[UP]
[1][TOP] >UniRef100_A2A655 Bromodomain PHD finger transcription factor n=1 Tax=Mus musculus RepID=A2A655_MOUSE Length = 2973 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/68 (47%), Positives = 39/68 (57%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPPPPP G R R R W + ++ P+ + ++ Sbjct: 24 PPPPPPPPPPPPPPPPPPPPASGPIGGLRSRHRGSSRGRWAAAQAEVA-----PKTRLSS 78 Query: 165 PRRDGGGR 142 PR GGGR Sbjct: 79 PR--GGGR 84 [2][TOP] >UniRef100_A2A654 Bromodomain PHD finger transcription factor n=1 Tax=Mus musculus RepID=A2A654_MOUSE Length = 3036 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/68 (47%), Positives = 39/68 (57%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPPPPP G R R R W + ++ P+ + ++ Sbjct: 24 PPPPPPPPPPPPPPPPPPPPASGPIGGLRSRHRGSSRGRWAAAQAEVA-----PKTRLSS 78 Query: 165 PRRDGGGR 142 PR GGGR Sbjct: 79 PR--GGGR 84 [3][TOP] >UniRef100_B8PFG8 Predicted protein n=1 Tax=Postia placenta Mad-698-R RepID=B8PFG8_POSPM Length = 476 Score = 67.4 bits (163), Expect = 5e-10 Identities = 42/106 (39%), Positives = 51/106 (48%), Gaps = 18/106 (16%) Frame = -3 Query: 345 PPPPPPPPPPP----PPPPPPPPPRGGSEPPGRGL-SRAGGRD---------GW*QVR-- 214 PPPPPPPPPPP PPPPPPPPP GGS P GL + A GRD G +R Sbjct: 358 PPPPPPPPPPPSGGMPPPPPPPPPAGGSPGPSAGLPAPAPGRDALLASIQSAGVHMLRKT 417 Query: 213 --TVLSGPPRVPRGKAAAPRRDGGGRLGRVQSVWVVAVRARHRARG 82 P P + +A GGG G + + A+ R++ G Sbjct: 418 DPNATPARPTSPPAEESASSSGGGGGGGDLTAALAAALLERNKKLG 463 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = -3 Query: 345 PPPPPPPPP----PPPPPPPPPPPRGGSEPPGRGLSRAGGRDG 229 PPPPPPPPP PPPPPPPPPPP GG PP AGG G Sbjct: 345 PPPPPPPPPAGGAPPPPPPPPPPPSGGMPPPPPPPPPAGGSPG 387 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/30 (76%), Positives = 24/30 (80%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPP---PPPPPPPPPPPPRGGSEPP 265 PPPPPP P PPPPPPPPPPPP GG+ PP Sbjct: 331 PPPPPPAPSGGPPPPPPPPPPPPAGGAPPP 360 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/32 (68%), Positives = 22/32 (68%), Gaps = 5/32 (15%) Frame = -3 Query: 345 PPPPPPP-----PPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP G PP Sbjct: 330 PPPPPPPAPSGGPPPPPPPPPPPPAGGAPPPP 361 [4][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 66.2 bits (160), Expect = 1e-09 Identities = 35/72 (48%), Positives = 38/72 (52%), Gaps = 5/72 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRV-----PR 181 PPPPPPPPPPPPPPPPPPPP PP + L G G R +GPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPQQPLPGNPGPPG----RPGPAGPPGPPGPPGPP 109 Query: 180 GKAAAPRRDGGG 145 G A P + G G Sbjct: 110 GPAGPPGQAGPG 121 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPP PP Sbjct: 51 PAPPPPPPPPPPPPPPPPPPPPPPPP 76 [5][TOP] >UniRef100_A8NN84 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NN84_COPC7 Length = 550 Score = 66.2 bits (160), Expect = 1e-09 Identities = 44/115 (38%), Positives = 53/115 (46%), Gaps = 6/115 (5%) Frame = -3 Query: 345 PPPPPPPPPP----PPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPP PPPPPPPPPP GG+ PP G G + S PP Sbjct: 403 PPPPPPPPPPGGAAPPPPPPPPPPPGGAVPPPPPPPPPAGGSG--APSALASMPP----- 455 Query: 177 KAAAPRRDGGGRLGRVQSVWVVAVRARHRARGVAGGVAGRVA*DVADA--HGAAA 19 P+ G L +Q + +R ++ AGG + A A A GAAA Sbjct: 456 ----PQPGRGNLLADIQGKGIHVLRKTEKSEAPAGGSSSSGAGTAAAAAVGGAAA 506 [6][TOP] >UniRef100_UPI00005A0B77 PREDICTED: similar to Vesicle-associated membrane protein 2 (VAMP-2) (Synaptobrevin 2) n=1 Tax=Canis lupus familiaris RepID=UPI00005A0B77 Length = 203 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/61 (49%), Positives = 32/61 (52%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPPPPP S PP A T + PP P G+ Sbjct: 60 PPPPPPPPPPPPPPPPPPPP---SRPPAAPAMSA----------TAATAPPAAPAGEGGP 106 Query: 165 P 163 P Sbjct: 107 P 107 [7][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 65.5 bits (158), Expect = 2e-09 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRD 232 PPPPPPPPPPPPPPPPPPPPR + P R LS RD Sbjct: 28 PPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSGVLCRD 65 Score = 63.2 bits (152), Expect = 9e-09 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSR 247 PPPPPPPPPPPPPPPPPPPP PP R +R Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTR 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [8][TOP] >UniRef100_Q4TB69 Chromosome 11 SCAF7190, whole genome shotgun sequence n=1 Tax=Tetraodon nigroviridis RepID=Q4TB69_TETNG Length = 452 Score = 65.1 bits (157), Expect = 2e-09 Identities = 41/83 (49%), Positives = 46/83 (55%), Gaps = 9/83 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP---GRGLSR---AGGRDGW*QVRTVLSGPPRVP 184 PPPPP PPPPPPPPPPPPPPR + PP R +R AG R G + R R Sbjct: 353 PPPPPLPPPPPPPPPPPPPPRPPTCPPTAAARAPARTADAGERGGEGRGRR----RRRAG 408 Query: 183 RGKAAAP---RRDGGGRLGRVQS 124 RG A RR GGGR G V++ Sbjct: 409 RGGTGANWGIRRRGGGRRGEVRA 431 [9][TOP] >UniRef100_B2KTD4 Minicollagen 1 n=1 Tax=Clytia hemisphaerica RepID=B2KTD4_9CNID Length = 149 Score = 65.1 bits (157), Expect = 2e-09 Identities = 34/61 (55%), Positives = 35/61 (57%), Gaps = 7/61 (11%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP------RGGSEPPGR-GLSRAGGRDGW*QVRTVLSGPPRV 187 PPPPPPPPPPPPPPPPPPPP G PPGR G A G G L GPP + Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPAPIPGNPGPPGRPGPPGAPGPAG----PPGLPGPPGI 108 Query: 186 P 184 P Sbjct: 109 P 109 [10][TOP] >UniRef100_A8TMB7 Antisense fragile X mental retardation protein variant A n=1 Tax=Homo sapiens RepID=A8TMB7_HUMAN Length = 100 Score = 65.1 bits (157), Expect = 2e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPPR + PPG G S Sbjct: 48 PPPPPPPPPPPPPPPPPPPPRCRT-PPGSGAS 78 [11][TOP] >UniRef100_Q0U2K7 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0U2K7_PHANO Length = 390 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/40 (70%), Positives = 28/40 (70%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW 226 PPPPPPPPPPPPPPPPPPPP G P GR GRD W Sbjct: 151 PPPPPPPPPPPPPPPPPPPPSG---PSGR------GRDTW 181 [12][TOP] >UniRef100_Q0CQD0 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CQD0_ASPTN Length = 313 Score = 65.1 bits (157), Expect = 2e-09 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP G PP Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPP 165 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPP G PPG Sbjct: 140 PPPPPPPPPPPPPPPPPPPMAGPPPPPG 167 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPP PP G Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPPPG 167 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 3/29 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPP---PPPPRGGSEP 268 PPPPPPPPPPPPPPPP PPPP G P Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPP 171 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 23/30 (76%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPPPP---PPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPPP G PP Sbjct: 144 PPPPPPPPPPPPPPPMAGPPPPP--GPPPP 171 [13][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/51 (54%), Positives = 29/51 (56%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPP 193 PPPPPPPPPPPPPPPPPPPP PP RD W Q + L P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSPLDRDP 117 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP S PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPP 91 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPP 87 [14][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP G+ PP Sbjct: 941 PPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 64.7 bits (156), Expect = 3e-09 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP G PP Sbjct: 942 PPPPPPPPPPPPPPPPPPPPPGAPPPP 968 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPPP PPG Sbjct: 936 PPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP PP G Sbjct: 934 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 963 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 943 PPPPPPPPPPPPPPPPPPPPGAPPPPP 969 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 940 PPPPPPPPPPPPPPPPPPPPPPPGAPP 966 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPP 880 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPP 881 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPP 882 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPP 883 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPP 884 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPP 885 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPP 886 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 926 PPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 927 PPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 928 PPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 929 PPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 930 PPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 931 PPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 932 PPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 933 PPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPP PPP + PPG Sbjct: 948 PPPPPPPPPPPPPPPGAPPPPPPALPPG 975 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPP PPPP Sbjct: 123 PPPPPPPPPPPPPPPQPPPP 142 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPP PP Sbjct: 851 PTTPPPPPPPPPPPPPPPPPPPPPPPP 877 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/29 (72%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPP--PRGGSEPP 265 PPPPPPPPPPP PPPPPP P G PP Sbjct: 952 PPPPPPPPPPPGAPPPPPPALPPGAPPPP 980 [15][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/54 (57%), Positives = 36/54 (66%), Gaps = 6/54 (11%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGS------EPPGRGLSRAGGRDGW*QVRTVLS 202 PPPPPPPPPPPPPPPPPPPP GS +PP R ++ GG G+ + R V S Sbjct: 31 PPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKPPRRHIAFTGG--GYEENRPVTS 82 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [16][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 64.7 bits (156), Expect = 3e-09 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP PPG G Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPGGG 82 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW 226 PPPPPPPPPPPPPPPPPPPP PP G R W Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVDCRQVW 90 Score = 62.0 bits (149), Expect = 2e-08 Identities = 25/38 (65%), Positives = 25/38 (65%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRD 232 PPPPPPPPPPPPPPPPPPPP PP GG D Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/81 (39%), Positives = 36/81 (44%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPPPPP PP PP P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPP-------------------PPPPPPPPPPPPP 75 Query: 165 PRRDGGGRLGRVQSVWVVAVR 103 P GGG + + VW + +R Sbjct: 76 PPPPGGGGVD-CRQVWYLYIR 95 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 [17][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/40 (65%), Positives = 26/40 (65%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW 226 PPPPPPPPPPPPPPPPPPPP PP R R GW Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRPRPYYGHGW 125 Score = 62.4 bits (150), Expect = 1e-08 Identities = 25/40 (62%), Positives = 25/40 (62%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW 226 PPPPPPPPPPPPPPPPPPPP PP R G W Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPPRRRPRPYYGHGWW 126 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPP 111 [18][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 64.7 bits (156), Expect = 3e-09 Identities = 33/63 (52%), Positives = 36/63 (57%), Gaps = 3/63 (4%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QV---RTVLSGPPRVPRGK 175 PPPPPPPPPPPPPPPPPPPP S P + LS A +V + SG RV Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPASTKPPQALSFAKRLQQLVEVLKGGSTFSGAKRVDTAA 416 Query: 174 AAA 166 AAA Sbjct: 417 AAA 419 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPP 378 [19][TOP] >UniRef100_Q4QE97 Formin A n=1 Tax=Leishmania major RepID=Q4QE97_LEIMA Length = 1300 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 2/36 (5%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGS--EPPGRGLSRA 244 PPPPPPPPPPPPPPPPPPP G PPG+G S A Sbjct: 663 PPPPPPPPPPPPPPPPPPPRMGNGPPPPPGKGASGA 698 [20][TOP] >UniRef100_Q00484 Mini-collagen n=1 Tax=Hydra sp. RepID=Q00484_9CNID Length = 149 Score = 64.3 bits (155), Expect = 4e-09 Identities = 37/76 (48%), Positives = 39/76 (51%), Gaps = 7/76 (9%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP------RGGSEPPGR-GLSRAGGRDGW*QVRTVLSGPPRV 187 PPPPPPPPPPPPPPPPPPPP G PPGR G A G +GPP + Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAPLPGNPGPPGRPGPPGAPGP----------AGPPGL 101 Query: 186 PRGKAAAPRRDGGGRL 139 P G P G G L Sbjct: 102 P-GPPGPPGAPGQGGL 116 [21][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 64.3 bits (155), Expect = 4e-09 Identities = 37/83 (44%), Positives = 37/83 (44%), Gaps = 24/83 (28%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP------------------------GRGLSRAGG 238 PPPPPPPPPPPPPPPPPPPP PP RG RAG Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSATATALGARANVVDERGSGRAGL 139 Query: 237 RDGW*QVRTVLSGPPRVPRGKAA 169 RD SGPPR G AA Sbjct: 140 RDP--------SGPPRGVGGSAA 154 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [22][TOP] >UniRef100_B0DG37 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0DG37_LACBS Length = 965 Score = 64.3 bits (155), Expect = 4e-09 Identities = 43/111 (38%), Positives = 49/111 (44%), Gaps = 8/111 (7%) Frame = +2 Query: 38 SATSYATRPATPPATPRARWRAR--------TATTQTDCTRPSLPPPSRRGAAALPRGTR 193 S TSY R + P ++ RA +T + D P PPS G R Sbjct: 814 SWTSYTFRQRSNPMGVQSPSRANGDGNNHRGISTARNDGPPPGGSPPSSNND---DHGRR 870 Query: 194 GGPDRTVRTCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 PD P NP +PPRG GGGGGGGGGGGGGGGGGG Sbjct: 871 PNPD------------PNGSNPPASWYVPPRGNGGGGGGGGGGGGGGGGGG 909 [23][TOP] >UniRef100_P33485 Probable nuclear antigen n=2 Tax=Suid herpesvirus 1 RepID=VNUA_SUHVK Length = 1733 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/44 (63%), Positives = 29/44 (65%), Gaps = 8/44 (18%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSE--------PPGRGLSRAGGR 235 PPPP PPPPPPPPPP PPP GGS PPGRG R GG+ Sbjct: 280 PPPPLPPPPPPPPPPQPPPAGGSARRRRRGGGPPGRGGRRRGGK 323 [24][TOP] >UniRef100_B8LVW5 Proline-rich, actin-associated protein Vrp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8LVW5_TALSN Length = 466 Score = 63.5 bits (153), Expect = 7e-09 Identities = 29/57 (50%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = -3 Query: 345 PPPPPPPPPPPPP----PPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRV 187 PPPPPPPPPPPPP PPPPPPP G P R AGG D + G P++ Sbjct: 2 PPPPPPPPPPPPPSMGGPPPPPPPPPGGSIPARPAKGAGGTDRSALFADINKGAPKL 58 [25][TOP] >UniRef100_B6Q311 Actin associated protein Wsp1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q311_PENMQ Length = 627 Score = 63.5 bits (153), Expect = 7e-09 Identities = 46/119 (38%), Positives = 50/119 (42%), Gaps = 4/119 (3%) Frame = -3 Query: 345 PPPPPPPPP----PPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRG 178 PPPPPPPPP PPPPPPPPPPP G+ PP G PP P G Sbjct: 476 PPPPPPPPPSSGIPPPPPPPPPPPSSGAPPPPPPPPPPPASSG------APPPPPPPPPG 529 Query: 177 KAAAPRRDGGGRLGRVQSVWVVAVRARHRARGVAGGVAGRVA*DVADAHGAAADVNGKS 1 AA P G GR + A RA G GG R D ++A V G S Sbjct: 530 GAAPPPLPSVGGGGRDD------LLAAIRASGGRGGGGLRKVNDTEKRDRSSAMVPGGS 582 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%), Gaps = 4/30 (13%) Frame = -3 Query: 342 PPPPPPP----PPPPPPPPPPPPRGGSEPP 265 PPPPP P PPPPPPPPPPPP G PP Sbjct: 462 PPPPPAPSSGAPPPPPPPPPPPPSSGIPPP 491 [26][TOP] >UniRef100_UPI0000D9B690 PREDICTED: similar to diaphanous 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9B690 Length = 1269 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/60 (50%), Positives = 33/60 (55%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAAP 163 PPPPPPPPPPPPPPPPPPP GS S GG T + PP +P G + P Sbjct: 634 PPPPPPPPPPPPPPPPPPPLIGSVCISSTPSLPGG--------TAIPPPPPLPEGASIPP 685 [27][TOP] >UniRef100_UPI000184A345 DMRT-like family B with proline-rich C-terminal, 1 n=1 Tax=Canis lupus familiaris RepID=UPI000184A345 Length = 346 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPPP+ PPG Sbjct: 264 PPPPPPPPPPPPPPPPPPPPQPQFLPPG 291 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPP 282 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPP 280 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 P PPPPPPPPPPPPPPPPPP +P Sbjct: 260 PLPPPPPPPPPPPPPPPPPPPPPPQP 285 [28][TOP] >UniRef100_Q69340 Pseudorabies virus ORF1, ORF2, and ORF3 n=1 Tax=Suid herpesvirus 1 RepID=Q69340_9ALPH Length = 1958 Score = 63.2 bits (152), Expect = 9e-09 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 10/46 (21%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSE----------PPGRGLSRAGGR 235 PPPP PPPPPPPPPP PPP GGS PPGRG R GG+ Sbjct: 489 PPPPLPPPPPPPPPPQPPPAGGSARRRRRGGGGGPPGRGGRRRGGK 534 [29][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP EPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPEPPP 367 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP +P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPEPPPQP 369 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P +PP Sbjct: 346 PPPPPPPPPPPPPPPPPPEPPPQPDPP 372 [30][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPPR PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPPR PP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPRPCPPPP 109 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP PP R Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 65 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP PP R Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 103 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPRPCPPP 70 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPRPCPPP 108 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPRPCPP 69 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPRPCPP 107 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPP PP R Sbjct: 84 PPPPPPPPPPPPPPPPPPPRPCPPPPPAR 112 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/57 (47%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = -3 Query: 345 PPPPPPPPPPPPPPP---PPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 PPPPPPPPPPPPPPP PPPPP PP G + QV + P +P Sbjct: 88 PPPPPPPPPPPPPPPRPCPPPPPARPCPPPCPPKHECGLPEPCPQVEPIAGEPMPIP 144 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPRPCPPPPP 72 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 47 PPPPPPPPPPPPPPPPPPRPCPPPPPP 73 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 66 PCPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPP---PPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPRPCPPPPPPPPPP 77 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPP---PPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPPP PP Sbjct: 52 PPPPPPPPPPPPPRPCPPPPPPPPPPPPPP 81 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPPP---PPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPPP PP Sbjct: 56 PPPPPPPPPRPCPPPPPPPPPPPPPPPPPP 85 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPP---PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPPP PP Sbjct: 57 PPPPPPPPRPCPPPPPPPPPPPPPPPPPPP 86 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPP---PPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPPP PP Sbjct: 58 PPPPPPPRPCPPPPPPPPPPPPPPPPPPPP 87 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPP---PPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPPP PP Sbjct: 59 PPPPPPRPCPPPPPPPPPPPPPPPPPPPPP 88 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPP---PPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPPP PP Sbjct: 60 PPPPPRPCPPPPPPPPPPPPPPPPPPPPPP 89 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPP---PPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPPP PP Sbjct: 61 PPPPRPCPPPPPPPPPPPPPPPPPPPPPPP 90 [31][TOP] >UniRef100_B9IEK7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IEK7_POPTR Length = 580 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/66 (45%), Positives = 38/66 (57%), Gaps = 2/66 (3%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLS--GPPRVPRGKA 172 PPPPPPP PPPPPPPPPPPP ++PP ++ ++S PP VPRGK Sbjct: 31 PPPPPPPHPPPPPPPPPPPPPTSTKPPLITKKNPASPPPPPKIGGLISLLKPPPVPRGKL 90 Query: 171 AAPRRD 154 + R+ Sbjct: 91 NSKSRE 96 [32][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPPP PPG Sbjct: 101 PPPPPPPPPPPPPPPPPPPPPPPPPPPG 128 Score = 62.4 bits (150), Expect = 1e-08 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSE 271 PPPPPPPPPPPPPPPPPPPP G +E Sbjct: 107 PPPPPPPPPPPPPPPPPPPPPGSAE 131 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 100 PPPPPPPPPPPPPPPPPPPPPPPPPPP 126 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGS 274 PPPPPPPPPPPPPPPPPPPP GS Sbjct: 106 PPPPPPPPPPPPPPPPPPPPPPGS 129 Score = 60.1 bits (144), Expect = 7e-08 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRA 244 PPPPPPPPPPPPPPPPPPP PP G + A Sbjct: 100 PPPPPPPPPPPPPPPPPPPPPPPPPPPPGSAEA 132 [33][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/41 (65%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR-GLSRAGGRDGW 226 PPPPPPPPPPPPPPPPPPPP PP R +SR GW Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRRWLLGW 54 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR 235 PPPPPPPPPPPPPPPPPPPP PP L+ + R Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPHRLTMSRRR 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [34][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/36 (69%), Positives = 25/36 (69%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGG 238 PPPPPPPPPPPPPPPPPPPP PP AGG Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDLAGG 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 [35][TOP] >UniRef100_B0CT66 RhoA GTPase effector DIA/Diaphanous n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0CT66_LACBS Length = 1620 Score = 63.2 bits (152), Expect = 9e-09 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPPP PPG Sbjct: 988 PPPPPPPPPPPPPPPPPPPPPPPPPPPG 1015 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP PP G Sbjct: 986 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPG 1015 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 985 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1011 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGL 253 PPPPPPPPPPPPPPPPPPPP P +G+ Sbjct: 989 PPPPPPPPPPPPPPPPPPPPPPPPPPGFKGI 1019 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGL 253 PPPPPPPPPPPPPPPPPPP G P G+ Sbjct: 996 PPPPPPPPPPPPPPPPPPPGFKGIIPSSSGI 1026 [36][TOP] >UniRef100_O42403 Attachment region binding protein (Fragment) n=1 Tax=Gallus gallus RepID=O42403_CHICK Length = 344 Score = 62.8 bits (151), Expect = 1e-08 Identities = 39/95 (41%), Positives = 46/95 (48%) Frame = +2 Query: 62 PATPPATPRARWRARTATTQTDCTRPSLPPPSRRGAAALPRGTRGGPDRTVRTCHHPSRP 241 PA+PPA P T + P PP+ G +G GG R R + Sbjct: 245 PASPPAPP-------TPLPPSAAHPPPTAPPATHG-----QGLGGGVKRPGRK--RKAEA 290 Query: 242 PARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 +R P+ G P GGGGGGGGGGGGGGG GGGG Sbjct: 291 DSRSVPKKRGRKPGGGGGGGGGGGGGGGGGVGGGG 325 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 191 RGGPDRTVRTCHHPSRPPARDNPRPG-GSLPPRGGGGGGGGGGGGGGGGGGG 343 RG P R R P + + +P G G P+G GGGGGGGGGGGGGGGGG Sbjct: 163 RGSPSR--REQRPPKKAKSPKSPGSGRGRGRPKGSGGGGGGGGGGGGGGGGG 212 [37][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP S PP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 680 PPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 681 PPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P S PP Sbjct: 685 PPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 676 PPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPP PP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPP----PPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPPP PP Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPPPPP----PPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPPP PP Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPPPP----PPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPPP PP Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPPP----PPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPPP PP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPP----PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPPP PP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPP----PPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPPP PP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPP----PPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPPP PP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPP----PPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPPP PP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPP------PPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPPP PP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPP PPP + PP Sbjct: 692 PPPPPPPPPPPHPPPPSPPPLVPALPP 718 [38][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP S PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPP 296 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPP 297 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPP 298 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPP 299 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPP 300 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPP 301 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPP 302 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPP PP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPP PP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPPP PP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPPPPP PP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP PP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPP PP Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPP PP Sbjct: 271 PPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPP PP Sbjct: 272 PPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 273 PPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 274 PPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 275 PSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPP PPPPPPPPPP PP Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPP 254 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPP PPPPP PP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPP 264 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPP PPPPPP PP Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPP PPPPPPP PP Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPP PPPPPPPP PP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPP PPPPPPPPP PP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPP PPPPPPPPPP PP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPP PPPPPPPPPPP PP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPP PPPPPPPPPPPP PP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPP PPPPPPPPPPPPP PP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPP PPPPPPPPPPPPPP PP Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPP PPPPPPP S PP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPP 251 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPP PPPPPPPPPP S PP Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPP 255 [39][TOP] >UniRef100_C0PGT8 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PGT8_MAIZE Length = 787 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/65 (46%), Positives = 33/65 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPP PPPPPPPPR S PP V V P +P + + Sbjct: 432 PPPPPPPPPPPTPPPPPPPPRLPSPPP---------------VEKVTVNPIVLPEKRVST 476 Query: 165 PRRDG 151 P R G Sbjct: 477 PPRTG 481 [40][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 62.8 bits (151), Expect = 1e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP EPP Sbjct: 150 PPPPPPPPPPPPPPPPPPPPPTTLEPP 176 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 151 PPPPPPPPPPPPPPPPPPPPTTLEPPP 177 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 146 PPPPPPPPPPPPPPPPPPPP 165 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 147 PPPPPPPPPPPPPPPPPPPP 166 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 8/35 (22%) Frame = -3 Query: 345 PPPPPPPPPPPPPPP--------PPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPPP SEPP Sbjct: 152 PPPPPPPPPPPPPPPPPPPTTLEPPPPPPTSSEPP 186 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 144 PAPPPPPPPPPPPPPPPPPPPPPPPPP 170 [41][TOP] >UniRef100_UPI0001926BC8 PREDICTED: similar to mini-collagen isoform 1 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC8 Length = 146 Score = 62.4 bits (150), Expect = 1e-08 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 5/34 (14%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP-----RGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP G PPGR Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPVAIPGNPGPPGR 84 [42][TOP] >UniRef100_UPI0001926BC7 PREDICTED: similar to mini-collagen isoform 3 n=1 Tax=Hydra magnipapillata RepID=UPI0001926BC7 Length = 148 Score = 62.4 bits (150), Expect = 1e-08 Identities = 35/75 (46%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP------RGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 PPPPPPPPPPPPPPPPPPPP G PPGR G GPP P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPLPLPGNPGPPGRPGPPGGPGP---------MGPPG-P 100 Query: 183 RGKAAAPRRDGGGRL 139 G P G G L Sbjct: 101 PGPPGPPGNPGQGGL 115 [43][TOP] >UniRef100_UPI0001926BAB PREDICTED: similar to mini-collagen n=1 Tax=Hydra magnipapillata RepID=UPI0001926BAB Length = 149 Score = 62.4 bits (150), Expect = 1e-08 Identities = 35/75 (46%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP------RGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 PPPPPPPPPPPPPPPPPPPP G PPGR G GPP P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPAPLPGNPGPPGRPGPPGGPGP---------MGPPG-P 101 Query: 183 RGKAAAPRRDGGGRL 139 G P G G L Sbjct: 102 PGPPGPPGNPGQGGL 116 [44][TOP] >UniRef100_UPI0000F2C87F PREDICTED: similar to RanBPM n=1 Tax=Monodelphis domestica RepID=UPI0000F2C87F Length = 906 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/65 (46%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPP----PPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRG 178 PPPPPPPP PPPPPPPPPPPP + P G+S A G PP Sbjct: 254 PPPPPPPPTTAAPPPPPPPPPPPPAAAAASPAPGISAAASPAG--------GAPPSASGS 305 Query: 177 KAAAP 163 A AP Sbjct: 306 NAPAP 310 [45][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 62.4 bits (150), Expect = 1e-08 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR 235 PPPPPPPPPPPPPPPPPPPP PP + GG+ Sbjct: 1476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPRTPRGGK 1512 Score = 62.4 bits (150), Expect = 1e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR 235 PPPPPPPPPPPPPPPPPPPP PP R G R Sbjct: 1477 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPRTPRGGKR 1513 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1501 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 1472 PPLPPPPPPPPPPPPPPPPPPPPPPPP 1498 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 1473 PLPPPPPPPPPPPPPPPPPPPPPPPPP 1499 [46][TOP] >UniRef100_UPI00005A0520 PREDICTED: similar to ring finger and KH domain containing 3 n=1 Tax=Canis lupus familiaris RepID=UPI00005A0520 Length = 678 Score = 62.4 bits (150), Expect = 1e-08 Identities = 46/120 (38%), Positives = 54/120 (45%), Gaps = 11/120 (9%) Frame = +2 Query: 20 AAAPWASATSYATRPATPPATPRARWRARTATTQ-------TDCTRPSLPPPSRRGAAAL 178 A AP A T+ P AT R T T++ +RP+ PP + R AA Sbjct: 56 APAPPAGRPGVGTQAGAPAATARRGPHRATQTSRRRERSHGARGSRPASPPLTARFPAAF 115 Query: 179 PRGTRG--GPDRTVRTCHHPSRPPA--RDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 G R R H + P + D R G GGGGGGGGGGGGGGGGGGGG Sbjct: 116 VAAASGRRAEGRRGRGAHGRAMPSSLFADLERHGSG----GGGGGGGGGGGGGGGGGGGG 171 [47][TOP] >UniRef100_UPI000184A36E RNA-binding protein MEX3B (RING finger and KH domain-containing protein 3) (RING finger protein 195). n=1 Tax=Canis lupus familiaris RepID=UPI000184A36E Length = 711 Score = 62.4 bits (150), Expect = 1e-08 Identities = 46/120 (38%), Positives = 54/120 (45%), Gaps = 11/120 (9%) Frame = +2 Query: 20 AAAPWASATSYATRPATPPATPRARWRARTATTQ-------TDCTRPSLPPPSRRGAAAL 178 A AP A T+ P AT R T T++ +RP+ PP + R AA Sbjct: 21 APAPPAGRPGVGTQAGAPAATARRGPHRATQTSRRRERSHGARGSRPASPPLTARFPAAF 80 Query: 179 PRGTRG--GPDRTVRTCHHPSRPPA--RDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 G R R H + P + D R G GGGGGGGGGGGGGGGGGGGG Sbjct: 81 VAAASGRRAEGRRGRGAHGRAMPSSLFADLERHGSG----GGGGGGGGGGGGGGGGGGGG 136 [48][TOP] >UniRef100_C1USL6 DNA/RNA helicase, superfamily II n=1 Tax=Haliangium ochraceum DSM 14365 RepID=C1USL6_9DELT Length = 497 Score = 62.4 bits (150), Expect = 1e-08 Identities = 35/67 (52%), Positives = 36/67 (53%) Frame = +2 Query: 146 PPPSRRGAAALPRGTRGGPDRTVRTCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGG 325 PP R + RG GGP R P GGS P RGGGGGGGGGGGGG Sbjct: 403 PPGRSRRSGGGRRGPGGGPGAGTGN--------GRRGPG-GGSRPRRGGGGGGGGGGGGG 453 Query: 326 GGGGGGG 346 GGGGGGG Sbjct: 454 GGGGGGG 460 [49][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 62.4 bits (150), Expect = 1e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPPR S PP Sbjct: 427 PPPPPPPPPPPPPTPPPPPPRPPSPPP 453 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP PP R Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPTPPPPPPR 447 [50][TOP] >UniRef100_A4RZU2 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RZU2_OSTLU Length = 779 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRA 244 PPPPPPPPPPPPPPPPPPPP PPG LS A Sbjct: 343 PPPPPPPPPPPPPPPPPPPP-----PPGFKLSSA 371 [51][TOP] >UniRef100_Q00485 Mini-collagen (Fragment) n=1 Tax=Hydra sp. RepID=Q00485_9CNID Length = 142 Score = 62.4 bits (150), Expect = 1e-08 Identities = 25/34 (73%), Positives = 25/34 (73%), Gaps = 5/34 (14%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP-----RGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP G PPGR Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPVAIPGNPGPPGR 80 [52][TOP] >UniRef100_B9Q7D9 Zinc finger (C3HC4 RING finger) protein n=1 Tax=Toxoplasma gondii VEG RepID=B9Q7D9_TOXGO Length = 1058 Score = 62.4 bits (150), Expect = 1e-08 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW 226 PPPPPPPPPPPPPPPPPPP G+ R GG W Sbjct: 289 PPPPPPPPPPPPPPPPPPPLPAGTVSTSRAGGAVGGATRW 328 [53][TOP] >UniRef100_B9PM01 Zinc finger (C3HC4 RING finger) protein n=1 Tax=Toxoplasma gondii GT1 RepID=B9PM01_TOXGO Length = 2406 Score = 62.4 bits (150), Expect = 1e-08 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW 226 PPPPPPPPPPPPPPPPPPP G+ R GG W Sbjct: 1637 PPPPPPPPPPPPPPPPPPPLPAGTVSTSRAGGAVGGATRW 1676 [54][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 62.4 bits (150), Expect = 1e-08 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR 235 PPPPPPPPPPPPPPPPPPPP PP L GR Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGR 45 Score = 61.6 bits (148), Expect = 3e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP P GR S Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPLRAPKGRAPS 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 [55][TOP] >UniRef100_B6KE02 Zinc finger (C3HC4 RING finger) protein, putative n=1 Tax=Toxoplasma gondii ME49 RepID=B6KE02_TOXGO Length = 2401 Score = 62.4 bits (150), Expect = 1e-08 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW 226 PPPPPPPPPPPPPPPPPPP G+ R GG W Sbjct: 1632 PPPPPPPPPPPPPPPPPPPLPAGTVSTSRAGGAVGGATRW 1671 [56][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 62.4 bits (150), Expect = 1e-08 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGL 253 PPPPPPPPPPPPPPPPPPPP PP R + Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPLPPPPRNI 105 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPLPP 100 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 24 PPRPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 25 PRPPPPPPPPPPPPPPPPPPPPPPPPP 51 [57][TOP] >UniRef100_C0NGH8 Predicted protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NGH8_AJECG Length = 628 Score = 62.4 bits (150), Expect = 1e-08 Identities = 40/117 (34%), Positives = 48/117 (41%), Gaps = 4/117 (3%) Frame = +2 Query: 8 PLTSAAAPWASATSYATRPATPPATPRARWRARTATTQTDCTRPSLPPPSRRGAAALPRG 187 P P A+ T +R + PPA P +A + + P +PPP AA Sbjct: 468 PAPPPPPPQAAPTEAPSRESAPPAPPPPPPQAAPTEAPSRESAPPVPPPPPPQAAPTETP 527 Query: 188 TRGGPDRTVRTCHHPSRPPARD----NPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 R P+ PP D NP P P GGGG GG GGG GGG GGG Sbjct: 528 PR-----------EPAPPPPGDPESPNPSPPADAPNGGGGGNDGGNGGGNGGGNGGG 573 Score = 57.8 bits (138), Expect = 4e-07 Identities = 40/114 (35%), Positives = 48/114 (42%), Gaps = 1/114 (0%) Frame = +2 Query: 8 PLTSAAAPWASATSYATRPATPPATPRARWRARTATTQTDCTRPSLPPPSRRGAAA-LPR 184 P AAP + + + PA PP P+A A T + P PPP + A P Sbjct: 472 PPPPQAAPTEAPSRESAPPAPPPPPPQA---APTEAPSRESAPPVPPPPPPQAAPTETPP 528 Query: 185 GTRGGPDRTVRTCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 P +PS P N GG+ GGG GGG GGG GGGG G G Sbjct: 529 REPAPPPPGDPESPNPSPPADAPNGGGGGNDGGNGGGNGGGNGGGHGGGGRGSG 582 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPP S PP Sbjct: 160 PPPPPPPPASAPPPPPPPPPISPSLPP 186 [58][TOP] >UniRef100_UPI000194BCD9 PREDICTED: similar to hCG38312 n=1 Tax=Taeniopygia guttata RepID=UPI000194BCD9 Length = 551 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/30 (80%), Positives = 24/30 (80%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPPP---PPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPPPP GG PP Sbjct: 5 PPPPPPPPPPPPPPSGGPPPPPPSGGPPPP 34 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -3 Query: 336 PPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPP GG PP Sbjct: 2 PVPPPPPPPPPPPPPPPSGGPPPP 25 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 P PPPPPPPPPPPPPPP G PP G Sbjct: 2 PVPPPPPPPPPPPPPPPSGGPPPPPPSG 29 [59][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP PP R Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPP P Sbjct: 39 PPPPPPPPPPPPPPPPPPRP 58 [60][TOP] >UniRef100_UPI000069FBE4 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE4 Length = 1054 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP +EPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPLPSAEPP 578 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 12/47 (25%) Frame = -3 Query: 345 PPPPPPPPPPPPP------------PPPPPPPRGGSEPPGRGLSRAG 241 PPPPPPPPPPPPP PPPPPPP G PG G Sbjct: 555 PPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPGSASPTVG 601 [61][TOP] >UniRef100_UPI000069FBE3 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE3 Length = 1101 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP +EPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPLPSAEPP 590 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 8/36 (22%) Frame = -3 Query: 345 PPPPPPPPPPPPP--------PPPPPPPRGGSEPPG 262 PPPPPPPPPPPPP PPPPPPP G PG Sbjct: 571 PPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPG 606 [62][TOP] >UniRef100_UPI000069FBE2 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069FBE2 Length = 980 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP +EPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPLPSAEPP 477 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 8/36 (22%) Frame = -3 Query: 345 PPPPPPPPPPPPP--------PPPPPPPRGGSEPPG 262 PPPPPPPPPPPPP PPPPPPP G PG Sbjct: 458 PPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPG 493 [63][TOP] >UniRef100_UPI00004D6F7F Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7F Length = 555 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP +EPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPLPSAEPP 49 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 8/36 (22%) Frame = -3 Query: 345 PPPPPPPPPPPPP--------PPPPPPPRGGSEPPG 262 PPPPPPPPPPPPP PPPPPPP G PG Sbjct: 30 PPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPG 65 [64][TOP] >UniRef100_UPI00004D6F7D Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI00004D6F7D Length = 1054 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP +EPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPLPSAEPP 559 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 23/36 (63%), Gaps = 8/36 (22%) Frame = -3 Query: 345 PPPPPPPPPPPPP--------PPPPPPPRGGSEPPG 262 PPPPPPPPPPPPP PPPPPPP G PG Sbjct: 540 PPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPG 575 [65][TOP] >UniRef100_UPI0001B7A6BD enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6BD Length = 804 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPPPPPP PP LS G + G T S P +P Sbjct: 445 PPPPPPPPPPPPPPPPPPP-----LPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 499 Query: 177 KAAAP 163 AAAP Sbjct: 500 SAAAP 504 [66][TOP] >UniRef100_UPI0001B7A6BC enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6BC Length = 808 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPPPPPP PP LS G + G T S P +P Sbjct: 449 PPPPPPPPPPPPPPPPPPP-----LPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 503 Query: 177 KAAAP 163 AAAP Sbjct: 504 SAAAP 508 [67][TOP] >UniRef100_UPI0001B7A6A7 enabled homolog n=1 Tax=Rattus norvegicus RepID=UPI0001B7A6A7 Length = 823 Score = 62.0 bits (149), Expect = 2e-08 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPPPPPP PP LS G + G T S P +P Sbjct: 464 PPPPPPPPPPPPPPPPPPP-----LPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 518 Query: 177 KAAAP 163 AAAP Sbjct: 519 SAAAP 523 [68][TOP] >UniRef100_UPI0001951234 Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein). n=1 Tax=Canis lupus familiaris RepID=UPI0001951234 Length = 1045 Score = 62.0 bits (149), Expect = 2e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPAPAPAPP 888 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP + PP Sbjct: 863 PPPPPPPPPPPPPPPPPPPAPAPAPPP 889 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 681 PPPHPPPPPPPPPPPPPPPPPPARAPP 707 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPP R P Sbjct: 685 PPPPPPPPPPPPPPPPPPARAPPSP 709 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP P Sbjct: 683 PHPPPPPPPPPPPPPPPPPPARAPPSP 709 [69][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPP PPP + PP +G S Sbjct: 245 PPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPS 276 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPP S PP Sbjct: 238 PPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 239 PPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPP PP Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPP 251 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPP PP Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPP 252 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPP PP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPP 253 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPPP PP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPP 254 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPPPPP PP Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP PP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPP PP Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPP 248 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPP PP Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPP 249 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPP P PPPP+G S P Sbjct: 253 PPPPPPPPSPPPPSPNPPPPKGPSPTP 279 [70][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP PP R Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 99 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSR 247 PPPPPPPPPPPPPPPPPPPP PP SR Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSR 104 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/66 (48%), Positives = 34/66 (51%), Gaps = 5/66 (7%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRD----GW*QVRTVLSGPP-RVPR 181 PPPPPPPPPPPPPPPPPPP S P +R RD W + PP PR Sbjct: 80 PPPPPPPPPPPPPPPPPPPRLVTSRPLSALFARPVPRDLREMVWSGGDSPAPEPPFYAPR 139 Query: 180 GKAAAP 163 G AP Sbjct: 140 GNDPAP 145 [71][TOP] >UniRef100_B7PJF9 Menin, putative n=1 Tax=Ixodes scapularis RepID=B7PJF9_IXOSC Length = 588 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP PP LS Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPSVTLS 529 [72][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 62.0 bits (149), Expect = 2e-08 Identities = 24/29 (82%), Positives = 24/29 (82%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP--RGGSEPP 265 PPPPPPPPPPPPPPPPPPPP GG PP Sbjct: 1040 PPPPPPPPPPPPPPPPPPPPMSAGGIPPP 1068 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1059 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPP------PPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPPP PP Sbjct: 1053 PPPPPPPMSAGGIPPPPPPPPPPPPPMSPGMPP 1085 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 5/31 (16%) Frame = -3 Query: 345 PPPPPPPPPPPPP-----PPPPPPPRGGSEP 268 PPPPPPPPPPPPP PPPPPPP G P Sbjct: 1066 PPPPPPPPPPPPPMSPGMPPPPPPPPGAPVP 1096 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = -3 Query: 336 PPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAG 241 PPPPPPPPPPPPPPPPP PP +S G Sbjct: 1033 PPPPPPPPPPPPPPPPPPPPPPPPPPPMSAGG 1064 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = -3 Query: 342 PPPPPPPPPPPPP-----PPPPPPRGGSEPPG 262 PPPPPPPPPPPPP PPPPPP G+ PG Sbjct: 1066 PPPPPPPPPPPPPMSPGMPPPPPPPPGAPVPG 1097 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPP------PPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PPP PP Sbjct: 1043 PPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPP 1075 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 6/34 (17%) Frame = -3 Query: 345 PPPPPPPPPPP------PPPPPPPPPRGGSEPPG 262 PPPPPPPPPPP PPPPPPPPP PG Sbjct: 1049 PPPPPPPPPPPMSAGGIPPPPPPPPPPPPPMSPG 1082 [73][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP PP R Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 62.0 bits (149), Expect = 2e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP PP R Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [74][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 61.2 bits (147), Expect(2) = 2e-08 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP PP G Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPPPVPG 118 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 7/18 (38%), Positives = 7/18 (38%) Frame = -1 Query: 254 CHGLEGGMDGDKCAPSCR 201 C GG G C CR Sbjct: 130 CKSCSGGRGGGSCHHGCR 147 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPP 114 [75][TOP] >UniRef100_UPI000194C58F PREDICTED: formin 1 n=1 Tax=Taeniopygia guttata RepID=UPI000194C58F Length = 2007 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/67 (46%), Positives = 35/67 (52%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPPPPP P LS V+ PP +P G A+ Sbjct: 1446 PPPPPPPPPPPPPPPPPPPPL-----PCSSLS------------AVVPPPPPLPMGPASL 1488 Query: 165 PRRDGGG 145 + G G Sbjct: 1489 TSQFGSG 1495 [76][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPSPPPPP 384 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPSPPPPPP 385 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP S PP Sbjct: 356 PCPPPPPPPPPPPPPPPPPPPPPSPPP 382 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP S P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPCPASCSP 416 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPSPPPPPPP 386 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPP 387 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 362 PPPPPPPPPPPPPPPPPSPPPPPPPPP 388 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPP PP Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPP 389 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPP PP Sbjct: 364 PPPPPPPPPPPPPPPSPPPPPPPPPPP 390 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPPP PP Sbjct: 365 PPPPPPPPPPPPPPSPPPPPPPPPPPP 391 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPPPPP PP Sbjct: 367 PPPPPPPPPPPPSPPPPPPPPPPPPPP 393 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP PP Sbjct: 368 PPPPPPPPPPPSPPPPPPPPPPPPPPP 394 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 369 PPPPPPPPPPSPPPPPPPPPPPPPPPP 395 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 370 PPPPPPPPPSPPPPPPPPPPPPPPPPP 396 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPP 397 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 372 PPPPPPPSPPPPPPPPPPPPPPPPPPP 398 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPP PP Sbjct: 373 PPPPPPSPPPPPPPPPPPPPPPPPPPP 399 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPP PP Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPP 400 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPP PP Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPP 401 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 376 PPPSPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 377 PPSPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 378 PSPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPP P G Sbjct: 391 PPPPPPPPPPPPPPPPPPPCPASCSPTSCG 420 [77][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPPR + P Sbjct: 78 PPPPPPPPPPPPPPPPPPPPRVSTPAP 104 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 76 PAPPPPPPPPPPPPPPPPPP 95 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 P PPPPPPPPPPP PPPPP S+PP L+ Sbjct: 485 PSPPPPPPPPPPPRPPPPPPPPSQPPPTSLT 515 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPP PPPPPP PP Sbjct: 485 PSPPPPPPPPPPPRPPPPPPPPSQPPP 511 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPP-------PPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPPP PP Sbjct: 64 PPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPP 97 [78][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP +PP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPFQPP 265 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPR 283 PPPPPPPPPPPPPPPP PPR Sbjct: 246 PPPPPPPPPPPPPPPPFQPPR 266 [79][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP + PP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1435 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1436 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1437 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1438 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP + PP Sbjct: 1421 PPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPP PP Sbjct: 1424 PPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGG 238 PPPPPPPPPPPPPPP PPP PP +S G Sbjct: 1425 PPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTG 1460 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/31 (67%), Positives = 21/31 (67%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGL 253 PPPPPPPPP PPP PPPPPP G GL Sbjct: 1431 PPPPPPPPPTPPPAPPPPPPPPPPISSGTGL 1461 [80][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP + PP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPEETTPP 265 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPP 253 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPP 254 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPP 255 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPP 256 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPP 257 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 231 PPAPPPPPPPPPPPPPPPPPPPPPPPP 257 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 232 PAPPPPPPPPPPPPPPPPPPPPPPPPP 258 [81][TOP] >UniRef100_B4U926 Putative uncharacterized protein n=1 Tax=Hydrogenobaculum sp. Y04AAS1 RepID=B4U926_HYDS0 Length = 231 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPETPPPPP 93 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP + PP Sbjct: 65 PAPPPPPPPPPPPPPPPPPPPPETPPP 91 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSR 247 PPPPPPPPPPPPPPPPPPP PP +S+ Sbjct: 67 PPPPPPPPPPPPPPPPPPPPETPPPPPPPVSK 98 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPETPPPPPP 94 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPETPPPPPPP 95 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 4/30 (13%) Frame = -3 Query: 345 PPPPPPPPPPPPPPP----PPPPPRGGSEP 268 PPPPPPPPPPPPPPP PPPPP S+P Sbjct: 70 PPPPPPPPPPPPPPPPPETPPPPPPPVSKP 99 [82][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 61.6 bits (148), Expect = 3e-08 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP G P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPP PPPPPPPPPPPPPPP PPG Sbjct: 508 PPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPP S PP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPP 515 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPP PPPPPPPPPPPPP PP G S Sbjct: 506 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPS 537 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPPP PP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPP 516 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPP PP Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPP 514 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPPPPP PP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPP 510 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPP 511 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPP PP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPP P PP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPP PP PP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPP PPP PP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPP PPPP PP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPP PPPPPP PP Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPP PPPPPPP PP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPP PPPPPPPP PP Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPP PPPPPPPPP PP Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPP PPPPPPPPPP PP Sbjct: 503 PSPPPPPPPSPPPPPPPPPPPPPPPPP 529 [83][TOP] >UniRef100_A5V8M1 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V8M1_SPHWW Length = 373 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPPP E PG Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPVVETPG 264 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPP 255 [84][TOP] >UniRef100_A5V4K4 OmpA/MotB domain protein n=1 Tax=Sphingomonas wittichii RW1 RepID=A5V4K4_SPHWW Length = 373 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPPP E PG Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPVVETPG 263 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPP 254 [85][TOP] >UniRef100_A0LQ52 Putative uncharacterized protein n=1 Tax=Syntrophobacter fumaroxidans MPOB RepID=A0LQ52_SYNFM Length = 335 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = +2 Query: 224 HHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 H P P + PGGS GGGGGGGGGGGGGGGGGGGG Sbjct: 281 HGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGG 321 [86][TOP] >UniRef100_C9S8M2 Cytokinesis protein sepA n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S8M2_9PEZI Length = 842 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPP G PG G Sbjct: 184 PPPPPPPPPPPPPPPPPPPMPGMLSPGGG 212 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPP------PRGGSEPP 265 PPPPPPPPPPPPPPPPPPP P GG PP Sbjct: 184 PPPPPPPPPPPPPPPPPPPMPGMLSPGGGPPPP 216 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 7/43 (16%) Frame = -3 Query: 345 PPPPPPPP-------PPPPPPPPPPPPRGGSEPPGRGLSRAGG 238 PPPPPPPP PPPPPPPPPPPP PP G+ GG Sbjct: 169 PPPPPPPPMPGQGGAPPPPPPPPPPPPPPPPPPPMPGMLSPGG 211 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/43 (58%), Positives = 25/43 (58%), Gaps = 7/43 (16%) Frame = -3 Query: 345 PPPPPPP-------PPPPPPPPPPPPPRGGSEPPGRGLSRAGG 238 PPPPPPP PPPPPPPPPPPPP P LS GG Sbjct: 170 PPPPPPPMPGQGGAPPPPPPPPPPPPPPPPPPPMPGMLSPGGG 212 [87][TOP] >UniRef100_B8M4W4 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W4_TALSN Length = 648 Score = 61.6 bits (148), Expect = 3e-08 Identities = 46/121 (38%), Positives = 51/121 (42%), Gaps = 6/121 (4%) Frame = -3 Query: 345 PPPPPPPPP---PPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK 175 PPPPPPPPP P PPPPPPPPP G+ PP G T PP P G Sbjct: 493 PPPPPPPPPSGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGG 552 Query: 174 AAAP---RRDGGGRLGRVQSVWVVAVRARHRARGVAGGVAGRVA*DVADAHGAAADVNGK 4 A P GGGR + ++ RA G GG R D +AA V G Sbjct: 553 AVPPPLLSVGGGGRDDLLAAI---------RASGGKGGSGLRRVNDSEKRDRSAAMVPGT 603 Query: 3 S 1 S Sbjct: 604 S 604 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPP---PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP P PPPPPPPPPP G +PP Sbjct: 479 PPPPPPPPSGIPQPPPPPPPPPPSGIPQPP 508 [88][TOP] >UniRef100_B8M4W3 Actin associated protein Wsp1, putative n=1 Tax=Talaromyces stipitatus ATCC 10500 RepID=B8M4W3_TALSN Length = 822 Score = 61.6 bits (148), Expect = 3e-08 Identities = 46/121 (38%), Positives = 51/121 (42%), Gaps = 6/121 (4%) Frame = -3 Query: 345 PPPPPPPPP---PPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK 175 PPPPPPPPP P PPPPPPPPP G+ PP G T PP P G Sbjct: 493 PPPPPPPPPSGIPQPPPPPPPPPSFGAPPPPPPPPATGSGAPPPPPPTGPGAPPPPPPGG 552 Query: 174 AAAP---RRDGGGRLGRVQSVWVVAVRARHRARGVAGGVAGRVA*DVADAHGAAADVNGK 4 A P GGGR + ++ RA G GG R D +AA V G Sbjct: 553 AVPPPLLSVGGGGRDDLLAAI---------RASGGKGGSGLRRVNDSEKRDRSAAMVPGT 603 Query: 3 S 1 S Sbjct: 604 S 604 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/30 (73%), Positives = 23/30 (76%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPP---PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP P PPPPPPPPPP G +PP Sbjct: 479 PPPPPPPPSGIPQPPPPPPPPPPSGIPQPP 508 [89][TOP] >UniRef100_B6QR64 Proline-rich, actin-associated protein Vrp1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QR64_PENMQ Length = 474 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/40 (65%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = -3 Query: 345 PPPPPPPPPPPP----PPPPPPPPRGGSEPPGRGLSRAGG 238 PPPPPPPPPPPP PPPPPPPP GG P S GG Sbjct: 2 PPPPPPPPPPPPGMGGPPPPPPPPPGGGMPARPAKSSGGG 41 [90][TOP] >UniRef100_UPI00015FF5B0 piccolo isoform 2 n=1 Tax=Mus musculus RepID=UPI00015FF5B0 Length = 4863 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2340 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2399 Query: 165 PRRDGG 148 RR G Sbjct: 2400 ARRSNG 2405 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2335 PPPPPPPPPPPPPPPPPPP 2353 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2335 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2377 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2378 PVAPTAIVTAHADAIPTVEATAARRSNGL 2406 [91][TOP] >UniRef100_UPI00015FA08D piccolo isoform 1 n=1 Tax=Mus musculus RepID=UPI00015FA08D Length = 5068 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2340 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2399 Query: 165 PRRDGG 148 RR G Sbjct: 2400 ARRSNG 2405 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2335 PPPPPPPPPPPPPPPPPPP 2353 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2335 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2377 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2378 PVAPTAIVTAHADAIPTVEATAARRSNGL 2406 [92][TOP] >UniRef100_UPI0000E23E7D PREDICTED: WAS protein homology region 2 domain containing 1 n=1 Tax=Pan troglodytes RepID=UPI0000E23E7D Length = 813 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP PP R LS Sbjct: 639 PPPPPPPPPPPPPPPPPPPP---PPPPLRALS 667 [93][TOP] >UniRef100_UPI0000E1F8E7 PREDICTED: Ras association and pleckstrin homology domains 1 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F8E7 Length = 1252 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP P G Sbjct: 631 PPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 660 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 629 PLPPPPPPPPPPPPPPPPPP 648 [94][TOP] >UniRef100_UPI0000E1F8E6 PREDICTED: Ras association and pleckstrin homology domains 1 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F8E6 Length = 1304 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP P G Sbjct: 683 PPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 712 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 681 PLPPPPPPPPPPPPPPPPPP 700 [95][TOP] >UniRef100_UPI0000603C6F PREDICTED: Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 n=1 Tax=Mus musculus RepID=UPI0000603C6F Length = 1266 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP P G Sbjct: 630 PPPPPPPPPPPPPPPPPPPPLPSQSAPSSG 659 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PP PPPPPPPPPPPPPPPPP Sbjct: 627 PPLPPPPPPPPPPPPPPPPP 646 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 628 PLPPPPPPPPPPPPPPPPPP 647 [96][TOP] >UniRef100_UPI00016D3858 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3858 Length = 4833 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2310 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2369 Query: 165 PRRDGG 148 RR G Sbjct: 2370 ARRSNG 2375 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2305 PPPPPPPPPPPPPPPPPPP 2323 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2305 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2347 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2348 PVAPTAIVTAHADAIPTVEATAARRSNGL 2376 [97][TOP] >UniRef100_UPI00016D3827 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00016D3827 Length = 3753 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2340 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2399 Query: 165 PRRDGG 148 RR G Sbjct: 2400 ARRSNG 2405 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2335 PPPPPPPPPPPPPPPPPPP 2353 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2335 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2377 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2378 PVAPTAIVTAHADAIPTVEATAARRSNGL 2406 [98][TOP] >UniRef100_UPI00015DF6C1 piccolo (presynaptic cytomatrix protein) n=1 Tax=Mus musculus RepID=UPI00015DF6C1 Length = 4833 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2310 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2369 Query: 165 PRRDGG 148 RR G Sbjct: 2370 ARRSNG 2375 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2305 PPPPPPPPPPPPPPPPPPP 2323 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2305 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2347 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2348 PVAPTAIVTAHADAIPTVEATAARRSNGL 2376 [99][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/58 (51%), Positives = 32/58 (55%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKA 172 PPPPPPPPPPPPPPPPPPPP PP D + RTV +G P G A Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPDVLAADAF--DRTVAAGWGSAPTGGA 708 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPPPPP 678 [100][TOP] >UniRef100_Q9WX60 Ccp protein n=1 Tax=Gluconacetobacter xylinus RepID=Q9WX60_ACEXY Length = 329 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/61 (44%), Positives = 32/61 (52%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPPPPP P + + + + TV PP P + Sbjct: 91 PPPPPPPPPPPPPPPPPPPPPAPVVPEAVHVPQPPAQPAPPVMETVAPEPPPPPPETVVS 150 Query: 165 P 163 P Sbjct: 151 P 151 [101][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP ++P R Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPAKPAAR 276 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSR 247 PPPPPPPPPPPPPPPPPPP PP + +R Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPAKPAAR 276 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPP PP Sbjct: 242 PAAPPPPPPPPPPPPPPPPPPPPPPPP 268 [102][TOP] >UniRef100_A3WBR8 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBR8_9SPHN Length = 378 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP EP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPAPEP 260 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP P G Sbjct: 237 PPPPPPPPPPPPPPPPPPPPAPEPAPCNTG 266 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPAPEPAP 262 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 231 PPPPPPPPPPPPPPPPPPPP 250 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 232 PPPPPPPPPPPPPPPPPPPP 251 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 233 PPPPPPPPPPPPPPPPPPPP 252 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPP 253 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 231 PPPPPPPPPPPPPPPPPPPPPPPPPP 256 [103][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP PP + Sbjct: 82 PPPPPPPPPPPPPPPPPPPPLPPPPPPSQ 110 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSE 271 PPPPPPPPPPPPPPP PPPP E Sbjct: 87 PPPPPPPPPPPPPPPLPPPPPPSQE 111 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PP PPPPPPPPPPPPP PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPP 81 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PP PPPPPPPPPPPPPP PP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.9 bits (128), Expect = 5e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PP PPPPPPPPPPPPPPP PP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPP 83 [104][TOP] >UniRef100_C4QFT9 Diaphanous, putative n=1 Tax=Schistosoma mansoni RepID=C4QFT9_SCHMA Length = 1068 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPP----PPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPPP GG PP Sbjct: 497 PPPPPMEGVPPPPPPPPPPPPPPPMGGIPPP 527 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 11/41 (26%) Frame = -3 Query: 345 PPPPPPPPPPP----PPP-------PPPPPPRGGSEPPGRG 256 PPPPPPPPPPP PPP PPPPPP GG PP G Sbjct: 510 PPPPPPPPPPPMGGIPPPPPPMGSIPPPPPPMGGVPPPPPG 550 [105][TOP] >UniRef100_B7QDE3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QDE3_IXOSC Length = 908 Score = 61.2 bits (147), Expect = 3e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P GS PP Sbjct: 738 PPPPPPPPPPPPPPPPPPCPSVGSIPP 764 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP P G PP Sbjct: 739 PPPPPPPPPPPPPPPPPCPSVGSIPPP 765 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPP-------PPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPPP PP Sbjct: 740 PPPPPPPPPPPPPPPPCPSVGSIPPPPPPPPPPP 773 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%), Gaps = 8/30 (26%) Frame = -3 Query: 345 PPPPPPPPP--------PPPPPPPPPPPRG 280 PPPPPPPPP PPPPPPPPPPP G Sbjct: 746 PPPPPPPPPPCPSVGSIPPPPPPPPPPPTG 775 [106][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 61.2 bits (147), Expect = 3e-08 Identities = 31/68 (45%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPPPPP PP PP+ PR A Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP--------------------PPPPKTPRTTVAF 53 Query: 165 P----RRD 154 P RRD Sbjct: 54 PPAPLRRD 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 [107][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 3/32 (9%) Frame = -3 Query: 345 PPPPPPPP---PPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPP PPPPPPPPPPPP G PPG+ Sbjct: 368 PPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQ 399 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPP PPP G PP G Sbjct: 379 PPPPPPPPPPPPPPGPPPPGQLPPPPAG 406 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 345 PPP---PPPPPPPPPPPPPPPPPRGGSEPPGRGLSRA 244 PPP PPPPPPPPPPPPPP PP G PP +RA Sbjct: 373 PPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAGARA 409 [108][TOP] >UniRef100_A0CS42 Chromosome undetermined scaffold_26, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0CS42_PARTE Length = 417 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/30 (80%), Positives = 24/30 (80%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPP---PPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPPPRG PP Sbjct: 285 PPPPPPPPPPPPPPPPKGVPPPPRGPPPPP 314 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/38 (65%), Positives = 25/38 (65%), Gaps = 8/38 (21%) Frame = -3 Query: 345 PPP--------PPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPP PPPPPPPPPPPPPPPPP G PP RG Sbjct: 272 PPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRG 309 [109][TOP] >UniRef100_C9K0J5 Putative uncharacterized protein RAPH1 n=1 Tax=Homo sapiens RepID=C9K0J5_HUMAN Length = 1302 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP P G Sbjct: 681 PPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 710 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PP PPPPPPPPPPPPPPPPP Sbjct: 678 PPLPPPPPPPPPPPPPPPPP 697 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 679 PLPPPPPPPPPPPPPPPPPP 698 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAG 241 P PP PPPPPPPPPPPPPPP P + AG Sbjct: 676 PSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 710 [110][TOP] >UniRef100_Q2HG22 Putative uncharacterized protein n=1 Tax=Chaetomium globosum RepID=Q2HG22_CHAGB Length = 441 Score = 61.2 bits (147), Expect = 3e-08 Identities = 24/34 (70%), Positives = 25/34 (73%), Gaps = 4/34 (11%) Frame = -3 Query: 345 PPPPPPPPPP----PPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPP PPPPPPPPPP + PGRG Sbjct: 4 PPPPPPPPPPGFGGPPPPPPPPPPAAAAAAPGRG 37 [111][TOP] >UniRef100_Q0CUB4 Predicted protein n=1 Tax=Aspergillus terreus NIH2624 RepID=Q0CUB4_ASPTN Length = 442 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/46 (65%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +2 Query: 218 TCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGG---GGGGG 346 TC PS PP + P S PP GGGGGGGGGGGGGGG GGGGG Sbjct: 144 TCQDPSPPPGK----PDDSSPPCGGGGGGGGGGGGGGGSSCGGGGG 185 [112][TOP] >UniRef100_Q70E73 Ras-associated and pleckstrin homology domains-containing protein 1 n=1 Tax=Homo sapiens RepID=RAPH1_HUMAN Length = 1250 Score = 61.2 bits (147), Expect = 3e-08 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP P G Sbjct: 629 PPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 658 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PP PPPPPPPPPPPPPPPPP Sbjct: 626 PPLPPPPPPPPPPPPPPPPP 645 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 627 PLPPPPPPPPPPPPPPPPPP 646 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAG 241 P PP PPPPPPPPPPPPPPP P + AG Sbjct: 624 PSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAG 658 [113][TOP] >UniRef100_Q9QYX7-2 Isoform 2 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-2 Length = 4833 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2310 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2369 Query: 165 PRRDGG 148 RR G Sbjct: 2370 ARRSNG 2375 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2305 PPPPPPPPPPPPPPPPPPP 2323 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2305 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2347 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2348 PVAPTAIVTAHADAIPTVEATAARRSNGL 2376 [114][TOP] >UniRef100_Q9QYX7-3 Isoform 3 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-3 Length = 4981 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2340 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2399 Query: 165 PRRDGG 148 RR G Sbjct: 2400 ARRSNG 2405 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2335 PPPPPPPPPPPPPPPPPPP 2353 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2335 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2377 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2378 PVAPTAIVTAHADAIPTVEATAARRSNGL 2406 [115][TOP] >UniRef100_Q9QYX7-4 Isoform 4 of Protein piccolo n=1 Tax=Mus musculus RepID=Q9QYX7-4 Length = 5177 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2340 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2399 Query: 165 PRRDGG 148 RR G Sbjct: 2400 ARRSNG 2405 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2335 PPPPPPPPPPPPPPPPPPP 2353 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2335 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2377 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2378 PVAPTAIVTAHADAIPTVEATAARRSNGL 2406 [116][TOP] >UniRef100_Q9QYX7 Protein piccolo n=1 Tax=Mus musculus RepID=PCLO_MOUSE Length = 5038 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/66 (42%), Positives = 33/66 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPP PP +PP + V + +P +A A Sbjct: 2310 PPPPPPPPPPPPPPPPPLPPATSPKPPTYPKRKLAAAAPVAPTAIVTAHADAIPTVEATA 2369 Query: 165 PRRDGG 148 RR G Sbjct: 2370 ARRSNG 2375 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 2305 PPPPPPPPPPPPPPPPPPP 2323 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 2/89 (2%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK--AAA 166 PPPPPPPPPPPPPPPPPP PP PP P+ K AAA Sbjct: 2305 PPPPPPPPPPPPPPPPPPPPPPLPPATS-----------------PKPPTYPKRKLAAAA 2347 Query: 165 PRRDGGGRLGRVQSVWVVAVRARHRARGV 79 P ++ V A R+ G+ Sbjct: 2348 PVAPTAIVTAHADAIPTVEATAARRSNGL 2376 [117][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 174 PPPPPPPPPPPPPPPPPPPPPPPPPPP 200 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 175 PPPPPPPPPPPPPPPPPPPPPPPPPPP 201 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 176 PPPPPPPPPPPPPPPPPPPPPPPPPPP 202 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP P R Sbjct: 177 PPPPPPPPPPPPPPPPPPPPPPPPPPVDR 205 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 166 PPPPPPPSPPPPPPPPPPPPPPPPPPP 192 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPP PP Sbjct: 167 PPPPPPSPPPPPPPPPPPPPPPPPPPP 193 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPP PP Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPP PP Sbjct: 169 PPPPSPPPPPPPPPPPPPPPPPPPPPP 195 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 170 PPPSPPPPPPPPPPPPPPPPPPPPPPP 196 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 171 PPSPPPPPPPPPPPPPPPPPPPPPPPP 197 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 172 PSPPPPPPPPPPPPPPPPPPPPPPPPP 198 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPP PPPPPP PP Sbjct: 138 PPPPPPPSPPPPPSPPPPPPPSPPPPP 164 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPP PPPPPP PP Sbjct: 152 PPPPPPPSPPPPPSPPPPPPPSPPPPP 178 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPP PPPPP PP Sbjct: 131 PPPPPPSPPPPPPPSPPPPPSPPPPPP 157 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPP PPPPPPP PP Sbjct: 153 PPPPPPSPPPPPSPPPPPPPSPPPPPP 179 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPP PPPPPP PP Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPP 186 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPP PPPPPPP PP Sbjct: 161 PPPPSPPPPPPPSPPPPPPPPPPPPPP 187 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPP PPPPPPPP PP Sbjct: 162 PPPSPPPPPPPSPPPPPPPPPPPPPPP 188 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPP PPPPPPPPP PP Sbjct: 163 PPSPPPPPPPSPPPPPPPPPPPPPPPP 189 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPP PPPPPPPPPP PP Sbjct: 164 PSPPPPPPPSPPPPPPPPPPPPPPPPP 190 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPP PPPPP PPPP S PP Sbjct: 136 PSPPPPPPPSPPPPPSPPPPPPPSPPP 162 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPP PPPPPPP PP S PP Sbjct: 142 PPPSPPPPPSPPPPPPPSPPPPPSPPP 168 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPP PPPPP PPPP S PP Sbjct: 150 PSPPPPPPPSPPPPPSPPPPPPPSPPP 176 [118][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 138 PPPPPPPPPPPPPPPPPPPPPPPPPPP 164 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 139 PPPPPPPPPPPPPPPPPPPPPPPPPPP 165 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 146 PPPPPPPPPPPPPPPPPPPPVVFCPPP 172 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 147 PPPPPPPPPPPPPPPPPPPVVFCPPPP 173 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPP---PPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPPP PP Sbjct: 130 PPPPPMCAPPPPPPPPPPPPPPPPPPPPPP 159 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPP---PPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPPP PP Sbjct: 131 PPPPMCAPPPPPPPPPPPPPPPPPPPPPPP 160 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPP---PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPPP PP Sbjct: 183 PPPPPPPPMCLPPPPPPPPPPPPCPLPPPP 212 [119][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 60.1 bits (144), Expect = 7e-08 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP PP +S Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPLLPPPPPPSIS 462 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPLLPP 455 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPLLPPP 456 Score = 59.3 bits (142), Expect = 1e-07 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPR 283 PPPPPPPPPPPPPPPPPPPP+ Sbjct: 149 PPPPPPPPPPPPPPPPPPPPK 169 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP +PP Sbjct: 146 PPPPPPPPPPPPPPPPPPPPPPPKPP 171 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 146 PPPPPPPPPPPPPPPPPPPP 165 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 147 PPPPPPPPPPPPPPPPPPPP 166 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 148 PPPPPPPPPPPPPPPPPPPP 167 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 422 PPLPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 423 PLPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 56.2 bits (134), Expect = 1e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPR 283 PPPPPPPPPPPPPPPPP PP+ Sbjct: 152 PPPPPPPPPPPPPPPPPKPPK 172 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPP P Sbjct: 151 PPPPPPPPPPPPPPPPPPKP 170 [120][TOP] >UniRef100_UPI0000F53460 enabled homolog isoform 2 n=2 Tax=Mus musculus RepID=UPI0000F53460 Length = 789 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPPPP PP PP LS G + G T S P +P Sbjct: 427 PPPPPPPPPPPPPPPPPLPP--PPLPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 484 Query: 177 KAAAP 163 AAAP Sbjct: 485 SAAAP 489 [121][TOP] >UniRef100_UPI0000F2DFA6 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2DFA6 Length = 354 Score = 60.8 bits (146), Expect = 4e-08 Identities = 45/115 (39%), Positives = 50/115 (43%), Gaps = 20/115 (17%) Frame = +2 Query: 62 PATPPATPRARWRARTATTQTDCTRPSL---PPPSRR----GAAALPRGTRGGPDRTVRT 220 PA+ ++PRA DC P PPPSRR G LP R + R Sbjct: 223 PASSSSSPRAE----------DCVPPGCARSPPPSRREEDVGVPRLPVMERSLGSHS-RC 271 Query: 221 CHHPSRPPARDNPRPGGSLPPRG-------------GGGGGGGGGGGGGGGGGGG 346 C P P R + PP G GGGGGGGGGGGGGGGGGGG Sbjct: 272 CPRPRPPGHRCSCHRRRRRPPTGSEDLESVAAAAAAGGGGGGGGGGGGGGGGGGG 326 [122][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPP 260 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPP 261 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPP 262 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 259 PPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPPP PP Sbjct: 258 PPPPPPPPPPPPPPLPPPPPPPPPLPP 284 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPPPPP PP Sbjct: 260 PPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP PP Sbjct: 261 PPPPPPPPPPPLPPPPPPPPPLPPPPP 287 [123][TOP] >UniRef100_UPI000047625B enabled homolog isoform 3 n=1 Tax=Mus musculus RepID=UPI000047625B Length = 785 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPPPP PP PP LS G + G T S P +P Sbjct: 423 PPPPPPPPPPPPPPPPPLPP--PPLPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 480 Query: 177 KAAAP 163 AAAP Sbjct: 481 SAAAP 485 [124][TOP] >UniRef100_UPI000023CA6C hypothetical protein FG00996.1 n=1 Tax=Gibberella zeae PH-1 RepID=UPI000023CA6C Length = 406 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = -3 Query: 345 PPPPPPPPPPPP-----PPPPPPPPRGGSEPPGRGLSRAGGR 235 PPPPPPPPPPPP PPPPPPPP GG PGR + AG R Sbjct: 2 PPPPPPPPPPPPGGMGGPPPPPPPPPGGL--PGRPPAGAGNR 41 [125][TOP] >UniRef100_UPI0001A2D80C UPI0001A2D80C related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D80C Length = 815 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGS 274 PPPPPPPPPPPPPPPPPPPP G S Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPGHS 307 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/40 (57%), Positives = 23/40 (57%), Gaps = 10/40 (25%) Frame = -3 Query: 345 PPPPPPPPPPPPPPP----------PPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPP PPPPP PG G Sbjct: 290 PPPPPPPPPPPPPPPGHSIEISAPLPPPPPPCAPPLPGSG 329 [126][TOP] >UniRef100_UPI000069F105 Formin-like protein 3 (Formin homology 2 domain-containing protein 3). n=1 Tax=Xenopus (Silurana) tropicalis RepID=UPI000069F105 Length = 1108 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P G PP Sbjct: 613 PPPPPPPPPPPPPPPPPPMPTGKCPPP 639 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP G PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPMPTGKCPP 638 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPP 628 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 608 PAPPPPPPPPPPPPPPPPPP 627 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 P PPPPPPPPPPPPPPPPP P G+ Sbjct: 608 PAPPPPPPPPPPPPPPPPPPPPPMPTGK 635 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 7/33 (21%) Frame = -3 Query: 345 PPPPPPPPPPPPPPP-------PPPPPRGGSEP 268 PPPPPPPPPPPPPPP PPPPP S P Sbjct: 615 PPPPPPPPPPPPPPPPMPTGKCPPPPPLPSSSP 647 [127][TOP] >UniRef100_UPI00015DF6E5 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E5 Length = 391 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPPPP PP PP LS G + G T S P +P Sbjct: 30 PPPPPPPPPPPPPPPPPLPP--PPLPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 87 Query: 177 KAAAP 163 AAAP Sbjct: 88 SAAAP 92 [128][TOP] >UniRef100_UPI00015DF6E3 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E3 Length = 701 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPPPP PP PP LS G + G T S P +P Sbjct: 339 PPPPPPPPPPPPPPPPPLPP--PPLPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 396 Query: 177 KAAAP 163 AAAP Sbjct: 397 SAAAP 401 [129][TOP] >UniRef100_UPI000056479E enabled homolog isoform 1 n=1 Tax=Mus musculus RepID=UPI000056479E Length = 804 Score = 60.8 bits (146), Expect = 4e-08 Identities = 33/65 (50%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPPPP PP PP LS G + G T S P +P Sbjct: 442 PPPPPPPPPPPPPPPPPLPP--PPLPPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 499 Query: 177 KAAAP 163 AAAP Sbjct: 500 SAAAP 504 [130][TOP] >UniRef100_UPI00016E4781 UPI00016E4781 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E4781 Length = 906 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/33 (72%), Positives = 26/33 (78%), Gaps = 3/33 (9%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPR---GGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP+ G + P RG Sbjct: 608 PPPPPPPPPPPPPPPPPPPPQHPEGKATPLSRG 640 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSR 247 PPPPPPPPPPPPPPPPPPP E LSR Sbjct: 608 PPPPPPPPPPPPPPPPPPPPQHPEGKATPLSR 639 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGG 238 P PPPPPPPPPPPPPPPPP P G+ + G Sbjct: 606 PRPPPPPPPPPPPPPPPPPPPPQHPEGKATPLSRG 640 [131][TOP] >UniRef100_Q1G7H2 Dishevelled-associated activator of morphogenesis 1 (Fragment) n=1 Tax=Gallus gallus RepID=Q1G7H2_CHICK Length = 359 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 3/31 (9%) Frame = -3 Query: 345 PPPPPPPPP---PPPPPPPPPPPRGGSEPPG 262 PPPPPPPPP PPPPPPPPPPP G PPG Sbjct: 195 PPPPPPPPPGGCPPPPPPPPPPPGGPPPPPG 225 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPPPPP--PPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPP PPP G PP Sbjct: 207 PPPPPPPPPPPGGPPPPPGPPPLDGVMPP 235 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 3/31 (9%) Frame = -3 Query: 339 PPPPPPPPP---PPPPPPPPPRGGSEPPGRG 256 PPPPPPPPP PPPPPPPPP G PP G Sbjct: 195 PPPPPPPPPGGCPPPPPPPPPPPGGPPPPPG 225 [132][TOP] >UniRef100_Q2N609 Peptidoglycan-associated protein n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N609_ERYLH Length = 367 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 222 PPPPPPPPPPPPPPPPPPPPPPPPPPP 248 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP + P G Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPTTPCNTG 255 [133][TOP] >UniRef100_Q0ANI5 OmpA/MotB domain protein n=1 Tax=Maricaulis maris MCS10 RepID=Q0ANI5_MARMM Length = 359 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPP 242 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 219 PPPPPPPPPPPPPPPPPPPPPPPPPPP 245 [134][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPP 336 [135][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP + P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPVETSP 503 [136][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPP 288 [137][TOP] >UniRef100_Q1RH03 Cell surface antigen Sca2 n=2 Tax=Rickettsia bellii RepID=Q1RH03_RICBR Length = 909 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPP 70 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPP 71 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPP PP Sbjct: 51 PPPPPPPPPPPPPPPTPPPPPLPKTPP 77 [138][TOP] >UniRef100_Q3L8Q3 Surface antigen (Fragment) n=1 Tax=Rickettsia bellii RepID=Q3L8Q3_RICBE Length = 682 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPP 70 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPP 71 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPP PP Sbjct: 51 PPPPPPPPPPPPPPPTPPPPPLPKTPP 77 [139][TOP] >UniRef100_B4W5S8 OmpA family protein n=1 Tax=Brevundimonas sp. BAL3 RepID=B4W5S8_9CAUL Length = 385 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP +P R Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPAPVKPAAR 277 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPP 267 [140][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 224 PPPPPPPPPPPPPPPPPPPPPPPPPPP 250 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 225 PPPPPPPPPPPPPPPPPPPPPPPPPPP 251 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 226 PPPPPPPPPPPPPPPPPPPPPPPPPPP 252 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 227 PPPPPPPPPPPPPPPPPPPPPPPPPPP 253 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 228 PPPPPPPPPPPPPPPPPPPPPPPPPPP 254 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPPPPP P G Sbjct: 229 PPPPPPPPPPPPPPPPPPPPPPPPPPCNTG 258 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP + P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPCNTGP 259 [141][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP S PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPP------PPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PPP S PP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 [142][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPP--PPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPP--PPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 [143][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSE 271 PPPPPPPPPPPPPPPPPPPP SE Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPQPSE 48 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP +P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPQP 46 [144][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPP 104 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPP 105 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPP 106 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPP 107 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 82 PPPPPPPPPPPPPPPPPPPPPPPPPPP 108 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 83 PPPPPPPPPPPPPPPPPPPPPPPPPPP 109 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 86 PPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 87 PPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 88 PPPPPPPPPPPPPPPPPPPPPPPPPPP 114 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 89 PPPPPPPPPPPPPPPPPPPPPPPPPPP 115 [145][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPP 48 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 23 PPPPPPPPLPPPPPPPPPPPPPPPPPP 49 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 24 PPPPPPPLPPPPPPPPPPPPPPPPPPP 50 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPP PP Sbjct: 25 PPPPPPLPPPPPPPPPPPPPPPPPPPP 51 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPP PP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPP 52 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPP PP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 29 PPLPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 30 PLPPPPPPPPPPPPPPPPPPPPPPPPP 56 [146][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPP--PPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPP--PPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 [147][TOP] >UniRef100_A7QGU9 Chromosome chr16 scaffold_94, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7QGU9_VITVI Length = 341 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPP 69 [148][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 [149][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 58.9 bits (141), Expect = 2e-07 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPR 283 PPPPPPPPPPPPPPPPPPPP+ Sbjct: 63 PPPPPPPPPPPPPPPPPPPPQ 83 [150][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPP 529 [151][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPP ++PP + Sbjct: 80 PPPPPPPPPPPPPPPPPPPQWEPADPPSK 108 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP EP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPQWEP 102 [152][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 58.9 bits (141), Expect = 2e-07 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPR 283 PPPPPPPPPPPPPPPPPPPP+ Sbjct: 36 PPPPPPPPPPPPPPPPPPPPQ 56 [153][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [154][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [155][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSE 271 PPPPPPPPPPPPPPPPPPPP +E Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPENNE 36 [156][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPP 27 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPP 28 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPP 29 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPP 30 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPP 31 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPP 32 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPP 33 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPP 57 [157][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 120 PPPPPPPPPPPPPPPPPPPPPPPPPPP 146 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 121 PPPPPPPPPPPPPPPPPPPPPPPPPPP 147 Score = 60.1 bits (144), Expect = 7e-08 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 8/35 (22%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP--------RGGSEPP 265 PPPPPPPPPPPPPPPPPPPP RG S PP Sbjct: 126 PPPPPPPPPPPPPPPPPPPPPPTPRFTTRGVSFPP 160 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/33 (69%), Positives = 24/33 (72%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSR 247 PPPPPPPPPPPPPPPPPPPP P R +R Sbjct: 122 PPPPPPPPPPPPPPPPPPPPPPPPPPTPRFTTR 154 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 118 PAPPPPPPPPPPPPPPPPPPPPPPPPP 144 [158][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPP P Sbjct: 49 PPPPPPPPPPPPPPPPPPAP 68 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PPPPPPPPPPPPPPPPP P P G G Sbjct: 50 PPPPPPPPPPPPPPPPPAPYVYPRRPIGVG 79 [159][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 841 PPPPPPPPPPPPPPPPPPPPPPPPPPP 867 [160][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [161][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 [162][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPFILPP 304 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPFILPPP 305 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 268 PGPPPPPPPPPPPPPPPPPPPPPPPPP 294 [163][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 60.8 bits (146), Expect = 4e-08 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPR PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPP 378 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPP + G+ PP Sbjct: 361 PPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 57.4 bits (137), Expect = 5e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 [164][TOP] >UniRef100_P08001 Acrosin heavy chain n=1 Tax=Sus scrofa RepID=ACRO_PIG Length = 415 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRA 244 PPPPPPPPPPPPPPPPPPP+ S P + LS A Sbjct: 348 PPPPPPPPPPPPPPPPPPPQQVSAKPPQALSFA 380 Score = 60.8 bits (146), Expect = 4e-08 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP + ++PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPQQVSAKPP 374 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPP PPPPPPPPPPPPPPPP Sbjct: 344 PPPAPPPPPPPPPPPPPPPP 363 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PP PPPPPPPPPPPPPPPPP Sbjct: 345 PPAPPPPPPPPPPPPPPPPP 364 [165][TOP] >UniRef100_UPI0000D9B773 PREDICTED: similar to CG5514-PB, isoform B n=1 Tax=Macaca mulatta RepID=UPI0000D9B773 Length = 283 Score = 57.4 bits (137), Expect(2) = 5e-08 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 36 PPPPPPPPPPSPPPPPPPPPSPPPLPP 62 Score = 23.1 bits (48), Expect(2) = 5e-08 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -2 Query: 232 WMVTSAHRPVGATASA-AGQGGGTPTGWWGKAGAGAVRLG 116 W + P+ A +A A GGG TG G GAG G Sbjct: 83 WRRSYYRSPLWARGTAMADGGGGGGTGAVGGGGAGQASAG 122 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPP PPPPPP S PP Sbjct: 33 PSPPPPPPPPPPPSPPPPPPPPPSPPP 59 Score = 53.9 bits (128), Expect = 5e-06 Identities = 33/72 (45%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP-----RGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPR 181 PPPPPP PPPPPPPPP PPP S PP L G W R P R Sbjct: 40 PPPPPPSPPPPPPPPPSPPPLPPWGPPPSPPPSPPL-HVQGLLSW---RRSYYRSPLWAR 95 Query: 180 GKAAAPRRDGGG 145 G A A GGG Sbjct: 96 GTAMADGGGGGG 107 [166][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP PP LS Sbjct: 3069 PPPPPPPPPPPPPPPPPPPP-----PPSSSLS 3095 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/54 (46%), Positives = 28/54 (51%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPR 181 P PPPPPPPPPPPPPPPP S+P G + T L PP P+ Sbjct: 1986 PETPPPPPPPPPPPPPPPPPTPSQPSSAGAGKIQN-----TAPTPLQAPPPTPQ 2034 [167][TOP] >UniRef100_UPI000175F433 PREDICTED: similar to formin-like 1 n=1 Tax=Danio rerio RepID=UPI000175F433 Length = 1102 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPPP------PPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPPP GG PP Sbjct: 593 PPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPP 625 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/54 (48%), Positives = 30/54 (55%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 PPPPPPPPPP PPPPPPP G PP G A G + + R + R+P Sbjct: 609 PPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAPGAETGPKARKTIQTKFRMP 662 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/67 (43%), Positives = 31/67 (46%), Gaps = 6/67 (8%) Frame = -3 Query: 345 PPPPPPPP------PPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 PPPPPPPP PPPPPPPPPP GG+ PP GG GPP P Sbjct: 579 PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGG------------GPPPPP 626 Query: 183 RGKAAAP 163 + P Sbjct: 627 PPPGSGP 633 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPP------PPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP G PP Sbjct: 578 PPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPP 610 [168][TOP] >UniRef100_UPI0000E7FF28 PREDICTED: similar to zinc-finger homeodomain protein 4 isoform 2 n=1 Tax=Gallus gallus RepID=UPI0000E7FF28 Length = 3618 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP PP LS Sbjct: 3152 PPPPPPPPPPPPPPPPPPPP-----PPSSSLS 3178 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPP S PP Sbjct: 2028 PPPTPPPPPPPPPPPPPPPPPPSAPP 2053 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPP PPPPPPPPPPPPPPPP + P Sbjct: 2028 PPPTPPPPPPPPPPPPPPPPPPSAPP 2053 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/53 (47%), Positives = 27/53 (50%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 P PPPPPPPPPPPPPPPP S+P G + T L PP P Sbjct: 1985 PETPPPPPPPPPPPPPPPPPTPSQPSSAGAGKIQN-----TTPTPLQAPPPTP 2032 [169][TOP] >UniRef100_UPI0000DD90BE Os04g0438100 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000DD90BE Length = 200 Score = 60.5 bits (145), Expect = 6e-08 Identities = 37/95 (38%), Positives = 45/95 (47%) Frame = +2 Query: 62 PATPPATPRARWRARTATTQTDCTRPSLPPPSRRGAAALPRGTRGGPDRTVRTCHHPSRP 241 PAT ++ R W T++T + + + RR A R +R P R R Sbjct: 46 PATTCSSARTWWATSTSSTSSIVSSSAASALRRRRA----RASRNSPARRPRNSSPAIGT 101 Query: 242 PARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 GG GGGGGGGGGGGGGGGGGGGG Sbjct: 102 TTITTMLFGGGGGGGGGGGGGGGGGGGGGGGGGGG 136 [170][TOP] >UniRef100_UPI0001A2D69A UPI0001A2D69A related cluster n=1 Tax=Danio rerio RepID=UPI0001A2D69A Length = 1058 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPPP------PPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPPP GG PP Sbjct: 540 PPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPP 572 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRD 232 PPPPPPPPPP PPPPPPP G PP G A G + Sbjct: 556 PPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAPGAE 593 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/67 (43%), Positives = 31/67 (46%), Gaps = 6/67 (8%) Frame = -3 Query: 345 PPPPPPPP------PPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 PPPPPPPP PPPPPPPPPP GG+ PP GG GPP P Sbjct: 526 PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGG------------GPPPPP 573 Query: 183 RGKAAAP 163 + P Sbjct: 574 PPPGSGP 580 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/33 (66%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPP------PPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP G PP Sbjct: 525 PPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPP 557 [171][TOP] >UniRef100_UPI0001A2BF4C Hypothetical protein. n=1 Tax=Danio rerio RepID=UPI0001A2BF4C Length = 354 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/84 (41%), Positives = 38/84 (45%), Gaps = 17/84 (20%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP----------GRGLSRAGGRDG-------W*QV 217 PPP PPP P PPPPPPPPPP GG PP G G GG DG ++ Sbjct: 125 PPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKL 184 Query: 216 RTVLSGPPRVPRGKAAAPRRDGGG 145 R V P A+A GGG Sbjct: 185 RKVAKDDSGGPAPAASASSGGGGG 208 Score = 57.8 bits (138), Expect = 4e-07 Identities = 43/117 (36%), Positives = 48/117 (41%), Gaps = 4/117 (3%) Frame = +2 Query: 8 PLTSAAAPWASATSYATRPATPPATPRARWRARTATTQTDCTRPSLPPPSRRGAAALPRG 187 P +A P A A+ P PPA P P+ PPPS G G Sbjct: 109 PPPPSAPPPAPASGPPPPPGPPPA-PGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGG 167 Query: 188 TRGGPDRTVRTCHHPS-RPPARDN---PRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 GG R A+D+ P P S GGGGG GGGGGGGGGGGGG Sbjct: 168 GGGGDGGLASALAGAKLRKVAKDDSGGPAPAASASSGGGGGGSSGGGGGGGGGGGGG 224 [172][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP PP LS Sbjct: 3066 PPPPPPPPPPPPPPPPPPPP-----PPSSSLS 3092 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPP S PP Sbjct: 1952 PPPTPPPPPPPPPPPPPPPPPPSAPP 1977 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPP PPPPPPPPPPPPPPPP + P Sbjct: 1952 PPPTPPPPPPPPPPPPPPPPPPSAPP 1977 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPP---PPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PPP PP Sbjct: 1932 PPPPPPPPPPPPPPPPPTPAPPPTPPPPPP 1961 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPPPPPP-------PPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPPP PP Sbjct: 1936 PPPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPP 1969 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPPPPP-------PPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPPPPPP PP Sbjct: 1937 PPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPP 1970 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPPPP-------PPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPPP PP Sbjct: 1938 PPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPP 1971 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPPP-------PPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPPP PP Sbjct: 1939 PPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPP 1972 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPP-------PPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPPP PP Sbjct: 1940 PPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPP 1973 Score = 53.1 bits (126), Expect = 9e-06 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 P PPPPPPPPPPPPPPPPP P Sbjct: 1929 PETPPPPPPPPPPPPPPPPPTPAPPP 1954 [173][TOP] >UniRef100_UPI0000ECD10B Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10B Length = 3578 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP PP LS Sbjct: 3112 PPPPPPPPPPPPPPPPPPPP-----PPSSSLS 3138 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPP S PP Sbjct: 1988 PPPTPPPPPPPPPPPPPPPPPPSAPP 2013 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPP PPPPPPPPPPPPPPPP + P Sbjct: 1988 PPPTPPPPPPPPPPPPPPPPPPSAPP 2013 [174][TOP] >UniRef100_A4QN64 Zgc:162320 protein n=1 Tax=Danio rerio RepID=A4QN64_DANRE Length = 412 Score = 60.5 bits (145), Expect = 6e-08 Identities = 35/84 (41%), Positives = 38/84 (45%), Gaps = 17/84 (20%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP----------GRGLSRAGGRDG-------W*QV 217 PPP PPP P PPPPPPPPPP GG PP G G GG DG ++ Sbjct: 183 PPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKL 242 Query: 216 RTVLSGPPRVPRGKAAAPRRDGGG 145 R V P A+A GGG Sbjct: 243 RKVAKDDSGGPAPAASASSGGGGG 266 Score = 57.8 bits (138), Expect = 4e-07 Identities = 43/117 (36%), Positives = 48/117 (41%), Gaps = 4/117 (3%) Frame = +2 Query: 8 PLTSAAAPWASATSYATRPATPPATPRARWRARTATTQTDCTRPSLPPPSRRGAAALPRG 187 P +A P A A+ P PPA P P+ PPPS G G Sbjct: 167 PPPPSAPPPAPASGPPPPPGPPPA-PGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGG 225 Query: 188 TRGGPDRTVRTCHHPS-RPPARDN---PRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 GG R A+D+ P P S GGGGG GGGGGGGGGGGGG Sbjct: 226 GGGGDGGLASALAGAKLRKVAKDDSGGPAPAASASSGGGGGGSSGGGGGGGGGGGGG 282 [175][TOP] >UniRef100_C5JBL9 Uncharacterized protein n=1 Tax=uncultured bacterium RepID=C5JBL9_9BACT Length = 140 Score = 60.5 bits (145), Expect = 6e-08 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP ++P Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPAAKP 92 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP S PP Sbjct: 70 PPPPPPPPPPPPPPPPPPPAAKPSAPP 96 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPAAKPSAP 95 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPP 83 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPP 84 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPP 85 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 62 PTPPPPPPPPPPPPPPPPPPPPPPPPP 88 [176][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPPR PP Sbjct: 436 PPPPPPPPPPPPPTPPPPPPRPPPPPP 462 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PP PP Sbjct: 433 PPPPPPPPPPPPPPPPTPPPPPPRPP 458 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/65 (41%), Positives = 30/65 (46%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPP PPPPPP PP V V+ P P + + Sbjct: 437 PPPPPPPPPPPPTPPPPPPRPPPPPPPPP------------PVEKVIVNPIVKPEKRVST 484 Query: 165 PRRDG 151 P R G Sbjct: 485 PPRTG 489 [177][TOP] >UniRef100_C1E0F8 Dead box helicase n=1 Tax=Micromonas sp. RCC299 RepID=C1E0F8_9CHLO Length = 1778 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/63 (53%), Positives = 37/63 (58%) Frame = +2 Query: 158 RRGAAALPRGTRGGPDRTVRTCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGG 337 R G+ + R +R P R S PAR N PG P GGGGGGGGGGGGGGGGG Sbjct: 1373 RSGSESAERASREMPPPPSRA--PTSASPARRNT-PGVWTPATGGGGGGGGGGGGGGGGG 1429 Query: 338 GGG 346 GGG Sbjct: 1430 GGG 1432 [178][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 60.5 bits (145), Expect = 6e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP S PP Sbjct: 264 PPSPPPPPPPPPPPPPPPPPPSPSPPP 290 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP PP Sbjct: 263 PPPSPPPPPPPPPPPPPPPPPPSPSPP 289 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 265 PSPPPPPPPPPPPPPPPPPPSPSPPPP 291 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPP S P Sbjct: 262 PPPPSPPPPPPPPPPPPPPPPPPSPSP 288 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR 235 PPPPPPPPPPPPPPPP P P PP + ++ A R Sbjct: 269 PPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKR 305 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPP PPPPPPPPPPPP Sbjct: 259 PPPPPPPSPPPPPPPPPPPP 278 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPP PPPPPPPPPPPPP Sbjct: 260 PPPPPPSPPPPPPPPPPPPP 279 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPP PPPPPPPPPPPPPP Sbjct: 261 PPPPPSPPPPPPPPPPPPPP 280 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPP PP Sbjct: 259 PPPPPPPSPPPPPPPPPPPPPPPPPP 284 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPP PPPPPPPPP PP Sbjct: 256 PPSPPPPPPPSPPPPPPPPPPPPPPPP 282 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPP PPPPPPPPPP PP Sbjct: 257 PSPPPPPPPSPPPPPPPPPPPPPPPPP 283 [179][TOP] >UniRef100_A5B2G4 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5B2G4_VITVI Length = 261 Score = 60.5 bits (145), Expect = 6e-08 Identities = 36/73 (49%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = +2 Query: 134 RPSLPPPSRRGAAALPRGTRGGPDRTVRTCHHPSR--PPARDNPRPGGSLPPRGGGGGGG 307 RP + PPS P P T+ PS PP NP GG GGGGGGG Sbjct: 71 RPIVSPPSNNPPGITPPVVN--PPVTIPP---PSSTYPPYTGNPPSGGGGGGGGGGGGGG 125 Query: 308 GGGGGGGGGGGGG 346 GGGGGGGGGGGGG Sbjct: 126 GGGGGGGGGGGGG 138 Score = 56.6 bits (135), Expect = 8e-07 Identities = 38/115 (33%), Positives = 48/115 (41%), Gaps = 7/115 (6%) Frame = +2 Query: 23 AAPWASATSYATRPATPPATPRARWRARTATTQTDCTRPSLPPPSRRGAAA-------LP 181 A P A Y ++P P P +R T P PPS++ + Sbjct: 19 ALPPMQACGYCSQPQPPYRYPSPPYRRPNTPT---IPHPHPHPPSKKHPPGHHKERPIVS 75 Query: 182 RGTRGGPDRTVRTCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 + P T + P P + P + P GGGGGGGGGGGGGGGGGGG Sbjct: 76 PPSNNPPGITPPVVNPPVTIPPPSSTYPPYTGNPPSGGGGGGGGGGGGGGGGGGG 130 [180][TOP] >UniRef100_Q2LZE7 GA11560 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=Q2LZE7_DROPS Length = 248 Score = 60.5 bits (145), Expect = 6e-08 Identities = 39/105 (37%), Positives = 44/105 (41%), Gaps = 13/105 (12%) Frame = +2 Query: 65 ATPPATPRARWRARTATTQTDCTRPSLPPPSRRG-AAALPRGTRGGPDRTVRTCHH---- 229 A P P AR A + P PPP + P G P R + Sbjct: 20 AQPAGYPSARPPATYLPAKPPAPAPKPPPPPKTSYGPPKPNGKPKPPPPPPRPSYGAPPP 79 Query: 230 PSRPPARDNPRPG--------GSLPPRGGGGGGGGGGGGGGGGGG 340 P +PPA P G G +PP G GGGGGGGGGGGGGGG Sbjct: 80 PKKPPAPPKPSYGPPPAPPNNGYIPPSNGNGGGGGGGGGGGGGGG 124 [181][TOP] >UniRef100_B4LU87 GJ17267 n=1 Tax=Drosophila virilis RepID=B4LU87_DROVI Length = 1229 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPPPPP-------PPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPPPPPP GG PP Sbjct: 677 PPPPPPPPPPPPGMTAAAAPPPPPPPPPGGGPPP 710 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPPPP-------PPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPPP GG PP Sbjct: 678 PPPPPPPPPPPGMTAAAAPPPPPPPPPGGGPPPP 711 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/74 (43%), Positives = 34/74 (45%), Gaps = 13/74 (17%) Frame = -3 Query: 345 PPPPPPPPPP-------PPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRV 187 PPPPPPPPPP PPPPPPPPP G PP G + G +GPP Sbjct: 679 PPPPPPPPPPGMTAAAAPPPPPPPPPGGGPPPPPPPGPANVG------------NGPPPP 726 Query: 186 P------RGKAAAP 163 P G A AP Sbjct: 727 PPLSTSKSGTALAP 740 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 670 PPPPPPPPPPPPPPPPPPP 688 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRG 280 PPPPPPPPPPPPPPPPPP G Sbjct: 670 PPPPPPPPPPPPPPPPPPPG 689 [182][TOP] >UniRef100_A7S4U2 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7S4U2_NEMVE Length = 448 Score = 60.5 bits (145), Expect = 6e-08 Identities = 34/73 (46%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = -3 Query: 345 PPPPPPP---PPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPP-RVPRG 178 PPPPPPP PPPPPPPPPPPP GG+ PP + G GPP VP G Sbjct: 272 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPPTVMDGSAPAPPPPPPPDGPPAEVPEG 331 Query: 177 KAAAPRRDGGGRL 139 A DG L Sbjct: 332 VPEAVASDGRASL 344 [183][TOP] >UniRef100_O73590 Zinc finger homeobox protein 4 n=1 Tax=Gallus gallus RepID=ZFHX4_CHICK Length = 3573 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPPP PP LS Sbjct: 3107 PPPPPPPPPPPPPPPPPPPP-----PPSSSLS 3133 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPP S PP Sbjct: 1983 PPPTPPPPPPPPPPPPPPPPPPSAPP 2008 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPP PPPPPPPPPPPPPPPP + P Sbjct: 1983 PPPTPPPPPPPPPPPPPPPPPPSAPP 2008 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/53 (47%), Positives = 27/53 (50%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 P PPPPPPPPPPPPPPPP S+P G + T L PP P Sbjct: 1940 PETPPPPPPPPPPPPPPPPPTPSQPSSAGAGKIQN-----TTPTPLQAPPPTP 1987 [184][TOP] >UniRef100_UPI0000D9E767 PREDICTED: similar to SOX-1 protein n=1 Tax=Macaca mulatta RepID=UPI0000D9E767 Length = 786 Score = 60.1 bits (144), Expect = 7e-08 Identities = 46/123 (37%), Positives = 51/123 (41%), Gaps = 18/123 (14%) Frame = +2 Query: 32 WASATSYATRPATPPATPRARWRARTATTQTDCTRPS---LPPPSRRGAAALPRGTRGGP 202 WA + + P A PRA R + RPS PP+ G LP TR Sbjct: 239 WAPRAAGPACASAPSARPRAGSRQPIPGSAAPALRPSPRARAPPAVPGP--LPGCTRTAA 296 Query: 203 DRTVRTCHHPSRPPARDNPR-----------PGGSLPPRG----GGGGGGGGGGGGGGGG 337 R T H P PA P PGG+ P G GGGGGGGGGGGGG Sbjct: 297 AREEETAH-PGPGPAHSAPMYSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGG 355 Query: 338 GGG 346 GGG Sbjct: 356 GGG 358 [185][TOP] >UniRef100_UPI00005A436D PREDICTED: similar to forkhead box L2 n=1 Tax=Canis lupus familiaris RepID=UPI00005A436D Length = 582 Score = 60.1 bits (144), Expect = 7e-08 Identities = 41/97 (42%), Positives = 44/97 (45%), Gaps = 10/97 (10%) Frame = +2 Query: 83 PRARWRARTATTQTDCTRPSLPPPSRRGAAAL-----PRGTRGG-----PDRTVRTCHHP 232 PRA RARTA P R G A + P G P R + P Sbjct: 250 PRAASRARTAPRGHRGNGAGAARPRRAGFAMMASYPEPEDAAGALLAPEPGRAAKEPEAP 309 Query: 233 SRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGG 343 PP P PG +GGGGGGGGGGGGGGGGGGG Sbjct: 310 PPPP----PSPG-----KGGGGGGGGGGGGGGGGGGG 337 Score = 57.0 bits (136), Expect = 6e-07 Identities = 41/109 (37%), Positives = 45/109 (41%), Gaps = 11/109 (10%) Frame = +2 Query: 53 ATRPATPPATPRARWRARTATTQTDCTRPSLPPPSRRG-AAALPRGTRGG---------P 202 A R A P +T AR + T +R P RG A R R G P Sbjct: 228 AQREARPASTGGARGAQKFETRPRAASRARTAPRGHRGNGAGAARPRRAGFAMMASYPEP 287 Query: 203 DRTVRTCHHPSRPPARDNPRPGGSLPPRGG-GGGGGGGGGGGGGGGGGG 346 + P A P PP G GGGGGGGGGGGGGGGGGG Sbjct: 288 EDAAGALLAPEPGRAAKEPEAPPPPPPSPGKGGGGGGGGGGGGGGGGGG 336 [186][TOP] >UniRef100_Q2RTE8 Putative uncharacterized protein n=1 Tax=Rhodospirillum rubrum ATCC 11170 RepID=Q2RTE8_RHORT Length = 208 Score = 60.1 bits (144), Expect = 7e-08 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP EPP Sbjct: 93 PPPPPPPPPPPPPPPPPPPP---PEPP 116 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 91 PEPPPPPPPPPPPPPPPPPPPPPEPPP 117 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSE 271 PPPPPPPPPPPPPPPPP PP SE Sbjct: 97 PPPPPPPPPPPPPPPPPEPPPFVSE 121 [187][TOP] >UniRef100_B4YB55 BimA n=1 Tax=Burkholderia pseudomallei RepID=B4YB55_BURPS Length = 369 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP S PP Sbjct: 96 PPPPPPPPPPPPPPPPPPPSTTPSPPP 122 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 24/34 (70%), Gaps = 5/34 (14%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPP-----PPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPP PP + PP R Sbjct: 97 PPPPPPPPPPPPPPPPPPSTTPSPPPPTTTPPTR 130 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPP----PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPPP PP Sbjct: 84 PPPPPPPPSTTTPPPPPPPPPPPPPPPPPPP 114 [188][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP S PP Sbjct: 128 PPPPPPPPPPNPPPPPPPPPPSPSPPP 154 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP S PP Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPPP 127 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP S PP Sbjct: 87 PPPPPPPPVPPPPPPPPPPPPPPSPPP 113 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPP 128 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPP 129 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP + PP Sbjct: 115 PPPPPPPPPSPPPPPPPPPPPPPNPPP 141 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 116 PPPPPPPPSPPPPPPPPPPPPPNPPPP 142 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 117 PPPPPPPSPPPPPPPPPPPPPNPPPPP 143 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPP PP Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 88 PPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPP PP Sbjct: 89 PPPPPPVPPPPPPPPPPPPPPSPPPPP 115 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 100 PPPPPPPPPPSPPPPPPPPPPPPPSPP 126 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPP PP Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPP 130 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 114 PPPPPPPPPPSPPPPPPPPPPPPPNPP 140 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPP PP Sbjct: 90 PPPPPVPPPPPPPPPPPPPPSPPPPPP 116 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPPP PP Sbjct: 96 PPPPPPPPPPPPPPSPPPPPPPPPPPP 122 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 97 PPPPPPPPPPPPPSPPPPPPPPPPPPP 123 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 111 PPPPPPPPPPPPPSPPPPPPPPPPPPP 137 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPP P PP Sbjct: 131 PPPPPPPNPPPPPPPPPPSPSPPPSPP 157 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPP PP Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPP 131 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPP P PP Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPP 132 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPP PP PP Sbjct: 107 PPPSPPPPPPPPPPPPPSPPPPPPPPP 133 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPP PPP PP Sbjct: 108 PPSPPPPPPPPPPPPPSPPPPPPPPPP 134 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPP PPPP PP Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPP 135 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPP PP Sbjct: 91 PPPPVPPPPPPPPPPPPPPSPPPPPPP 117 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPP P PP Sbjct: 92 PPPVPPPPPPPPPPPPPPSPPPPPPPP 118 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPP PP PP Sbjct: 93 PPVPPPPPPPPPPPPPPSPPPPPPPPP 119 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPP PPP PP Sbjct: 94 PVPPPPPPPPPPPPPPSPPPPPPPPPP 120 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPP PP Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPPPP 145 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPP P PP Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPP 146 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPP PP PP Sbjct: 121 PPPSPPPPPPPPPPPPPNPPPPPPPPP 147 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPP PPP PP Sbjct: 122 PPSPPPPPPPPPPPPPNPPPPPPPPPP 148 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPP P S PP Sbjct: 132 PPPPPPNPPPPPPPPPPSPSPPPSPPP 158 [189][TOP] >UniRef100_B9RYC5 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RYC5_RICCO Length = 510 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPPPR PP Sbjct: 104 PPPPPSPPPPPPPPPPPPPPRPTGLPP 130 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPP PPPPPPPPPPPP Sbjct: 102 PPPPPPPSPPPPPPPPPPPP 121 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPP PPPPPPPPPPPPP Sbjct: 103 PPPPPPSPPPPPPPPPPPPP 122 [190][TOP] >UniRef100_Q5BHU8 AT04667p n=1 Tax=Drosophila melanogaster RepID=Q5BHU8_DROME Length = 1286 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPPPP------PPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPPP GS PP Sbjct: 730 PPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPP 762 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/77 (42%), Positives = 34/77 (44%), Gaps = 10/77 (12%) Frame = -3 Query: 345 PPPPPPP--------PPPPPPPPPPPPPRG--GSEPPGRGLSRAGGRDGW*QVRTVLSGP 196 PPPPPPP PPPPPPPPPPPPP G+ PP G S P Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSG-----------SAP 761 Query: 195 PRVPRGKAAAPRRDGGG 145 P P AP GGG Sbjct: 762 PPPP----PAPIEGGGG 774 [191][TOP] >UniRef100_Q29QD2 AT18380p n=1 Tax=Drosophila melanogaster RepID=Q29QD2_DROME Length = 1153 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/33 (72%), Positives = 24/33 (72%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPPPP------PPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPPP GS PP Sbjct: 597 PPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPP 629 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/77 (42%), Positives = 34/77 (44%), Gaps = 10/77 (12%) Frame = -3 Query: 345 PPPPPPP--------PPPPPPPPPPPPPRG--GSEPPGRGLSRAGGRDGW*QVRTVLSGP 196 PPPPPPP PPPPPPPPPPPPP G+ PP G S P Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSG-----------SAP 628 Query: 195 PRVPRGKAAAPRRDGGG 145 P P AP GGG Sbjct: 629 PPPP----PAPIEGGGG 641 [192][TOP] >UniRef100_B7PLD9 Circumsporozoite protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PLD9_IXOSC Length = 188 Score = 60.1 bits (144), Expect = 7e-08 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSE 271 PPPPPPPPPPPPPPPPPPPP SE Sbjct: 29 PPPPPPPPPPPPPPPPPPPPAPPSE 53 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/63 (46%), Positives = 32/63 (50%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPPPPPPPPPPPPPPPPPPP PP T++ P +P A Sbjct: 27 PPPPPPPPPPPPPPPPPPPP--PPAPPSE--------------TTIIEVPVPMPFPVPAP 70 Query: 165 PRR 157 PRR Sbjct: 71 PRR 73 [193][TOP] >UniRef100_B4QT65 GD21099 n=1 Tax=Drosophila simulans RepID=B4QT65_DROSI Length = 360 Score = 60.1 bits (144), Expect = 7e-08 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPPP PPG Sbjct: 142 PPPPPPPPPPPPPPPPPPPP-----PPG 164 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPPPP PG +S Sbjct: 141 PPPPPPPPPPPPPPPPPPPPPPPGVPGNPVS 171 [194][TOP] >UniRef100_B4N591 GK20527 n=1 Tax=Drosophila willistoni RepID=B4N591_DROWI Length = 2261 Score = 60.1 bits (144), Expect = 7e-08 Identities = 49/140 (35%), Positives = 56/140 (40%), Gaps = 28/140 (20%) Frame = +2 Query: 11 LTSAAAPWASATSYATRPATPPATPRARWRARTATTQTDCTRPSLPPPSRRGA------A 172 L++AAA A A YA A AT +P PPP+ + A Sbjct: 1678 LSAAAAAAAGAHVYALPAQHATALIPTNIFPYAATAAAAAGQPGPPPPTAQSAPHHALIT 1737 Query: 173 ALPRGTRGGP--DRTVRTCHHPSRPPARDNPRPGGSLPPR-------------------- 286 A P GG D + + PS P A P S PP Sbjct: 1738 AAPFYPAGGSSIDSSGASQSAPSTPAAPGRQAPLFSTPPAPNNVSSGSASSSGGGAGGSS 1797 Query: 287 GGGGGGGGGGGGGGGGGGGG 346 GGGGGGGGGGGGGGGGGGGG Sbjct: 1798 GGGGGGGGGGGGGGGGGGGG 1817 [195][TOP] >UniRef100_B4M7B5 GJ16487 n=1 Tax=Drosophila virilis RepID=B4M7B5_DROVI Length = 880 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGS 274 PPPPPPPPPPPPPPPPPPPP S Sbjct: 189 PPPPPPPPPPPPPPPPPPPPESAS 212 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 186 PPPPPPPPPPPPPPPPPPPP 205 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 187 PPPPPPPPPPPPPPPPPPPP 206 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 188 PPPPPPPPPPPPPPPPPPPP 207 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGS 274 PPPPPPPPPPPPPPPPPPP S Sbjct: 190 PPPPPPPPPPPPPPPPPPPESASS 213 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPP 289 PPPPPPPPPPPPPPPPPPP Sbjct: 807 PPPPPPPPPPPPPPPPPPP 825 Score = 55.8 bits (133), Expect = 1e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPP Sbjct: 807 PPPPPPPPPPPPPPPPPPP 825 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDG 229 PPPPPPPPPPPPPPPPPP P P S + + G Sbjct: 808 PPPPPPPPPPPPPPPPPPLPLPPQPLPLSSASSSSSQSG 846 [196][TOP] >UniRef100_B4HH21 GM26598 n=1 Tax=Drosophila sechellia RepID=B4HH21_DROSE Length = 359 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRG 280 PPPPPPPPPPPPPPPPPPPP G Sbjct: 143 PPPPPPPPPPPPPPPPPPPPPG 164 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPP PPG Sbjct: 143 PPPPPPPPPPPPPPPPPPP-----PPG 164 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 P PPPPPPPPPPPPPPPPP PG +S Sbjct: 141 PSPPPPPPPPPPPPPPPPPPPPPGVPGNPVS 171 [197][TOP] >UniRef100_A9V6E2 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9V6E2_MONBE Length = 2389 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/32 (75%), Positives = 24/32 (75%), Gaps = 5/32 (15%) Frame = -3 Query: 345 PPPPPPPPPP-----PPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPPP G S PP Sbjct: 1230 PPPPPPPPPPGGASGPPPPPPPPPPGGASGPP 1261 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 5/31 (16%) Frame = -3 Query: 342 PPPPPPPPP-----PPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP G S PP Sbjct: 1216 PPPPPPPPPGGASGPPPPPPPPPPGGASGPP 1246 Score = 56.6 bits (135), Expect = 8e-07 Identities = 32/78 (41%), Positives = 32/78 (41%), Gaps = 17/78 (21%) Frame = -3 Query: 345 PPPPPPPPPPP------PPPPPP-----------PPPRGGSEPPGRGLSRAGGRDGW*QV 217 PPPPPPPPPPP PPPPPP PPP G PPG GG D Sbjct: 1308 PPPPPPPPPPPVTGNAAPPPPPPLPPTGSSAPSAPPPPGPPVPPGPPPPGVGGADVESMS 1367 Query: 216 RTVLSGPPRVPRGKAAAP 163 R PP P P Sbjct: 1368 RAPPPPPPMTPAASLPRP 1385 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/82 (40%), Positives = 37/82 (45%), Gaps = 21/82 (25%) Frame = -3 Query: 345 PPPPPPPPPP-----PPPPPPPPPPRGGSEPPGRGL---------SRAGGRDGW*QVRTV 208 PPPPPPPPPP PPPPPPPPPP S G+ SR+ Q++ Sbjct: 1245 PPPPPPPPPPGGASGPPPPPPPPPPGASSGANSAGMDALRKQIERSRSTRSGSLSQLKQG 1304 Query: 207 LSGPPRVP-------RGKAAAP 163 GPP P G AA P Sbjct: 1305 AGGPPPPPPPPPPPVTGNAAPP 1326 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/44 (54%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = -3 Query: 345 PPPPPPPPP-----PPPPPPPPPPPRGGSEPPGRGLSRAGGRDG 229 PPPPPPPPP PPPPPPPPPP PP GG G Sbjct: 1216 PPPPPPPPPGGASGPPPPPPPPPPGGASGPPPPPPPPPPGGASG 1259 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/77 (37%), Positives = 34/77 (44%), Gaps = 10/77 (12%) Frame = -3 Query: 345 PPPPPPPPP-----PPPPPPPPPP-----PRGGSEPPGRGLSRAGGRDGW*QVRTVLSGP 196 PPPPPPPPP PPPPPPPPPP P PP G S G +R + Sbjct: 1231 PPPPPPPPPGGASGPPPPPPPPPPGGASGPPPPPPPPPPGASSGANSAGMDALRKQIERS 1290 Query: 195 PRVPRGKAAAPRRDGGG 145 G + ++ GG Sbjct: 1291 RSTRSGSLSQLKQGAGG 1307 [198][TOP] >UniRef100_A8P9A8 Putative uncharacterized protein n=1 Tax=Brugia malayi RepID=A8P9A8_BRUMA Length = 93 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSE 271 PPPPPPPPPPPPPPPPPPPP+ S+ Sbjct: 47 PPPPPPPPPPPPPPPPPPPPKKTSD 71 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPP 61 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPP 62 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPP 63 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPP 64 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPP 65 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -3 Query: 336 PPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPP PP + S Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPKKTS 70 [199][TOP] >UniRef100_A0BLV2 Chromosome undetermined scaffold_115, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0BLV2_PARTE Length = 1084 Score = 60.1 bits (144), Expect = 7e-08 Identities = 34/70 (48%), Positives = 34/70 (48%), Gaps = 9/70 (12%) Frame = -3 Query: 345 PPPPPPPP------PPPPPPPPPPPPRGGS---EPPGRGLSRAGGRDGW*QVRTVLSGPP 193 PPPPPPPP PPPPPPPPPPPP GGS PP GGR L PP Sbjct: 552 PPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGR---------LPPPP 602 Query: 192 RVPRGKAAAP 163 P G P Sbjct: 603 PPPPGGMPPP 612 [200][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP +P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPEPEPQP 79 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 56 PPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPP EP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPEPEP 77 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP P P+ PP Sbjct: 58 PPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPPP--PPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPP--PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPP--PPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPP--PPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/28 (78%), Positives = 22/28 (78%), Gaps = 2/28 (7%) Frame = -3 Query: 345 PPP--PPPPPPPPPPPPPPPPPRGGSEP 268 PPP PPPPPPPPPPPPPPPPP EP Sbjct: 48 PPPASPPPPPPPPPPPPPPPPPPPPPEP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP P + PP Sbjct: 57 PPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPPPP--PPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 1950 PPPPPPPPPPTEDPPPPPPPPPAEAPPPP 1978 [201][TOP] >UniRef100_B6Q8P3 Actin cortical patch assembly protein Pan1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q8P3_PENMQ Length = 1446 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/42 (66%), Positives = 28/42 (66%), Gaps = 4/42 (9%) Frame = -3 Query: 345 PPPPPPPPPP----PPPPPPPPPPRGGSEPPGRGLSRAGGRD 232 PPPPPPPPPP PPPPPPPPPP GG PP G GG D Sbjct: 1377 PPPPPPPPPPGAAAPPPPPPPPPPTGG-PPPALG---GGGTD 1414 [202][TOP] >UniRef100_B2WMY2 Putative uncharacterized protein n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2WMY2_PYRTR Length = 418 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRG 280 PPPPPPPPPPPPPPPPPPPP G Sbjct: 115 PPPPPPPPPPPPPPPPPPPPGG 136 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGG 277 PPPPPPPPPPPPPPPPPPP GG Sbjct: 115 PPPPPPPPPPPPPPPPPPPPGG 136 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPP G P Sbjct: 115 PPPPPPPPPPPPPPPPPPPPGGIP 138 [203][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 60.1 bits (144), Expect = 7e-08 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP +P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPEPEPQP 79 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPP 72 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 56 PPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPP EP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPEPEP 77 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP P P+ PP Sbjct: 58 PPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPPP--PPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPPP PP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPP 70 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPP--PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPPP PP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPP 71 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPP--PPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPPP PP Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPP--PPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPPP PP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/28 (78%), Positives = 22/28 (78%), Gaps = 2/28 (7%) Frame = -3 Query: 345 PPP--PPPPPPPPPPPPPPPPPRGGSEP 268 PPP PPPPPPPPPPPPPPPPP EP Sbjct: 48 PPPASPPPPPPPPPPPPPPPPPPPPPEP 75 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP P + PP Sbjct: 57 PPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/29 (72%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPPPP--PPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 1853 PPPPPPPPPPTEDPPPPPPPPPAEAPPPP 1881 [204][TOP] >UniRef100_A3AB67 Formin-like protein 16 n=1 Tax=Oryza sativa Japonica Group RepID=FH16_ORYSJ Length = 906 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/64 (48%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Frame = -3 Query: 345 PPPPPPPPPPPPP---PPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGK 175 PPPPP PPPPPP PPPPPPP+G S PP GG+ G PP P+G Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP---PPPGGKKG--------GPPPPPPKGG 385 Query: 174 AAAP 163 A+ P Sbjct: 386 ASRP 389 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/80 (40%), Positives = 37/80 (46%), Gaps = 10/80 (12%) Frame = -3 Query: 345 PPPPPPP------PPPPPPP---PPPPPPRG-GSEPPGRGLSRAGGRDGW*QVRTVLSGP 196 PPPPPPP PPPPPPP PPPPPP+G PP +G P Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKG-----------------PPP 355 Query: 195 PRVPRGKAAAPRRDGGGRLG 136 P P+G + P GG+ G Sbjct: 356 PPPPKGPSPPPPPPPGGKKG 375 [205][TOP] >UniRef100_Q03173-5 Isoform 4 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-5 Length = 787 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPP PPPP PP LS G + G T S P +P Sbjct: 427 PPPPPPPPPPPPPPPLPPPPL----PPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 482 Query: 177 KAAAP 163 A AP Sbjct: 483 SAGAP 487 [206][TOP] >UniRef100_Q03173-2 Isoform 1 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-2 Length = 390 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPP PPPP PP LS G + G T S P +P Sbjct: 30 PPPPPPPPPPPPPPPLPPPPL----PPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 85 Query: 177 KAAAP 163 A AP Sbjct: 86 SAGAP 90 [207][TOP] >UniRef100_Q03173-4 Isoform 3 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-4 Length = 783 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPP PPPP PP LS G + G T S P +P Sbjct: 423 PPPPPPPPPPPPPPPLPPPPL----PPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 478 Query: 177 KAAAP 163 A AP Sbjct: 479 SAGAP 483 [208][TOP] >UniRef100_Q03173 Protein enabled homolog n=1 Tax=Mus musculus RepID=ENAH_MOUSE Length = 802 Score = 60.1 bits (144), Expect = 7e-08 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGR----DGW*QVRTVLSGPPRVPRG 178 PPPPPPPPPPPPPPP PPPP PP LS G + G T S P +P Sbjct: 442 PPPPPPPPPPPPPPPLPPPPL----PPLASLSHCGSQASPPPGTPLASTPSSKPSVLPSP 497 Query: 177 KAAAP 163 A AP Sbjct: 498 SAGAP 502 [209][TOP] >UniRef100_Q8NFD5-2 Isoform 2 of AT-rich interactive domain-containing protein 1B n=2 Tax=Homo sapiens RepID=Q8NFD5-2 Length = 2249 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/60 (51%), Positives = 35/60 (58%) Frame = +2 Query: 167 AAALPRGTRGGPDRTVRTCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 A+A G G D + H P ++ N PG S P GGGGGGGGGGGGG GGGGGG Sbjct: 269 ASAAAAGAPGSMDPLQNS--HEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGG 326 [210][TOP] >UniRef100_Q8NFD5-3 Isoform 3 of AT-rich interactive domain-containing protein 1B n=2 Tax=Homo sapiens RepID=Q8NFD5-3 Length = 2289 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/60 (51%), Positives = 35/60 (58%) Frame = +2 Query: 167 AAALPRGTRGGPDRTVRTCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 A+A G G D + H P ++ N PG S P GGGGGGGGGGGGG GGGGGG Sbjct: 269 ASAAAAGAPGSMDPLQNS--HEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGG 326 [211][TOP] >UniRef100_Q8NFD5 AT-rich interactive domain-containing protein 1B n=2 Tax=Homo sapiens RepID=ARI1B_HUMAN Length = 2236 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/60 (51%), Positives = 35/60 (58%) Frame = +2 Query: 167 AAALPRGTRGGPDRTVRTCHHPSRPPARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 A+A G G D + H P ++ N PG S P GGGGGGGGGGGGG GGGGGG Sbjct: 269 ASAAAAGAPGSMDPLQNS--HEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGG 326 [212][TOP] >UniRef100_UPI0001796908 PREDICTED: zinc finger homeobox 4 n=1 Tax=Equus caballus RepID=UPI0001796908 Length = 3574 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP S PP Sbjct: 1997 PPPTPPPPPPPPPPPPPPPPPPPSAPP 2023 [213][TOP] >UniRef100_UPI0000F2C563 PREDICTED: similar to functional smad suppressing element 18 n=1 Tax=Monodelphis domestica RepID=UPI0000F2C563 Length = 1158 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAG 241 PPPPPPPPPPPPPPPPPPPP +P R LS G Sbjct: 771 PPPPPPPPPPPPPPPPPPPP----QPHHRLLSPGG 801 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLS 250 PPPPPPPPPPPPPPPPP P P G S Sbjct: 774 PPPPPPPPPPPPPPPPPQPHHRLLSPGGTSCS 805 [214][TOP] >UniRef100_UPI0000F2C4EF PREDICTED: similar to junction-mediating and regulatory protein isoform 2 n=1 Tax=Monodelphis domestica RepID=UPI0000F2C4EF Length = 714 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/42 (59%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPP----PRGGSEPPGRGLSRAGGRD 232 PP PPPPPPPPPPPPPPPP G +EP +GLS+ G + Sbjct: 533 PPSPPPPPPPPPPPPPPPPLPTTKDGPTEPLEKGLSKVEGEE 574 [215][TOP] >UniRef100_UPI0000F2C4EE PREDICTED: similar to junction-mediating and regulatory protein isoform 1 n=1 Tax=Monodelphis domestica RepID=UPI0000F2C4EE Length = 967 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/42 (59%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPP----PRGGSEPPGRGLSRAGGRD 232 PP PPPPPPPPPPPPPPPP G +EP +GLS+ G + Sbjct: 786 PPSPPPPPPPPPPPPPPPPLPTTKDGPTEPLEKGLSKVEGEE 827 [216][TOP] >UniRef100_UPI00001809D7 UPI00001809D7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI00001809D7 Length = 3593 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP S PP Sbjct: 2018 PPPTPPPPPPPPPPPPPPPPPPPSAPP 2044 [217][TOP] >UniRef100_UPI0000EE3DB8 zinc finger homeodomain 4 n=1 Tax=Homo sapiens RepID=UPI0000EE3DB8 Length = 3571 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP S PP Sbjct: 1994 PPTPPPPPPPPPPPPPPPPPPPPSAPP 2020 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPP PPPPPPPPPPPPPPPP Sbjct: 1993 PPPTPPPPPPPPPPPPPPPP 2012 [218][TOP] >UniRef100_UPI00004576BB Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Homo sapiens RepID=UPI00004576BB Length = 3567 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP S PP Sbjct: 1994 PPTPPPPPPPPPPPPPPPPPPPPSAPP 2020 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPP PPPPPPPPPPPPPPPP Sbjct: 1993 PPPTPPPPPPPPPPPPPPPP 2012 [219][TOP] >UniRef100_UPI00016E6B74 UPI00016E6B74 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E6B74 Length = 493 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/81 (41%), Positives = 38/81 (46%), Gaps = 6/81 (7%) Frame = -3 Query: 345 PPPPPPPPPPPPPP---PPPPPPRGGSEPPGRGLSRAGGRDG-W*QVR--TVLSGPPRVP 184 PPPPPPPPPPPPP PPPPPP G PP GGR Q+R L +P Sbjct: 383 PPPPPPPPPPPPPTTDFPPPPPPSSGPLPPTSSGGGGGGRGALLDQIRLGKKLRNVTDIP 442 Query: 183 RGKAAAPRRDGGGRLGRVQSV 121 AP G +G + V Sbjct: 443 DAAPPAPAESSEGIVGALMMV 463 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPP----PPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPPP PP Sbjct: 372 PPPPPPPGGGGPPPPPPPPPPPPPTTDFPPP 402 [220][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP S PP Sbjct: 807 PPPPPPPPPPPPPPPPPPPP---SAPP 830 Score = 56.6 bits (135), Expect = 8e-07 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 P PPPPPPPPPPPPPPPPPP + P Sbjct: 805 PTPPPPPPPPPPPPPPPPPPPPSAPP 830 [221][TOP] >UniRef100_Q1LVK6 Novel protein similar to vertebrate vasodilator-stimulated phosphoprotein (VASP) n=1 Tax=Danio rerio RepID=Q1LVK6_DANRE Length = 445 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/90 (42%), Positives = 41/90 (45%), Gaps = 11/90 (12%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGS--EPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKA 172 PPPPP PPP PPPPP PPP GG PP L +GG DG G P G A Sbjct: 207 PPPPPGPPPSGPPPPPGPPPSGGGAPPPPAPPLPSSGGSDG--------GGGPGGGGGLA 258 Query: 171 AA---------PRRDGGGRLGRVQSVWVVA 109 AA P+ D GG G + VA Sbjct: 259 AALAAAKLRKVPKDDAGGGGGVASAAASVA 288 [222][TOP] >UniRef100_B0R0Q4 Novel protein similar to vertebrate vasodilator-stimulated phosphoprotein (VASP) n=1 Tax=Danio rerio RepID=B0R0Q4_DANRE Length = 420 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/90 (42%), Positives = 41/90 (45%), Gaps = 11/90 (12%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGS--EPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKA 172 PPPPP PPP PPPPP PPP GG PP L +GG DG G P G A Sbjct: 202 PPPPPGPPPSGPPPPPGPPPSGGGAPPPPAPPLPSSGGSDG--------GGGPGGGGGLA 253 Query: 171 AA---------PRRDGGGRLGRVQSVWVVA 109 AA P+ D GG G + VA Sbjct: 254 AALAAAKLRKVPKDDAGGGGGVASAAASVA 283 [223][TOP] >UniRef100_A2BDY3 Forkhead box D3 n=1 Tax=Mus musculus RepID=A2BDY3_MOUSE Length = 469 Score = 59.7 bits (143), Expect = 1e-07 Identities = 49/129 (37%), Positives = 55/129 (42%), Gaps = 16/129 (12%) Frame = +2 Query: 8 PLTSAAAPWASATSYA-----TRPATPPATPR--ARWRARTATTQTDCTRPSLPPP-SRR 163 P +AAA A+A Y P PPA P + R A PSL + Sbjct: 278 PAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPSLQLQLNTL 337 Query: 164 GAAALPRGTRGGPDRTVRTCHHPSRPPA--------RDNPRPGGSLPPRGGGGGGGGGGG 319 GAAA GT G T PS P+ + PGGS GGGG GGG GG Sbjct: 338 GAAAAAAGTAGAAGTTSLIKSEPSARPSFSIENIIGAGSAAPGGSA---GGGGSGGGAGG 394 Query: 320 GGGGGGGGG 346 GGG GGGGG Sbjct: 395 GGGSGGGGG 403 [224][TOP] >UniRef100_Q1NB62 OmpA/MotB n=1 Tax=Sphingomonas sp. SKA58 RepID=Q1NB62_9SPHN Length = 358 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP +P Sbjct: 220 PPPPPPPPPPPPPPPPPPPPVAECQP 245 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPP PG Sbjct: 220 PPPPPPPPPPPPPPPPPPPPVAECQPG 246 [225][TOP] >UniRef100_C4B111 Intracellular motility protein A n=4 Tax=Burkholderia mallei RepID=C4B111_BURMA Length = 373 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P S PP Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPP 116 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPP 117 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPP P S PP Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPP 121 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPP PP PP Sbjct: 96 PPPPPPPPPPPPSPPPPSPPPPSPPPP 122 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPP PP Sbjct: 94 PPPPPPPPPPPPPPSPPPPSPPPPSPP 120 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPP PPPP P S PP Sbjct: 100 PPPPPPPPSPPPPSPPPPSPPPPSPPP 126 [226][TOP] >UniRef100_B4W7V0 OmpA family protein n=1 Tax=Brevundimonas sp. BAL3 RepID=B4W7V0_9CAUL Length = 384 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP ++ P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPAPVAQAP 273 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPP 265 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPP P R Sbjct: 248 PPPPPPPPPPPPPPPPPPPAPVAQAPVAR 276 [227][TOP] >UniRef100_A3UDI3 OmpA family protein n=1 Tax=Oceanicaulis alexandrii HTCC2633 RepID=A3UDI3_9RHOB Length = 355 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PPPPPPPPPPPPPPPPPPPP E G Sbjct: 220 PPPPPPPPPPPPPPPPPPPPAPECEDAG 247 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 219 PPPPPPPPPPPPPPPPPPPP 238 [228][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP S PP Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPP 231 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP S PP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP S PP Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 58.9 bits (141), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP PP Sbjct: 241 PPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPP 232 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPP 233 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPP 234 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 58.2 bits (139), Expect = 3e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 232 PPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 55.8 bits (133), Expect = 1e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPP PPPPPP PP Sbjct: 239 PSPPPPPPPPPPPSPPPPPPPPSPSPP 265 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/29 (75%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = -3 Query: 345 PPPPPPPPPPPPP--PPPPPPPRGGSEPP 265 PP PPPPPPPPPP PPPPPPP S PP Sbjct: 238 PPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPP PP Sbjct: 242 PPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPP P PP Sbjct: 243 PPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPP PP Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPP 235 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPP P PP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPP 236 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPP PP PP Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPP 237 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPP PPP PP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPP 238 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPP PPPP PP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPP 239 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPP PP Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPP P PP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPP PP PP Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPP PPP PP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPP PPPP PP Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPP PP Sbjct: 233 PPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPP P PP Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPP P PPPPP S PP Sbjct: 249 PPPSPPPPPPPPSPSPPPPPPSPSPPP 275 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/30 (70%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPPPPPPPPPPPP---PPPPPPRGGSEPP 265 PPPPP PPPPPPPP PPPPPP PP Sbjct: 247 PPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 [229][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP S PP Sbjct: 227 PPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPP PP S PP Sbjct: 233 PPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPP PPPPPPPPPP PP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPP PPP PP Sbjct: 234 PPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPP PPPPPPPPPPP PP Sbjct: 218 PPSPPPPPSPPPPPPPPPPPSPPPPPP 244 Score = 55.1 bits (131), Expect = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPP P PP Sbjct: 232 PPPPPPSPPPPPPPPPPPSPPPPPSPP 258 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPP PP PP Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPP PPP PP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPP PPPP PP Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPP PPP PP Sbjct: 240 PPPPPPPPPPSPPPPPSPPPPSPPLPP 266 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPP PPPP PP Sbjct: 241 PPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPP PPPPP PPPPPPPP S PP Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPP 241 [230][TOP] >UniRef100_C5YEM1 Putative uncharacterized protein Sb06g026640 n=1 Tax=Sorghum bicolor RepID=C5YEM1_SORBI Length = 220 Score = 59.7 bits (143), Expect = 1e-07 Identities = 44/118 (37%), Positives = 50/118 (42%), Gaps = 22/118 (18%) Frame = -3 Query: 345 PPPPPPPPPPPPP----PPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPR---- 190 PPPPPPPPPPP P PPPPPPP P R GG G + + PPR Sbjct: 72 PPPPPPPPPPPLPLPLRPPPPPPPLSDLPAPARPKQSIGG--GEEEPAPGSTSPPRGRGS 129 Query: 189 ----------VPRGKAAAPRRDGGGRLGRVQSVW----VVAVRARHRARGVAGGVAGR 58 R + A R+GGGR GR W V+V + G G AGR Sbjct: 130 PVGSGSARFGGSRVRVRAAVREGGGRDGRGDRRWRWFYEVSVERGQKVGG--GSTAGR 185 [231][TOP] >UniRef100_Q5CS67 Signal peptide containing large protein with proline stretches n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CS67_CRYPV Length = 1884 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP + P Sbjct: 1180 PPPPPPPPPPPPPPPPPPPPPSYTSP 1205 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP S PP Sbjct: 1545 PPPPPPPPPPPPPPPPPPPSPPPSPPP 1571 Score = 58.5 bits (140), Expect = 2e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRGL 253 PPPPPPPPPPPPPPPPPPP P G+ Sbjct: 1180 PPPPPPPPPPPPPPPPPPPPPSYTSPSNGI 1209 [232][TOP] >UniRef100_Q4DD51 Putative uncharacterized protein n=1 Tax=Trypanosoma cruzi RepID=Q4DD51_TRYCR Length = 603 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 339 PPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP G + PP Sbjct: 383 PPPPPPPPPPPPPPPPPPAGKAPPP 407 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 5/33 (15%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPP-----PPPRGGSEPPG 262 PPPPPPPPPPPPPPPPP PPP PPG Sbjct: 383 PPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPG 415 [233][TOP] >UniRef100_B7Q7F1 Secreted protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7F1_IXOSC Length = 421 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 P PPPPPPPPPPPPPPPPPP+ +EP Sbjct: 158 PSPPPPPPPPPPPPPPPPPPKKKTEP 183 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/30 (70%), Positives = 21/30 (70%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 PP PPPPPPPPPPPPPPPPP P G Sbjct: 157 PPSPPPPPPPPPPPPPPPPPPKKKTEPDEG 186 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPP PPPPPPPPPPPPPPPP Sbjct: 156 PPPSPPPPPPPPPPPPPPPP 175 [234][TOP] >UniRef100_B4KTK9 GI20587 n=1 Tax=Drosophila mojavensis RepID=B4KTK9_DROMO Length = 529 Score = 59.7 bits (143), Expect = 1e-07 Identities = 32/77 (41%), Positives = 43/77 (55%), Gaps = 3/77 (3%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSR--AGGRDGW*QVRTVLSGPPRVPRGK- 175 PPPPPPPPPPPPPPPPPPP + ++ G + + + + + PP PR + Sbjct: 350 PPPPPPPPPPPPPPPPPPPSQTTAKLSSDGAVKPISPSLETPLNIPESRAPPPDDPRSEL 409 Query: 174 AAAPRRDGGGRLGRVQS 124 AA R GG GR++S Sbjct: 410 MAAIRNAGGAHGGRLRS 426 [235][TOP] >UniRef100_B4I348 GM18116 n=1 Tax=Drosophila sechellia RepID=B4I348_DROSE Length = 1519 Score = 59.7 bits (143), Expect = 1e-07 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 7/34 (20%) Frame = -3 Query: 345 PPPPPPPPPPP-------PPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPPP GS PP Sbjct: 962 PPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 995 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/69 (43%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Frame = -3 Query: 345 PPPPPPPPPP------PPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVP 184 PPPPPPPPPP PPPPPPPPP G + PP GG SG P P Sbjct: 964 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIQGG-----------SGIPPPP 1012 Query: 183 RGKAAAPRR 157 A+P + Sbjct: 1013 PPLGASPSK 1021 [236][TOP] >UniRef100_B4GFR0 GL21580 n=1 Tax=Drosophila persimilis RepID=B4GFR0_DROPE Length = 560 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPPPPP S PP Sbjct: 527 PPPRPPPPPPPPPPPPPPPPSTPSAPP 553 [237][TOP] >UniRef100_A2DM28 Diaphanous, putative n=1 Tax=Trichomonas vaginalis G3 RepID=A2DM28_TRIVA Length = 620 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/74 (45%), Positives = 37/74 (50%), Gaps = 8/74 (10%) Frame = -3 Query: 345 PPPP----PPPPPPP----PPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPR 190 PPPP PPPPPPP PPPPPPPPP+GG+ PP +RA P Sbjct: 525 PPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAP------------PPPAG 572 Query: 189 VPRGKAAAPRRDGG 148 P AAAP GG Sbjct: 573 TPPPPAAAPAPAGG 586 [238][TOP] >UniRef100_C5GLX8 Cytokinesis protein sepA n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GLX8_AJEDR Length = 1750 Score = 59.7 bits (143), Expect = 1e-07 Identities = 34/84 (40%), Positives = 38/84 (45%), Gaps = 5/84 (5%) Frame = -3 Query: 345 PPPPPPPPPPP----PPPPPPPPP-RGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPR 181 PPPPPPPPPPP PPPPPPPPP GG PP GG PP P Sbjct: 1030 PPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGG------------PPPPPPP 1077 Query: 180 GKAAAPRRDGGGRLGRVQSVWVVA 109 PR G +G + ++ A Sbjct: 1078 PPVNDPRPGAGSSIGSWKKTYLPA 1101 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/71 (45%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = -3 Query: 345 PPPPPPP----PPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRG 178 PPPPPPP PPPPPPPPPPPP G PP AGG + GPP P Sbjct: 1018 PPPPPPPGIGGPPPPPPPPPPPPGVGAPPPPPPPPPGAGGPPPPPPPPPGVGGPPPPPPP 1077 Query: 177 KAAAPRRDGGG 145 R G G Sbjct: 1078 PPVNDPRPGAG 1088 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPPPPP----PPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPPP G+ PP Sbjct: 988 PPPPPPPPPPPGVGLPPPPPPPPPGVGAPPP 1018 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPP----PPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPPP G+ PP Sbjct: 1017 PPPPPPPPGIGGPPPPPPPPPPPPGVGAPPP 1047 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 6/33 (18%) Frame = -3 Query: 345 PPPPPPPPP------PPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPPP G PP Sbjct: 973 PPPPPPPPPAVGGPLPPPPPPPPPPPGVGLPPP 1005 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/31 (70%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Frame = -3 Query: 345 PPPPPPPPPP----PPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP G PP Sbjct: 989 PPPPPPPPPPGVGLPPPPPPPPPGVGAPPPP 1019 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 4/30 (13%) Frame = -3 Query: 342 PPPPPPPPP----PPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPP GG PP Sbjct: 1003 PPPPPPPPPGVGAPPPPPPPPPGIGGPPPP 1032 [239][TOP] >UniRef100_C1H5C0 Decaprenyl-diphosphate synthase subunit 1 n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1H5C0_PARBA Length = 533 Score = 59.7 bits (143), Expect = 1e-07 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEP 268 PPPPPPPPPPPPPPPPPPPP +P Sbjct: 117 PPPPPPPPPPPPPPPPPPPPPPSLQP 142 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPPPPPPPPPPPPPPPPPP S P + Sbjct: 116 PPPPPPPPPPPPPPPPPPPPPPPSLQPSQ 144 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP S+ P Sbjct: 120 PPPPPPPPPPPPPPPPPPPSLQPSQTP 146 [240][TOP] >UniRef100_B2AYQ6 Predicted CDS Pa_1_11890 n=1 Tax=Podospora anserina RepID=B2AYQ6_PODAN Length = 444 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 8/43 (18%) Frame = -3 Query: 345 PPPPPPPPPP------PPPPPPPPPPRGGSEP--PGRGLSRAG 241 PPPPPPPPPP PPPPPPPPPP GG+ P P GL G Sbjct: 2 PPPPPPPPPPPPGFGGPPPPPPPPPPGGGALPARPPAGLPNRG 44 [241][TOP] >UniRef100_A1CM40 Cytokinesis protein SepA/Bni1 n=1 Tax=Aspergillus clavatus RepID=A1CM40_ASPCL Length = 1813 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP G PP Sbjct: 1022 PPPPPPPPPPPPPPPPPPPGAIGVPPP 1048 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/70 (45%), Positives = 34/70 (48%), Gaps = 9/70 (12%) Frame = -3 Query: 345 PPPPPPPPP-------PPPPPPPPPPP--RGGSEPPGRGLSRAGGRDGW*QVRTVLSGPP 193 PPPPPPPPP PPPPPPPPPPP GG PP G G + PP Sbjct: 1050 PPPPPPPPPGGKGMGVPPPPPPPPPPPGFGGGMPPPPPPPPPPGFGGG-------MPPPP 1102 Query: 192 RVPRGKAAAP 163 P G+ AP Sbjct: 1103 PPPPGRFGAP 1112 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/33 (69%), Positives = 23/33 (69%), Gaps = 5/33 (15%) Frame = -3 Query: 345 PPPPPPPPPPPPPP-----PPPPPPRGGSEPPG 262 PPPPPPPPPPPPPP PPPPPP PPG Sbjct: 1027 PPPPPPPPPPPPPPGAIGVPPPPPPPPPPPPPG 1059 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/45 (57%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = -3 Query: 342 PPPPPPPPPP------PPPPPPPPPRGGSEPPGRGLSRAGGRDGW 226 PPPPPPPPPP PPPPPPPP R G+ PP GG GW Sbjct: 1083 PPPPPPPPPPGFGGGMPPPPPPPPGRFGAPPPP---PPPGGAGGW 1124 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP G PP Sbjct: 1023 PPPPPPPPPPPPPPPPPPGAIGVPPPP 1049 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/28 (78%), Positives = 22/28 (78%), Gaps = 5/28 (17%) Frame = -3 Query: 345 PPPPPPPP-----PPPPPPPPPPPPRGG 277 PPPPPPPP PPPPPPPPPPPP GG Sbjct: 1033 PPPPPPPPGAIGVPPPPPPPPPPPPPGG 1060 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPG 262 P PPPPPPPPPPPPPPPPP PPG Sbjct: 1020 PAPPPPPPPPPPPPPPPPP-----PPG 1041 [242][TOP] >UniRef100_Q86UP3 Zinc finger homeobox protein 4 n=1 Tax=Homo sapiens RepID=ZFHX4_HUMAN Length = 3567 Score = 59.7 bits (143), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP S PP Sbjct: 1994 PPTPPPPPPPPPPPPPPPPPPPPSAPP 2020 Score = 55.5 bits (132), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPP PPPPPPPPPPPPPPPP Sbjct: 1993 PPPTPPPPPPPPPPPPPPPP 2012 [243][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 59.7 bits (143), Expect = 1e-07 Identities = 42/114 (36%), Positives = 51/114 (44%), Gaps = 2/114 (1%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAAA 166 PPP PPPPPPPPPPPPPPPP PP + S + + PP P AA Sbjct: 274 PPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPS----------PPVPPPPSPPSVLPAA 323 Query: 165 PRRDGGGRLGRVQS--VWVVAVRARHRARGVAGGVAGRVA*DVADAHGAAADVN 10 + R S W V V A A ++GG RV ++ + AAA N Sbjct: 324 TGFPFCECVSRSPSSYPWRVTV-ANVSAVTISGGAGERVCLKISVDNAAAATCN 376 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPP PP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPP PP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPP PPPPP PP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPPPPPP PP Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPP PPPPPPPP PP Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 57.8 bits (138), Expect = 4e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 57.8 bits (138), Expect = 4e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGR 259 PPPP PPPPPPPPPPPPPPP S P R Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPPR 301 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP P PPPPPPPPPPPPPP S PP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPP 280 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/30 (73%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 345 PPPP---PPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPPPPP PP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPP PP Sbjct: 258 PSPPPPPPPPPPPPPPPPPSPPPPPPP 284 [244][TOP] >UniRef100_Q61060 Forkhead box protein D3 n=1 Tax=Mus musculus RepID=FOXD3_MOUSE Length = 465 Score = 59.7 bits (143), Expect = 1e-07 Identities = 49/129 (37%), Positives = 55/129 (42%), Gaps = 16/129 (12%) Frame = +2 Query: 8 PLTSAAAPWASATSYA-----TRPATPPATPR--ARWRARTATTQTDCTRPSLPPP-SRR 163 P +AAA A+A Y P PPA P + R A PSL + Sbjct: 274 PAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPSLQLQLNTL 333 Query: 164 GAAALPRGTRGGPDRTVRTCHHPSRPPA--------RDNPRPGGSLPPRGGGGGGGGGGG 319 GAAA GT G T PS P+ + PGGS GGGG GGG GG Sbjct: 334 GAAAAAAGTAGAAGTTSLIKSEPSARPSFSIENIIGAGSAAPGGSA---GGGGSGGGAGG 390 Query: 320 GGGGGGGGG 346 GGG GGGGG Sbjct: 391 GGGSGGGGG 399 [245][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPPP PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPCPPPCPP 289 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPP 281 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPPPPPPPPPPPPPPPPP PP Sbjct: 260 PCPPPPPPPPPPPPPPPPPPPPPCPPP 286 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPPP PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPCPPPCPPP 290 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPPP PP Sbjct: 295 PPPPPPPPPCPPPPPPPPPPPPPCPPP 321 Score = 57.0 bits (136), Expect = 6e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPP PPPPPP PP Sbjct: 305 PPPPPPPPPPPPPCPPPPPPPPPCPPP 331 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPPP P PP Sbjct: 265 PPPPPPPPPPPPPPPPPPCPPPCPPPP 291 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPPP PP PP Sbjct: 266 PPPPPPPPPPPPPPPPPCPPPCPPPPP 292 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPPPPPP PPP PP Sbjct: 267 PPPPPPPPPPPPPPPPCPPPCPPPPPP 293 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPP PPPPPPPPPPP PP Sbjct: 296 PPPPPPPPCPPPPPPPPPPPPPCPPPP 322 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPP PPPPPPPPPPPP PP Sbjct: 297 PPPPPPPCPPPPPPPPPPPPPCPPPPP 323 Score = 56.6 bits (135), Expect = 8e-07 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPPPPPP PP Sbjct: 298 PPPPPPCPPPPPPPPPPPPPCPPPPPP 324 Score = 55.8 bits (133), Expect = 1e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPPPPPPPPPPPPPPPP PP Sbjct: 259 PPCPPPPPPPPPPPPPPPPPPPPPCPP 285 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPP PPPPPPPPP PP Sbjct: 308 PPPPPPPPPPCPPPPPPPPPCPPPCPP 334 Score = 54.7 bits (130), Expect = 3e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPP PPPPPPPPPPPPPPPP Sbjct: 258 PPPCPPPPPPPPPPPPPPPP 277 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPP PPPPPPPPPPPP PP Sbjct: 254 PPPCPPPCPPPPPPPPPPPPPPPPPPP 280 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PP PPP PPPPPPPPPPPPP PP Sbjct: 255 PPCPPPCPPPPPPPPPPPPPPPPPPPP 281 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 P PPP PPPPPPPPPPPPPP PP Sbjct: 256 PCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPPPPP PPP PPP PP Sbjct: 271 PPPPPPPPPPPPCPPPCPPPPPPCPPP 297 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPP PPPPPPPPP PPP PP Sbjct: 288 PPPPPPCPPPPPPPPPCPPPPPPPPPP 314 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPP PPPP PP Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPPP 315 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPP PPPPP PP Sbjct: 290 PPPPCPPPPPPPPPCPPPPPPPPPPPP 316 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPP PPPPPP PP Sbjct: 291 PPPCPPPPPPPPPCPPPPPPPPPPPPP 317 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPP PPPPPPPPPPPPP PP Sbjct: 299 PPPPPCPPPPPPPPPPPPPCPPPPPPP 325 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPP PPPPPPPPPPPPP P PP Sbjct: 300 PPPPCPPPPPPPPPPPPPCPPPPPPPP 326 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPP PPPPPPPPPPPPP PP PP Sbjct: 301 PPPCPPPPPPPPPPPPPCPPPPPPPPP 327 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPP 265 PPPPPPPPP PPPPPPPPP PP Sbjct: 309 PPPPPPPPPCPPPPPPPPPCPPPCPPP 335 [246][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGG 277 PPPPPPPPPPPPPPPPPPPP G Sbjct: 262 PPPPPPPPPPPPPPPPPPPPLPG 284 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPP 280 Score = 55.1 bits (131), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PP PPPPPPPPPPPPPPPPP Sbjct: 258 PPMPPPPPPPPPPPPPPPPP 277 Score = 55.1 bits (131), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 259 PMPPPPPPPPPPPPPPPPPP 278 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PP PPPPPPPPPPPPPPPP PG Sbjct: 258 PPMPPPPPPPPPPPPPPPPPPPPPLPG 284 [247][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 59.3 bits (142), Expect = 1e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGG 277 PPPPPPPPPPPPPPPPPPPP G Sbjct: 550 PPPPPPPPPPPPPPPPPPPPLPG 572 Score = 58.5 bits (140), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PPPPPPPPPPPPPPPPPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPP 568 Score = 55.1 bits (131), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 PP PPPPPPPPPPPPPPPPP Sbjct: 546 PPMPPPPPPPPPPPPPPPPP 565 Score = 55.1 bits (131), Expect = 2e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPP 286 P PPPPPPPPPPPPPPPPPP Sbjct: 547 PMPPPPPPPPPPPPPPPPPP 566 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPG 262 PP PPPPPPPPPPPPPPPP PG Sbjct: 546 PPMPPPPPPPPPPPPPPPPPPPPPLPG 572 [248][TOP] >UniRef100_UPI000175F960 PREDICTED: similar to WAS/WASL interacting protein family, member 1 n=1 Tax=Danio rerio RepID=UPI000175F960 Length = 485 Score = 59.3 bits (142), Expect = 1e-07 Identities = 36/95 (37%), Positives = 45/95 (47%) Frame = +2 Query: 62 PATPPATPRARWRARTATTQTDCTRPSLPPPSRRGAAALPRGTRGGPDRTVRTCHHPSRP 241 P PP P + +Q + +P L ++G AL G R + + Sbjct: 4 PPPPPPPPPPTF------SQANTEKPVLNRSEQQGRNALLSDISKGA-RLKKAVTNDRSA 56 Query: 242 PARDNPRPGGSLPPRGGGGGGGGGGGGGGGGGGGG 346 P D P+ GG GGGGGGGGG GGGGGGGGGG Sbjct: 57 PVLDKPKGGGGPGGGGGGGGGGGGFGGGGGGGGGG 91 [249][TOP] >UniRef100_UPI00015531A8 PREDICTED: similar to Glyceraldehyde-3-phosphate dehydrogenase n=1 Tax=Mus musculus RepID=UPI00015531A8 Length = 497 Score = 59.3 bits (142), Expect = 1e-07 Identities = 33/95 (34%), Positives = 47/95 (49%), Gaps = 7/95 (7%) Frame = -3 Query: 345 PPPPPPPPPPPPPPPPPPPPRGGSEPPGRGLSRAGGRDGW*QVRTVLSGPPRVPRGKAA- 169 PPPPPPPPPPPPP PPPPPP +E L G+ V T L+ RG+ Sbjct: 56 PPPPPPPPPPPPPTPPPPPPADTTENLQISLQLGKGK----AVGTCLTHEFEKGRGEGGR 111 Query: 168 ------APRRDGGGRLGRVQSVWVVAVRARHRARG 82 +R G++ V + ++ ++ RH+ +G Sbjct: 112 GGYGPWLQQRSTSGQVVVVVVIMILYLKDRHKVKG 146 [250][TOP] >UniRef100_UPI0001552F36 PREDICTED: similar to SH3 domain binding protein n=1 Tax=Mus musculus RepID=UPI0001552F36 Length = 455 Score = 59.3 bits (142), Expect = 1e-07 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = -3 Query: 342 PPPPPPPPPPPPPPPPPPPRGGSEPPGRG 256 P PPPPPPPPPPPPPPPPP G PP G Sbjct: 2 PVPPPPPPPPPPPPPPPPPLGAPPPPPLG 30 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = -3 Query: 345 PPPPPPPPPPPPPPP-----PPPPPRGGSEPP 265 PPPPPPPPPPPPPPP PPPPP G PP Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPP 35