132 [157][TOP] >UniRef100_UPI00015528CC histone cluster 1, H2bn n=1 Tax=Rattus norvegicus RepID=UPI00015528CC Length = 138 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [158][TOP] >UniRef100_UPI00005020AB UPI00005020AB related cluster n=1 Tax=Rattus norvegicus RepID=UPI00005020AB Length = 138 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [159][TOP] >UniRef100_UPI00005020A8 UPI00005020A8 related cluster n=1 Tax=Rattus norvegicus RepID=UPI00005020A8 Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [160][TOP] >UniRef100_UPI00005020A7 UPI00005020A7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI00005020A7 Length = 133 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [161][TOP] >UniRef100_Q6ZWY9 Histone H2B type 1-C/E/G n=5 Tax=Eutheria RepID=H2B1C_MOUSE Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [162][TOP] >UniRef100_UPI00001820F8 PREDICTED: similar to histone 2, H2be n=1 Tax=Rattus norvegicus RepID=UPI00001820F8 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [163][TOP] >UniRef100_UPI000017E318 PREDICTED: similar to Histone H2B 291B n=1 Tax=Rattus norvegicus RepID=UPI000017E318 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [164][TOP] >UniRef100_UPI00015DEAD1 histone cluster 1, H2be n=1 Tax=Mus musculus RepID=UPI00015DEAD1 Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [165][TOP] >UniRef100_UPI00015DEAD0 histone cluster 1, H2be n=1 Tax=Mus musculus RepID=UPI00015DEAD0 Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [166][TOP] >UniRef100_UPI00015DEACF histone cluster 1, H2bh n=1 Tax=Mus musculus RepID=UPI00015DEACF Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [167][TOP] >UniRef100_P58876 Histone H2B type 1-D n=5 Tax=Eutheria RepID=H2B1D_HUMAN Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [168][TOP] >UniRef100_UPI00016E4C62 UPI00016E4C62 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4C62 Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAQYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [169][TOP] >UniRef100_UPI0000EB0118 UPI0000EB0118 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB0118 Length = 135 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [170][TOP] >UniRef100_UPI0000EB0117 UPI0000EB0117 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB0117 Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [171][TOP] >UniRef100_UPI0000EB0113 UPI0000EB0113 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB0113 Length = 135 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [172][TOP] >UniRef100_O60814 Histone H2B type 1-K n=2 Tax=Eutheria RepID=H2B1K_HUMAN Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [173][TOP] >UniRef100_UPI0000EB0111 UPI0000EB0111 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB0111 Length = 138 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [174][TOP] >UniRef100_UPI0000EB010F UPI0000EB010F related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB010F Length = 140 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [175][TOP] >UniRef100_UPI0000EB010D UPI0000EB010D related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB010D Length = 135 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [176][TOP] >UniRef100_UPI0000EB010C UPI0000EB010C related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB010C Length = 135 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [177][TOP] >UniRef100_UPI0000EB0108 UPI0000EB0108 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB0108 Length = 135 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [178][TOP] >UniRef100_P06899 Histone H2B type 1-J n=2 Tax=Eutheria RepID=H2B1J_HUMAN Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [179][TOP] >UniRef100_UPI0000EB0100 UPI0000EB0100 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB0100 Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [180][TOP] >UniRef100_UPI0000EB00FD UPI0000EB00FD related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00FD Length = 135 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [181][TOP] >UniRef100_UPI0000EB00FB UPI0000EB00FB related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00FB Length = 137 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 88 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 135 [182][TOP] >UniRef100_UPI0000EB00F3 UPI0000EB00F3 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00F3 Length = 135 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [183][TOP] >UniRef100_UPI0000EB00F2 UPI0000EB00F2 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00F2 Length = 140 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [184][TOP] >UniRef100_UPI0000EB00ED UPI0000EB00ED related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00ED Length = 137 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [185][TOP] >UniRef100_UPI0000EB00EC UPI0000EB00EC related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00EC Length = 135 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [186][TOP] >UniRef100_UPI0000EB00EA UPI0000EB00EA related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00EA Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [187][TOP] >UniRef100_UPI0000EB00E6 UPI0000EB00E6 related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00E6 Length = 136 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [188][TOP] >UniRef100_P33778 Histone H2B type 1-B n=2 Tax=Eutheria RepID=H2B1B_HUMAN Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [189][TOP] >UniRef100_UPI0000EB00DE UPI0000EB00DE related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00DE Length = 134 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [190][TOP] >UniRef100_UPI0000EB00DD UPI0000EB00DD related cluster n=1 Tax=Canis lupus familiaris RepID=UPI0000EB00DD Length = 139 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [191][TOP] >UniRef100_UPI00004A73D1 PREDICTED: similar to testis-specific histone 2b n=2 Tax=Canis lupus familiaris RepID=UPI00004A73D1 Length = 127 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 78 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 125 [192][TOP] >UniRef100_UPI00005A581B PREDICTED: similar to testis-specific histone 2b n=2 Tax=Canis lupus familiaris RepID=UPI00005A581B Length = 127 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 78 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 125 [193][TOP] >UniRef100_UPI00005BC09F Histone H2B type 2-E (H2B.q) (H2B/q) (H2B-GL105). n=1 Tax=Bos taurus RepID=UPI00005BC09F Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [194][TOP] >UniRef100_UPI00004F1025 PREDICTED: similar to histone cluster 1, H2bd n=1 Tax=Bos taurus RepID=UPI00004F1025 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [195][TOP] >UniRef100_UPI00004EFFF4 PREDICTED: similar to histone cluster 1, H2bk n=1 Tax=Bos taurus RepID=UPI00004EFFF4 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [196][TOP] >UniRef100_UPI0000ECD1F7 Histone H2B 1/2/3/4/6 (H2B I) (H2B II) (H2B III) (H2B IV) (H2B VI). n=1 Tax=Gallus gallus RepID=UPI0000ECD1F7 Length = 133 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 84 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 131 [197][TOP] >UniRef100_UPI0000ECD1F4 Histone H2B 1/2/3/4/6 (H2B I) (H2B II) (H2B III) (H2B IV) (H2B VI). n=1 Tax=Gallus gallus RepID=UPI0000ECD1F4 Length = 131 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 83 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 130 [198][TOP] >UniRef100_P0C1H3 Histone H2B 1/2/3/4/6 n=2 Tax=Gallus gallus RepID=H2B1_CHICK Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [199][TOP] >UniRef100_UPI000044A513 PREDICTED: similar to Histone H2B n=2 Tax=Gallus gallus RepID=UPI000044A513 Length = 111 Score = 76.6 bits (187), Expect = 1e-12 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +2 Query: 386 LRIESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 L +E++ + YN T+TSRE+QTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 59 LAVEASRLAQYNHRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS 109 [200][TOP] >UniRef100_UPI0000449F22 PREDICTED: similar to histone H2B n=1 Tax=Gallus gallus RepID=UPI0000449F22 Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [201][TOP] >UniRef100_Q92130 Histone H2B n=1 Tax=Xenopus laevis RepID=Q92130_XENLA Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [202][TOP] >UniRef100_Q6AZK7 Histone H2B n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q6AZK7_XENTR Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [203][TOP] >UniRef100_Q28J31 Histone H2B n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q28J31_XENTR Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [204][TOP] >UniRef100_Q28D68 Histone H2B n=1 Tax=Xenopus (Silurana) tropicalis RepID=Q28D68_XENTR Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [205][TOP] >UniRef100_C3KI90 Histone H2B n=1 Tax=Anoplopoma fimbria RepID=C3KI90_9PERC Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [206][TOP] >UniRef100_B3DJF8 Histone H2B n=1 Tax=Danio rerio RepID=B3DJF8_DANRE Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [207][TOP] >UniRef100_A7MC11 Histone H2B n=1 Tax=Danio rerio RepID=A7MC11_DANRE Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [208][TOP] >UniRef100_A5A4L2 Histone H2B n=1 Tax=Bubalus bubalis RepID=A5A4L2_BUBBU Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [209][TOP] >UniRef100_Q963G1 Histone H2B n=1 Tax=Rhynchosciara americana RepID=Q963G1_RHYAM Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [210][TOP] >UniRef100_Q76FF7 Histone H2B (Fragment) n=1 Tax=Drosophila yakuba RepID=Q76FF7_DROYA Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [211][TOP] >UniRef100_Q76FE1 Histone H2B n=1 Tax=Drosophila sechellia RepID=Q76FE1_DROSE Length = 119 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 70 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 117 [212][TOP] >UniRef100_Q76FD3 Histone H2B n=1 Tax=Drosophila sechellia RepID=Q76FD3_DROSE Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [213][TOP] >UniRef100_Q6WV81 Histone H2B n=1 Tax=Mytilus chilensis RepID=Q6WV81_MYTCH Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [214][TOP] >UniRef100_Q17ER9 Histone H2B n=1 Tax=Aedes aegypti RepID=Q17ER9_AEDAE Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [215][TOP] >UniRef100_Q17EF1 Histone H2B n=1 Tax=Aedes aegypti RepID=Q17EF1_AEDAE Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [216][TOP] >UniRef100_C7ENF6 Histone H2B n=1 Tax=Helobdella robusta RepID=C7ENF6_HELRO Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [217][TOP] >UniRef100_B4K2A9 Histone H2B n=1 Tax=Drosophila grimshawi RepID=B4K2A9_DROGR Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [218][TOP] >UniRef100_B4K1Q4 Histone H2B n=1 Tax=Drosophila grimshawi RepID=B4K1Q4_DROGR Length = 101 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 52 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 99 [219][TOP] >UniRef100_B4K0J7 Histone H2B n=1 Tax=Drosophila grimshawi RepID=B4K0J7_DROGR Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [220][TOP] >UniRef100_B4IW93 Histone H2B n=1 Tax=Drosophila yakuba RepID=B4IW93_DROYA Length = 116 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 67 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 114 [221][TOP] >UniRef100_B4IQ64 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4IQ64_DROSE Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [222][TOP] >UniRef100_B4IQ43 Histone H2B (Fragment) n=1 Tax=Drosophila sechellia RepID=B4IQ43_DROSE Length = 113 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 64 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 111 [223][TOP] >UniRef100_B4IQ22 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4IQ22_DROSE Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [224][TOP] >UniRef100_B4IN83 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4IN83_DROSE Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [225][TOP] >UniRef100_B4IMS5 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4IMS5_DROSE Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [226][TOP] >UniRef100_B4NVL0 Histone H2B n=7 Tax=Drosophila RepID=B4NVL0_DROSI Length = 64 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 15 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 62 [227][TOP] >UniRef100_B4IMA8 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4IMA8_DROSE Length = 173 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [228][TOP] >UniRef100_B4IMA6 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4IMA6_DROSE Length = 182 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 63 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 110 [229][TOP] >UniRef100_B4IM98 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4IM98_DROSE Length = 173 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [230][TOP] >UniRef100_B4IM95 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4IM95_DROSE Length = 173 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [231][TOP] >UniRef100_B4ILZ8 Histone H2B n=1 Tax=Drosophila sechellia RepID=B4ILZ8_DROSE Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [232][TOP] >UniRef100_B3S2I2 Histone H2B n=1 Tax=Trichoplax adhaerens RepID=B3S2I2_TRIAD Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAQYNKRSTVTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [233][TOP] >UniRef100_B3N2X1 Histone H2B (Fragment) n=2 Tax=Drosophila RepID=B3N2X1_DROAN Length = 101 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 52 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 99 [234][TOP] >UniRef100_B3N2T9 Histone H2B n=2 Tax=Drosophila RepID=B3N2T9_DROAN Length = 64 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 15 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 62 [235][TOP] >UniRef100_B3N2S2 Histone H2B n=2 Tax=Drosophila RepID=B3N2S2_DROAN Length = 122 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 120 [236][TOP] >UniRef100_B3N2H1 GF20391 n=1 Tax=Drosophila ananassae RepID=B3N2H1_DROAN Length = 192 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 143 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 190 [237][TOP] >UniRef100_B3MUN8 Histone H2B (Fragment) n=2 Tax=melanogaster group RepID=B3MUN8_DROAN Length = 120 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 71 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 118 [238][TOP] >UniRef100_B3FEA5 Histone H2B n=6 Tax=Bivalvia RepID=B3FEA5_VENPH Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [239][TOP] >UniRef100_B0WZ35 Histone H2B n=1 Tax=Culex quinquefasciatus RepID=B0WZ35_CULQU Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [240][TOP] >UniRef100_B0WZ30 Histone H2B n=1 Tax=Culex quinquefasciatus RepID=B0WZ30_CULQU Length = 124 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 75 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 122 [241][TOP] >UniRef100_A8WB74 Histone H2B n=1 Tax=Anthonomus grandis RepID=A8WB74_ANTGR Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [242][TOP] >UniRef100_A7RJN0 Histone H2B (Fragment) n=1 Tax=Nematostella vectensis RepID=A7RJN0_NEMVE Length = 115 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 66 EASHLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 113 [243][TOP] >UniRef100_A2CI31 Histone H2B n=1 Tax=Chlamys farreri RepID=A2CI31_9BIVA Length = 125 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 76 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 123 [244][TOP] >UniRef100_B4DR52 Histone H2B n=1 Tax=Homo sapiens RepID=B4DR52_HUMAN Length = 166 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [245][TOP] >UniRef100_Q5QNW6 Histone H2B type 2-F n=3 Tax=Euarchontoglires RepID=H2B2F_HUMAN Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [246][TOP] >UniRef100_Q75VN4 Histone H2B n=1 Tax=Rhacophorus schlegelii RepID=H2B_RHASC Length = 126 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 77 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 124 [247][TOP] >UniRef100_P19374 Histone H2B n=1 Tax=Platynereis dumerilii RepID=H2B_PLADU Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121 [248][TOP] >UniRef100_P02284 Histone H2B, gonadal n=1 Tax=Patella granatina RepID=H2B_PATGR Length = 122 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 73 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 120 [249][TOP] >UniRef100_P83863 Histone H2B (Fragments) n=1 Tax=Litopenaeus vannamei RepID=H2B_LITVA Length = 116 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 67 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 114 [250][TOP] >UniRef100_Q8I1N0 Histone H2B n=1 Tax=Drosophila yakuba RepID=H2B_DROYA Length = 123 Score = 76.6 bits (187), Expect = 1e-12 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 395 ESTASSPYNKSKTLTSREIQTAVRLLLPGELAKHAVSEGTKAVTKYSS 538 E++ + YNK T+TSREIQTAVRLLLPGELAKHAVSEGTKAVTKY+S Sbjct: 74 EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121