[UP]
[1][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 61.6 bits (148), Expect = 3e-08 Identities = 33/80 (41%), Positives = 36/80 (45%), Gaps = 7/80 (8%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP-------AVASRAGRDYCSSH*RWP 69 +PPP P PP P PP PPPPPPPPPP PPP + R C H P Sbjct: 76 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCEKCRRGPCCHHFCMP 135 Query: 68 VRERPSTGGPPCPETCRRGQ 9 T P CP CRR + Sbjct: 136 ------TVPPYCPVPCRRSE 149 [2][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/61 (49%), Positives = 32/61 (52%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 PA+ +T PPP P PP P PP PPPPPPPPPP PPP R Y H W Sbjct: 69 PAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRPRPYY--GHGWW 126 Query: 71 P 69 P Sbjct: 127 P 127 [3][TOP] >UniRef100_C7J5E6 Os08g0345400 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=C7J5E6_ORYSJ Length = 185 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/70 (42%), Positives = 33/70 (47%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PP +PS PP P P PPPPPPPPPP PP A+R H P + P Sbjct: 8 PPASLSPSTKPPPPPPPCSPPPPPPPPPPSCSPPPAAARPSSTSPGRHALLPPQGSPPRP 67 Query: 44 GPPCPETCRR 15 PP PE R Sbjct: 68 TPPEPEPVAR 77 [4][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 60.5 bits (145), Expect = 6e-08 Identities = 31/68 (45%), Positives = 32/68 (47%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP AP PP P PP PPPPPPPPPP PPP V +C P P Sbjct: 132 PPPMCAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVV-------FCPPPPPCPPPPAPCPP 184 Query: 44 GPPCPETC 21 PP P C Sbjct: 185 PPPPPPMC 192 [5][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/65 (44%), Positives = 32/65 (49%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P P PPPPPPPPPP PPP S + + P R+RP Sbjct: 250 PPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPPPELPPAQPVTPARKRPPPP 309 Query: 44 GPPCP 30 PP P Sbjct: 310 APPPP 314 [6][TOP] >UniRef100_UPI0000F53460 enabled homolog isoform 2 n=2 Tax=Mus musculus RepID=UPI0000F53460 Length = 789 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/47 (53%), Positives = 28/47 (59%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSS 84 PPP P+ PP PP PPPPPPPPPP LPPP + A +C S Sbjct: 418 PPPTSGPAAPPP----PPPPPPPPPPPPPPLPPPPLPPLASLSHCGS 460 [7][TOP] >UniRef100_UPI000047625B enabled homolog isoform 3 n=1 Tax=Mus musculus RepID=UPI000047625B Length = 785 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/47 (53%), Positives = 28/47 (59%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSS 84 PPP P+ PP PP PPPPPPPPPP LPPP + A +C S Sbjct: 414 PPPTSGPAAPPP----PPPPPPPPPPPPPPLPPPPLPPLASLSHCGS 456 [8][TOP] >UniRef100_UPI00015DF6E5 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E5 Length = 391 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/47 (53%), Positives = 28/47 (59%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSS 84 PPP P+ PP PP PPPPPPPPPP LPPP + A +C S Sbjct: 21 PPPTSGPAAPPP----PPPPPPPPPPPPPPLPPPPLPPLASLSHCGS 63 [9][TOP] >UniRef100_UPI00015DF6E3 enabled homolog (Drosophila) n=1 Tax=Mus musculus RepID=UPI00015DF6E3 Length = 701 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/47 (53%), Positives = 28/47 (59%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSS 84 PPP P+ PP PP PPPPPPPPPP LPPP + A +C S Sbjct: 330 PPPTSGPAAPPP----PPPPPPPPPPPPPPLPPPPLPPLASLSHCGS 372 [10][TOP] >UniRef100_UPI000056479E enabled homolog isoform 1 n=1 Tax=Mus musculus RepID=UPI000056479E Length = 804 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/47 (53%), Positives = 28/47 (59%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSS 84 PPP P+ PP PP PPPPPPPPPP LPPP + A +C S Sbjct: 433 PPPTSGPAAPPP----PPPPPPPPPPPPPPLPPPPLPPLASLSHCGS 475 [11][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/68 (42%), Positives = 30/68 (44%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP P P Sbjct: 361 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP--------------PPPPPPPPP 406 Query: 44 GPPCPETC 21 PPCP +C Sbjct: 407 PPPCPASC 414 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/45 (51%), Positives = 24/45 (53%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYC 90 PPP P PP P PP PPPPPPPPPP PPP + C Sbjct: 375 PPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSC 419 [12][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -2 Query: 245 LTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPP-PPPPELPPPA 120 LT TG PPP P PP P PP PPPPPP PPPP PPPA Sbjct: 1402 LTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPA 1444 [13][TOP] >UniRef100_A7XYI3 JXC1 n=1 Tax=Monodelphis domestica RepID=A7XYI3_MONDO Length = 918 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/40 (67%), Positives = 28/40 (70%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 VPPP L PPLP PP PPPPPPPPPP PPPA AS+ Sbjct: 764 VPPP----PLLPPLPLPPPPPPPPPPPPPPPPPPPAPASQ 799 [14][TOP] >UniRef100_C0NIM8 Putative uncharacterized protein n=1 Tax=Ajellomyces capsulatus G186AR RepID=C0NIM8_AJECG Length = 281 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/73 (41%), Positives = 33/73 (45%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 P L+ + PPP +P P P PP PPPPPPPPPP PP S Sbjct: 114 PPLSYSPPPPPPPPSPPSPSPSPPPPPPPPPPPPPPPPPSPPAPAPSNPST--------- 164 Query: 71 PVRERPSTGGPPC 33 P PS GG PC Sbjct: 165 PPTSPPSGGGGPC 177 [15][TOP] >UniRef100_UPI000186A01D hypothetical protein BRAFLDRAFT_106142 n=1 Tax=Branchiostoma floridae RepID=UPI000186A01D Length = 550 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 +PPP P PPLP PP+PPPPPPPPPP PPP Sbjct: 95 LPPPLANPPSPPPLPTPPPYPPPPPPPPPPPPPPP 129 [16][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P L PP P PP PPPPPPPPPP PPP Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 57.4 bits (137), Expect = 5e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PPLP PP PPPPPPPPPP PPP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = -2 Query: 221 PPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PP PS PPLP PP PPPPPPPPPP PPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 P L PPP P PP P PP PPPPPPPPPP PPP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/33 (66%), Positives = 22/33 (66%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPP 126 PPP P PP P PP PPPPPPPPPP LPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P L P P PP PPPPPPPPPP PPP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P PP PPPPPPPPPP PPP Sbjct: 671 PPPPLPPSPPPPPP--PPPPPPPPPPPPPPPPPP 702 [17][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 PPP P PP P PP PPPPPPPPPP LPPP S+ Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQ 110 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 P L PPP P PP P PP PPPPPPPPPP PPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 [18][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 57.4 bits (137), Expect = 5e-07 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGR 99 PPP P PP P PP PPPPPPPPPP PPP + + GR Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGR 45 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/40 (60%), Positives = 24/40 (60%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRA 105 PPP P PP P PP PPPPPPPPPP PPP RA Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRA 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 [19][TOP] >UniRef100_A2ZIJ8 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2ZIJ8_ORYSI Length = 994 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = +1 Query: 124 GGGSSGGGGGGGGGGCGGRYGSGGVRLGAR----PGGGTAPVTVKAG 252 GGG GGGGGGGGGG GGR G GG G R G GT PVT+ G Sbjct: 4 GGGGGGGGGGGGGGGGGGRGGRGGTLAGTRGRVMTGAGTPPVTIGLG 50 [20][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP LPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 P + V PPP P PP P PP PPPPPPPPPP PPP Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -2 Query: 236 TGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 T V PP + + PP P PP PPPPPPPPPP PPP Sbjct: 221 TAVVVPPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPP 258 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP P PPPPPPPP LPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 [21][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/46 (54%), Positives = 25/46 (54%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCS 87 PPP P PP P PP PPPPPPPPPP PPP D CS Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQCS 309 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P PP PPP PPPPPP PPP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPP 263 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P PP PPPPPPPPPP PP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPP 126 PPP +P +PP P PP PPPPPPPPPP PP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 [22][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P L PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPP 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 +PPP P PP P PP PPPPPPPPPP PPP Sbjct: 31 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 26 PPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPHCPPPPPPPPPLPPPPPPPPPPPPPPPPPPP 50 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 [23][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/42 (57%), Positives = 26/42 (61%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGR 99 PPP P PP P PP PPPPPPPPPP PPP + +A R Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQR 71 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/83 (36%), Positives = 33/83 (39%) Frame = -2 Query: 263 FQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSS 84 F P + PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 FLDTPVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP------------ 52 Query: 83 H*RWPVRERPSTGGPPCPETCRR 15 P P PPC + +R Sbjct: 53 ----PPPPPPPPPPPPCSQQAQR 71 [24][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP LPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 102 [25][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/47 (55%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPE--LPPPAV 117 P +TG PPP P PP P PP PPPPPPPPPP LPPP + Sbjct: 261 PFQEITGPGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFILPPPFI 307 [26][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/40 (60%), Positives = 25/40 (62%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRA 105 PPP +P PP P PP PPPPPPPPPP PPP V A Sbjct: 168 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNA 207 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P PP PPPPPPPPPP PPP Sbjct: 166 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 161 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 194 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGR 99 PPP P PP P PP PPPPPPPPPP PPP R R Sbjct: 169 PPPPSPPPPPPPPP--PPPPPPPPPPPPPPPPPPPPVDRNAR 208 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 P P PS PP P PP PPPPPPPPPP PPP Sbjct: 158 PSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPP PPPPP PPP Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPP 155 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P +PP P PP PPPPPPPPPP PPP Sbjct: 156 PPPSPPPPPSPPPP-PPPSPPPPPPPPPPPPPPP 188 [27][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -2 Query: 254 HPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 HP PPP P PP P PP PPPPPPPPPP PPP Sbjct: 239 HPPAPPPCPPPPPPCPPPCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/68 (42%), Positives = 29/68 (42%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP P P Sbjct: 289 PPPPPCPPPPPPPPPCPPPPPPPPPPPPPCPPPPP----------------PPPPCPPPC 332 Query: 44 GPPCPETC 21 PPCP C Sbjct: 333 PPPCPPPC 340 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/68 (42%), Positives = 29/68 (42%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP P PPPPPPPP PPP C P P Sbjct: 275 PPPPPPPPCPPPCP-PPPPPCPPPPPPPPPCPPPPPPPPPPPPPCP-----PPPPPPPPC 328 Query: 44 GPPCPETC 21 PPCP C Sbjct: 329 PPPCPPPC 336 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/64 (42%), Positives = 27/64 (42%) Frame = -2 Query: 221 PPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTGG 42 PP P PP P PP PPPPPPPPPP PPP P P Sbjct: 254 PPPCPPPCPPPPPPPPPPPPPPPPPPPPPCPPPCPPPP------------PPCPPPPPPP 301 Query: 41 PPCP 30 PPCP Sbjct: 302 PPCP 305 [28][TOP] >UniRef100_UPI0000E1F761 PREDICTED: formin-like 2 isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E1F761 Length = 1087 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/78 (39%), Positives = 35/78 (44%), Gaps = 11/78 (14%) Frame = -2 Query: 224 PPPGRAPS-----------LTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH* 78 PPP PS +TPP+P PP PPPPPPPPPP PPP + A + Sbjct: 529 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPA--- 585 Query: 77 RWPVRERPSTGGPPCPET 24 P P PP P T Sbjct: 586 --PPLAPPLPSAPPLPGT 601 [29][TOP] >UniRef100_UPI0000E1F760 PREDICTED: formin-like 2 isoform 8 n=1 Tax=Pan troglodytes RepID=UPI0000E1F760 Length = 1093 Score = 56.6 bits (135), Expect = 8e-07 Identities = 31/78 (39%), Positives = 35/78 (44%), Gaps = 11/78 (14%) Frame = -2 Query: 224 PPPGRAPS-----------LTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH* 78 PPP PS +TPP+P PP PPPPPPPPPP PPP + A + Sbjct: 529 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPA--- 585 Query: 77 RWPVRERPSTGGPPCPET 24 P P PP P T Sbjct: 586 --PPLAPPLPSAPPLPGT 601 [30][TOP] >UniRef100_UPI0001951234 Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein). n=1 Tax=Canis lupus familiaris RepID=UPI0001951234 Length = 1045 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/53 (52%), Positives = 30/53 (56%), Gaps = 9/53 (16%) Frame = -2 Query: 236 TGAVPPPGRAPSL---------TPPLP*RPPHPPPPPPPPPPELPPPAVASRA 105 T VPP P L +PPLP PPHPPPPPPPPPP PPP +RA Sbjct: 655 TSLVPPLSPQPKLVTPHTASQPSPPLP--PPHPPPPPPPPPPPPPPPPPPARA 705 [31][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P PP PPPPPPPPPP PPP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 PPP PS PP P PP PPPPPPPPPP P P S Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPS 542 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -2 Query: 233 GAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 G PPP P PP P PP PPPPPPP PP PPP Sbjct: 483 GVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 [32][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/48 (56%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Frame = -2 Query: 248 ALTVTGAVPPPGRAPSLTPP------LP*RPPHPPPPPPPPPPELPPP 123 AL T A PPPG P TPP P P HPPPPPPPPPP PP Sbjct: 33 ALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPP 80 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -2 Query: 221 PPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PP +P PP P PP PPPPPPPPPP PPP Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPP 114 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P PP PP PPPPPPP PPP Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPP 136 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP+PPPPPPPPPP PP Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPP 153 [33][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = -2 Query: 257 SHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 S P + + PP +PS PP P PP PPPPPPPPPP PPP+ Sbjct: 220 SSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPS 265 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/72 (40%), Positives = 34/72 (47%), Gaps = 12/72 (16%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPP-----PAVASRAGRDYC-------SS 84 +PPP P PP P PP PPPPPPPPPP PP P ++ C + Sbjct: 246 MPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSPCDCLSPLIDN 305 Query: 83 H*RWPVRERPST 48 H RW R + ST Sbjct: 306 HSRWAFRFQEST 317 [34][TOP] >UniRef100_C1H633 Predicted protein n=1 Tax=Paracoccidioides brasiliensis Pb01 RepID=C1H633_PARBA Length = 680 Score = 56.6 bits (135), Expect = 8e-07 Identities = 34/73 (46%), Positives = 37/73 (50%), Gaps = 8/73 (10%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPH----PPPPPPPP----PPELPPPAVASRAGRDYCSSH*RWP 69 PPPG APS P P PP PPPPPPPP PP PPPA + +SH P Sbjct: 499 PPPGPAPSTAVPPPPPPPPASGLPPPPPPPPSGSVPPPPPPPASS--------ASHSPPP 550 Query: 68 VRERPSTGGPPCP 30 PS+G PP P Sbjct: 551 PLSEPSSGPPPPP 563 [35][TOP] >UniRef100_Q03173-5 Isoform 4 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-5 Length = 787 Score = 56.6 bits (135), Expect = 8e-07 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 14/87 (16%) Frame = -2 Query: 242 TVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWP-- 69 +VT V PP P+ P P PP PPPPPPPPPP LPPP + A +C S P Sbjct: 411 SVTYPVSPP---PTSGPAAP--PPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPG 465 Query: 68 ------------VRERPSTGGPPCPET 24 V PS G P ET Sbjct: 466 TPLASTPSSKPSVLPSPSAGAPASAET 492 [36][TOP] >UniRef100_Q03173-2 Isoform 1 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-2 Length = 390 Score = 56.6 bits (135), Expect = 8e-07 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 14/87 (16%) Frame = -2 Query: 242 TVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWP-- 69 +VT V PP P+ P P PP PPPPPPPPPP LPPP + A +C S P Sbjct: 14 SVTYPVSPP---PTSGPAAP--PPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPG 68 Query: 68 ------------VRERPSTGGPPCPET 24 V PS G P ET Sbjct: 69 TPLASTPSSKPSVLPSPSAGAPASAET 95 [37][TOP] >UniRef100_Q03173-4 Isoform 3 of Protein enabled homolog n=1 Tax=Mus musculus RepID=Q03173-4 Length = 783 Score = 56.6 bits (135), Expect = 8e-07 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 14/87 (16%) Frame = -2 Query: 242 TVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWP-- 69 +VT V PP P+ P P PP PPPPPPPPPP LPPP + A +C S P Sbjct: 407 SVTYPVSPP---PTSGPAAP--PPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPG 461 Query: 68 ------------VRERPSTGGPPCPET 24 V PS G P ET Sbjct: 462 TPLASTPSSKPSVLPSPSAGAPASAET 488 [38][TOP] >UniRef100_Q03173 Protein enabled homolog n=1 Tax=Mus musculus RepID=ENAH_MOUSE Length = 802 Score = 56.6 bits (135), Expect = 8e-07 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 14/87 (16%) Frame = -2 Query: 242 TVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWP-- 69 +VT V PP P+ P P PP PPPPPPPPPP LPPP + A +C S P Sbjct: 426 SVTYPVSPP---PTSGPAAP--PPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPG 480 Query: 68 ------------VRERPSTGGPPCPET 24 V PS G P ET Sbjct: 481 TPLASTPSSKPSVLPSPSAGAPASAET 507 [39][TOP] >UniRef100_UPI00017F09BE PREDICTED: similar to KIAA1902 protein, partial n=1 Tax=Sus scrofa RepID=UPI00017F09BE Length = 734 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/76 (38%), Positives = 35/76 (46%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 P L ++ P + +TPP+P PP PPPPPPPPPP PPP A Sbjct: 239 PPLPLSSDAPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAADTVPAP----- 293 Query: 71 PVRERPSTGGPPCPET 24 P+ P PP P T Sbjct: 294 PLPPPPPPSAPPLPGT 309 [40][TOP] >UniRef100_UPI00017974C7 PREDICTED: similar to KIAA1902 protein n=1 Tax=Equus caballus RepID=UPI00017974C7 Length = 1089 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/76 (39%), Positives = 34/76 (44%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 PAL + P + TPP+P PP PPPPPPPPPP PPP A Sbjct: 527 PALPPSSDTPEAVQNGPATPPMPPPPPPPPPPPPPPPPPPPPPLPGPAADTVPAP----- 581 Query: 71 PVRERPSTGGPPCPET 24 P+ P PP P T Sbjct: 582 PLPPPPPPSAPPLPGT 597 [41][TOP] >UniRef100_UPI0000E1F767 PREDICTED: formin-like 2 isoform 3 n=1 Tax=Pan troglodytes RepID=UPI0000E1F767 Length = 994 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/60 (45%), Positives = 31/60 (51%) Frame = -2 Query: 203 SLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTGGPPCPET 24 S+TPP+P PP PPPPPPPPPP PPP + A + P P PP P T Sbjct: 448 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPA-----PPLAPPLPSAPPLPGT 502 [42][TOP] >UniRef100_UPI0000E1F766 PREDICTED: formin-like 2 isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E1F766 Length = 1026 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/60 (45%), Positives = 31/60 (51%) Frame = -2 Query: 203 SLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTGGPPCPET 24 S+TPP+P PP PPPPPPPPPP PPP + A + P P PP P T Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPA-----PPLAPPLPSAPPLPGT 553 [43][TOP] >UniRef100_UPI0000E1F765 PREDICTED: formin-like 2 isoform 7 n=1 Tax=Pan troglodytes RepID=UPI0000E1F765 Length = 1045 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/60 (45%), Positives = 31/60 (51%) Frame = -2 Query: 203 SLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTGGPPCPET 24 S+TPP+P PP PPPPPPPPPP PPP + A + P P PP P T Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPA-----PPLAPPLPSAPPLPGT 553 [44][TOP] >UniRef100_UPI0000E1F763 PREDICTED: formin-like 2 isoform 4 n=1 Tax=Pan troglodytes RepID=UPI0000E1F763 Length = 1037 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/60 (45%), Positives = 31/60 (51%) Frame = -2 Query: 203 SLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTGGPPCPET 24 S+TPP+P PP PPPPPPPPPP PPP + A + P P PP P T Sbjct: 499 SVTPPMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPA-----PPLAPPLPSAPPLPGT 553 [45][TOP] >UniRef100_UPI00016E1896 UPI00016E1896 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E1896 Length = 695 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -2 Query: 233 GAVPPPGRAP--SLTPPLP*RPPHPPPPPPPPPPELPPPAVA 114 G PPP AP + PP P PP PPPPPPPPPP PPP A Sbjct: 600 GPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPA 641 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PA PPP P PP P PP PP PPPPPPP PPP Sbjct: 611 PAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPPPPPPAPPPP 653 [46][TOP] >UniRef100_Q6DD43 LOC446221 protein (Fragment) n=1 Tax=Xenopus laevis RepID=Q6DD43_XENLA Length = 512 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/76 (40%), Positives = 37/76 (48%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 P +++ A PP AP L PPLP P PPPPP PPPP PPP + S+A Sbjct: 280 PGSSLSSATTPP--APPLPPPLPPSGPAPPPPPGPPPPPGPPPPLHSQA----------- 326 Query: 71 PVRERPSTGGPPCPET 24 P P PP P + Sbjct: 327 PPLAPPPPPAPPLPSS 342 [47][TOP] >UniRef100_Q5ID03 Enabled protein n=1 Tax=Xenopus laevis RepID=Q5ID03_XENLA Length = 535 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/76 (40%), Positives = 37/76 (48%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 P +++ A PP AP L PPLP P PPPPP PPPP PPP + S+A Sbjct: 280 PGSSLSSATTPP--APPLPPPLPPSGPAPPPPPGPPPPPGPPPPLHSQA----------- 326 Query: 71 PVRERPSTGGPPCPET 24 P P PP P + Sbjct: 327 PPLAPPPPPAPPLPSS 342 [48][TOP] >UniRef100_Q4V859 LOC446221 protein n=1 Tax=Xenopus laevis RepID=Q4V859_XENLA Length = 535 Score = 56.2 bits (134), Expect = 1e-06 Identities = 31/76 (40%), Positives = 37/76 (48%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 P +++ A PP AP L PPLP P PPPPP PPPP PPP + S+A Sbjct: 280 PGSSLSSATTPP--APPLPPPLPPSGPAPPPPPGPPPPPGPPPPLHSQA----------- 326 Query: 71 PVRERPSTGGPPCPET 24 P P PP P + Sbjct: 327 PPLAPPPPPAPPLPSS 342 [49][TOP] >UniRef100_Q9LUI1 At3g22800 n=1 Tax=Arabidopsis thaliana RepID=Q9LUI1_ARATH Length = 470 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -2 Query: 272 CLDFQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 C F S+P + PP P PP P PP PPPPPPPPPP PPP V Sbjct: 359 CKSFSSYPIDCASFGCSPPSPPPPPPPPPP-PPPPPPPPPPPPPPPPPPPYV 409 [50][TOP] >UniRef100_C5XK05 Putative uncharacterized protein Sb03g034303 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XK05_SORBI Length = 115 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -2 Query: 248 ALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 A T +VPPP P PP P R P PPPPPPPPPP PPP Sbjct: 3 APTSGDSVPPPPPLPPPQPPRPSRHPAPPPPPPPPPPPPPPP 44 [51][TOP] >UniRef100_C5XBT9 Putative uncharacterized protein Sb02g005130 n=1 Tax=Sorghum bicolor RepID=C5XBT9_SORBI Length = 984 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -2 Query: 248 ALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 A T +VPPP P PP P R P PPPPPPPPPP PPP Sbjct: 3 APTPGDSVPPPPPLPPPQPPRPSRHPAPPPPPPPPPPPPPPP 44 [52][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = -2 Query: 272 CLDFQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 C+D Q L + PPP P PP P PP PPPPPPPPPP PPP Sbjct: 476 CIDVQ----LVFSHLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PPP P PP P PP PPPPPPPPPP PPP+ Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPS 530 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 [53][TOP] >UniRef100_Q5ASL5 Putative uncharacterized protein n=1 Tax=Emericella nidulans RepID=Q5ASL5_EMENI Length = 1186 Score = 56.2 bits (134), Expect = 1e-06 Identities = 38/94 (40%), Positives = 40/94 (42%), Gaps = 10/94 (10%) Frame = -2 Query: 257 SHPALTVTGAVPPPGRAP-SLTPPLP*RPPHP------PPPPPPPPPEL---PPPAVASR 108 + P TVTG PPP P S PP+P PP P PPPPPPPPP PPP Sbjct: 472 ARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPPPPPPPPGAGAPPPPPPPPG 531 Query: 107 AGRDYCSSH*RWPVRERPSTGGPPCPETCRRGQP 6 AG P P G PP P G P Sbjct: 532 AGAPP-------PPPPPPGAGAPPPPPPPGAGAP 558 [54][TOP] >UniRef100_C8VA31 Putative uncharacterized protein n=1 Tax=Aspergillus nidulans FGSC A4 RepID=C8VA31_EMENI Length = 657 Score = 56.2 bits (134), Expect = 1e-06 Identities = 38/94 (40%), Positives = 40/94 (42%), Gaps = 10/94 (10%) Frame = -2 Query: 257 SHPALTVTGAVPPPGRAP-SLTPPLP*RPPHP------PPPPPPPPPEL---PPPAVASR 108 + P TVTG PPP P S PP+P PP P PPPPPPPPP PPP Sbjct: 472 ARPTPTVTGPPPPPPPPPASSGPPMPPPPPPPAPGSSAPPPPPPPPPGAGAPPPPPPPPG 531 Query: 107 AGRDYCSSH*RWPVRERPSTGGPPCPETCRRGQP 6 AG P P G PP P G P Sbjct: 532 AGAPP-------PPPPPPGAGAPPPPPPPGAGAP 558 [55][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = -2 Query: 266 DFQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 +++ P + PPP P PP P PP PPPPPPPPPP PPP Sbjct: 840 NYEPAPMVCEEPTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 887 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/65 (43%), Positives = 28/65 (43%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP P P G Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP----------------PPPPPPPPG 963 Query: 44 GPPCP 30 PP P Sbjct: 964 APPPP 968 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 888 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 889 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 890 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 891 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 892 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 893 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 894 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 895 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 [56][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPPG+ P PP P P PPPPPPPPPP LPPP Sbjct: 1198 PPPGQPPRPAPPPP--SPPPPPPPPPPPPPLPPP 1229 [57][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 PPP P PP P PP PPPPPPPPPP PPP + S Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGS 54 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/61 (45%), Positives = 30/61 (49%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP + Y + P R TG Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQ---KPPRRHIAFTG 71 Query: 44 G 42 G Sbjct: 72 G 72 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 [58][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 55.8 bits (133), Expect = 1e-06 Identities = 31/67 (46%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PP V SR + +RE +G Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLSALFARPVPRDLREMVWSG 125 Query: 44 G-PPCPE 27 G P PE Sbjct: 126 GDSPAPE 132 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 PPP P PP P PP PPPPPPPPPP PPP + + Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVT 102 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [59][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 VPPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 VPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRD 96 PPP P PP P PP PPPPPPPPPP PPP RD Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRD 49 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 PPP P PP P PP PPPPPPPPPP PPP +R Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTR 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 [60][TOP] >UniRef100_B4G6U6 GL19111 n=1 Tax=Drosophila persimilis RepID=B4G6U6_DROPE Length = 191 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 PPP P+ PP P PP PPPPPPPPPP PPP +R Sbjct: 112 PPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPLFTTR 150 [61][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGR 99 PPP P PP P PP PPPPPPPPPP PPP R R Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRAR 62 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -2 Query: 248 ALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 +LT PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [62][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 55.8 bits (133), Expect = 1e-06 Identities = 29/65 (44%), Positives = 30/65 (46%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP+ S R P P Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPS----------PSPPRKPPSPSPPVP 311 Query: 44 GPPCP 30 PP P Sbjct: 312 PPPSP 316 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PP R PS PP P PP PPPPPPPPPP P P Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSP 278 [63][TOP] >UniRef100_UPI00016E59B7 UPI00016E59B7 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E59B7 Length = 1290 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 224 PPPGRAP------SLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPPG +P S TP LP PP PPPPPPP PP LPPP Sbjct: 1179 PPPGDSPHPTQTESTTPTLPPPPPPPPPPPPPRPPPLPPP 1218 [64][TOP] >UniRef100_UPI00016E59B6 UPI00016E59B6 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E59B6 Length = 1827 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 224 PPPGRAP------SLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPPG +P S TP LP PP PPPPPPP PP LPPP Sbjct: 1716 PPPGDSPHPTQTESTTPTLPPPPPPPPPPPPPRPPPLPPP 1755 [65][TOP] >UniRef100_UPI00016E599B UPI00016E599B related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E599B Length = 1868 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 224 PPPGRAP------SLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPPG +P S TP LP PP PPPPPPP PP LPPP Sbjct: 1757 PPPGDSPHPTQTESTTPTLPPPPPPPPPPPPPRPPPLPPP 1796 [66][TOP] >UniRef100_UPI00016E599A UPI00016E599A related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E599A Length = 1868 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 224 PPPGRAP------SLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPPG +P S TP LP PP PPPPPPP PP LPPP Sbjct: 1757 PPPGDSPHPTQTESTTPTLPPPPPPPPPPPPPRPPPLPPP 1796 [67][TOP] >UniRef100_UPI00016E5999 UPI00016E5999 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E5999 Length = 1916 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 224 PPPGRAP------SLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPPG +P S TP LP PP PPPPPPP PP LPPP Sbjct: 1755 PPPGDSPHPTQTESTTPTLPPPPPPPPPPPPPRPPPLPPP 1794 [68][TOP] >UniRef100_UPI00016E597F UPI00016E597F related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E597F Length = 1892 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 224 PPPGRAP------SLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPPG +P S TP LP PP PPPPPPP PP LPPP Sbjct: 1725 PPPGDSPHPTQTESTTPTLPPPPPPPPPPPPPRPPPLPPP 1764 [69][TOP] >UniRef100_UPI00016E595C UPI00016E595C related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E595C Length = 1919 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/40 (62%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -2 Query: 224 PPPGRAP------SLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPPG +P S TP LP PP PPPPPPP PP LPPP Sbjct: 1751 PPPGDSPHPTQTESTTPTLPPPPPPPPPPPPPRPPPLPPP 1790 [70][TOP] >UniRef100_C5C089 Metallophosphoesterase n=1 Tax=Beutenbergia cavernae DSM 12333 RepID=C5C089_BEUC1 Length = 890 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -2 Query: 248 ALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 A+ GA PPP P PP P PP PPPPPPPPPP PPP V Sbjct: 645 AVRSVGAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPPDV 686 [71][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 +PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 IPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/74 (40%), Positives = 30/74 (40%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP P P Sbjct: 53 PPPPPPPPPPPPRPCPPPPPPPPPPPPPPPPPPPPP---------------PPPPPPPPP 97 Query: 44 GPPCPETCRRGQPA 3 PP P C PA Sbjct: 98 PPPPPRPCPPPPPA 111 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 [72][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [73][TOP] >UniRef100_B8B832 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8B832_ORYSI Length = 1521 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/85 (41%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPEL---PPPAVASRAGRDYCSSH 81 P +T +GA PPP P PP P P PPPPPPPP PPP GR S+ Sbjct: 941 PPITRSGAPPPPPPPPGPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRP--SAP 998 Query: 80 *RWPVRERPSTGGPPCPETCRRGQP 6 P R S PP P + R G P Sbjct: 999 PLPPPGGRASAPPPPPPPSTRLGAP 1023 [74][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [75][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/36 (63%), Positives = 23/36 (63%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 PPP P PP P PP PPPPPPPPPP PPP V Sbjct: 81 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPV 116 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/54 (48%), Positives = 28/54 (51%) Frame = -2 Query: 284 CD*RCLDFQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 C R + + LT PPP P PP P PP PPPPPPPPPP PPP Sbjct: 57 CKGRDIIIRIEVILTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 110 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 79 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 112 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 80 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 [76][TOP] >UniRef100_B7Q3U3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q3U3_IXOSC Length = 137 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRD 96 PPP P PP P PP PPPPPPPPPP PPP G D Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGGGGVD 85 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 [77][TOP] >UniRef100_C9S8M2 Cytokinesis protein sepA n=1 Tax=Verticillium albo-atrum VaMs.102 RepID=C9S8M2_9PEZI Length = 842 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/57 (47%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPP-------LP*RPPHPPPPPPPPPPELPPPAVASRAG 102 P + VT A PPP P PP P PP PPPPPPPPPP P P + S G Sbjct: 155 PKIEVTSAAPPPPPPPPPPPPPMPGQGGAPPPPPPPPPPPPPPPPPPPMPGMLSPGG 211 [78][TOP] >UniRef100_Q9QXM1 Junction-mediating and -regulatory protein n=1 Tax=Mus musculus RepID=JMY_MOUSE Length = 983 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/56 (48%), Positives = 29/56 (51%), Gaps = 15/56 (26%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLT---------------PPLP*RPPHPPPPPPPPPPELP 129 P V+ +PPP AP LT PPLP PP PPPPPPPPPP LP Sbjct: 763 PRAVVSSELPPPQSAPLLTSIDPKPCSVTIDPLPPPLPPTPPPPPPPPPPPPPPLP 818 [79][TOP] >UniRef100_P12978 Epstein-Barr nuclear antigen 2 n=1 Tax=Human herpesvirus 4 (strain B95-8) RepID=EBNA2_EBVB9 Length = 487 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 VPPP P PP P PP PPPPPPPPPP PPP Sbjct: 58 VPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPP 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -2 Query: 236 TGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 TG PP P PP P PP PPPPPPPPPP PPP Sbjct: 56 TGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 [80][TOP] >UniRef100_UPI0001983880 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001983880 Length = 1479 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/49 (48%), Positives = 29/49 (59%) Frame = -2 Query: 260 QSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVA 114 Q P ++ A P P P +PPLP PP PPPPPPPP LPP A++ Sbjct: 1189 QFEPQFPLSYAPPLPNDVPPSSPPLPTSPPPPPPPPPPPSLPLPPSAIS 1237 [81][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 55.1 bits (131), Expect = 2e-06 Identities = 32/80 (40%), Positives = 35/80 (43%) Frame = -2 Query: 260 QSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH 81 QS P+L P P P L PP P PP PPPPPPPPPP PPP S Sbjct: 407 QSQPSLPFA---PLPQIQPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPPPSISS 463 Query: 80 *RWPVRERPSTGGPPCPETC 21 P + P P C +C Sbjct: 464 FLVPPQSCPIPCSPQCAPSC 483 [82][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/36 (61%), Positives = 24/36 (66%) Frame = -2 Query: 230 AVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 ++PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 SLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [83][TOP] >UniRef100_UPI0001951250 Formin-like protein 2 (Formin homology 2 domain-containing protein 2). n=1 Tax=Canis lupus familiaris RepID=UPI0001951250 Length = 1052 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/78 (39%), Positives = 34/78 (43%), Gaps = 11/78 (14%) Frame = -2 Query: 224 PPPGRAPS-----------LTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH* 78 PPP PS +TPP+P PP PPPPPPPPPP PPP A Sbjct: 488 PPPPLPPSSETPEAVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAP--- 544 Query: 77 RWPVRERPSTGGPPCPET 24 P+ P PP P T Sbjct: 545 --PLPPPPPPSAPPLPGT 560 [84][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 221 PPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 PP AP+ TPP P PP PPPPPPPPPP PP V Sbjct: 798 PPQPAPAPTPPPPPPPPPPPPPPPPPPPPSAPPQV 832 [85][TOP] >UniRef100_UPI0000ECD10C Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Gallus gallus RepID=UPI0000ECD10C Length = 3532 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1937 PPPPPPPPPPPPTPAPPPTPPPPPPPPPPPPPPP 1970 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PPP P TP P PP PPPPPPPPPP PPP+ Sbjct: 1940 PPPPPPPPPTPAPPPTPPPPPPPPPPPPPPPPPPS 1974 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 PPP AP TPP P PP PPPPPPPPPP PP V Sbjct: 1946 PPPTPAPPPTPPPP--PPPPPPPPPPPPPPSAPPQV 1979 [86][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -2 Query: 245 LTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 L G PPP P PP P PP PPPPPPPPPP PP Sbjct: 225 LDAAGFAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQPP 265 [87][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 P+ +T PP R P +PP P PP PPPPP PPPP PPP Sbjct: 503 PSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPP 545 [88][TOP] >UniRef100_Q41645 Extensin (Fragment) n=1 Tax=Volvox carteri RepID=Q41645_VOLCA Length = 464 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/72 (41%), Positives = 33/72 (45%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 P V PPP RA PP PP P PPPP PPP PPPA A +++ Sbjct: 359 PPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATA--------AANPPS 410 Query: 71 PVRERPSTGGPP 36 P R GGPP Sbjct: 411 PAPSRSRAGGPP 422 [89][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PPP P PP P PP PPPPPPPPPP PPP+ Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPS 261 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = -2 Query: 263 FQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPP 126 F+ P + + PPP P PP P PP PPPPPPPPPP PP Sbjct: 215 FRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/40 (57%), Positives = 24/40 (60%) Frame = -2 Query: 242 TVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 T A PPP R + P P PP PPPPPPPPPP PPP Sbjct: 206 TPVSAPPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPP 245 [90][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/67 (40%), Positives = 30/67 (44%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP + + P+ Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSE---------ILPAPANR 56 Query: 44 GPPCPET 24 PP P T Sbjct: 57 APPAPST 63 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 [91][TOP] >UniRef100_C1EF12 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EF12_9CHLO Length = 588 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/75 (40%), Positives = 36/75 (48%), Gaps = 5/75 (6%) Frame = -2 Query: 236 TGAVPPPGRAPSLTPPLP*RPP-----HPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 T VPPP APS PP PP HPPPPP PPPP P P+ + + +W Sbjct: 237 TPRVPPPPPAPSSPPPSSPPPPTPPSPHPPPPPSPPPPAPPRPSPPPSPPPPWFTE--QW 294 Query: 71 PVRERPSTGGPPCPE 27 + + GPP PE Sbjct: 295 AILTPGAPPGPPAPE 309 [92][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/62 (43%), Positives = 32/62 (51%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP R + + P+R ++ Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTPRTTVAFPPA----PLRRDTAST 65 Query: 44 GP 39 GP Sbjct: 66 GP 67 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 [93][TOP] >UniRef100_B6AF23 Putative uncharacterized protein n=1 Tax=Cryptosporidium muris RN66 RepID=B6AF23_9CRYT Length = 876 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = -2 Query: 260 QSHPALTVTGAVP-PPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRA 105 Q +P T + P PP +P L PP PP PPPPPPPPPP PPP +S + Sbjct: 163 QQYPLSTFSSYFPHPPPPSPPLYPPPLHPPPPPPPPPPPPPPPPPPPPPSSHS 215 [94][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = -2 Query: 242 TVTGAVPPPGRAPSLTPPLP*RPP----HPPPPPPPPPPELPPP 123 T+T A PP R P+L PP P PP PPPPPPPPP E PPP Sbjct: 1936 TITSAAPP--RPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPP 1977 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/73 (39%), Positives = 31/73 (42%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P+ PP P PP PPPPPPPPPP P P A Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPA----------------------- 80 Query: 44 GPPCPETCRRGQP 6 PP PET + QP Sbjct: 81 -PPPPETPSQSQP 92 [95][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/44 (59%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = -2 Query: 242 TVTGAVPPPGRAPSLTPPLP*RPP----HPPPPPPPPPPELPPP 123 T+T A PP R P+L PP P PP PPPPPPPPP E PPP Sbjct: 1839 TITSAAPP--RPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPP 1880 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/73 (39%), Positives = 31/73 (42%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P+ PP P PP PPPPPPPPPP P P A Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPA----------------------- 80 Query: 44 GPPCPETCRRGQP 6 PP PET + QP Sbjct: 81 -PPPPETPSQSQP 92 [96][TOP] >UniRef100_UPI0000DA32C3 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus RepID=UPI0000DA32C3 Length = 86 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/48 (56%), Positives = 28/48 (58%) Frame = +1 Query: 82 WLLQ*SLPALLATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGG 225 W L +PAL GGG GGGGGGGGGG GG G GG G GGG Sbjct: 16 WWLTPLIPALRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 63 [97][TOP] >UniRef100_UPI00005026F6 Short stature homeobox protein 2 (Paired family homeodomain protein Prx3) n=1 Tax=Rattus norvegicus RepID=UPI00005026F6 Length = 331 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/47 (57%), Positives = 30/47 (63%) Frame = +1 Query: 97 SLPALLATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGGTAPV 237 S PA+ A GGG +GGGGGGGGGG GG G G G GGG +PV Sbjct: 51 SSPAVRAAGGGGGAGGGGGGGGGGGGGAGGGGA---GGGAGGGRSPV 94 [98][TOP] >UniRef100_P70390-2 Isoform 2 of Short stature homeobox protein 2 n=1 Tax=Mus musculus RepID=P70390-2 Length = 319 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/47 (57%), Positives = 30/47 (63%) Frame = +1 Query: 97 SLPALLATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGGTAPV 237 S PA+ A GGG +GGGGGGGGGG GG G G G GGG +PV Sbjct: 51 SSPAVRAAGGGGGAGGGGGGGGGGGGGAGGGGA---GGGAGGGRSPV 94 [99][TOP] >UniRef100_P70390 Short stature homeobox protein 2 n=1 Tax=Mus musculus RepID=SHOX2_MOUSE Length = 331 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/47 (57%), Positives = 30/47 (63%) Frame = +1 Query: 97 SLPALLATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGGTAPV 237 S PA+ A GGG +GGGGGGGGGG GG G G G GGG +PV Sbjct: 51 SSPAVRAAGGGGGAGGGGGGGGGGGGGAGGGGA---GGGAGGGRSPV 94 [100][TOP] >UniRef100_UPI0000E213C1 PREDICTED: similar to SH3 domain binding protein isoform 1 n=1 Tax=Pan troglodytes RepID=UPI0000E213C1 Length = 483 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/83 (38%), Positives = 38/83 (45%), Gaps = 5/83 (6%) Frame = -2 Query: 236 TGAVPPPG-----RAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 T V PPG P + PP+P PP PPPPPPP PP LPP +V S + Sbjct: 198 TPLVSPPGPLTKGNLPVVAPPVPCAPPPPPPPPPPTPPPLPPASVLSDKAVKPQLAPLHL 257 Query: 71 PVRERPSTGGPPCPETCRRGQPA 3 P P PPC + +PA Sbjct: 258 PPIPPPLPLLPPCGYPGLKAEPA 280 [101][TOP] >UniRef100_UPI0000E213C0 PREDICTED: similar to SH3 domain binding protein isoform 2 n=1 Tax=Pan troglodytes RepID=UPI0000E213C0 Length = 483 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/83 (38%), Positives = 38/83 (45%), Gaps = 5/83 (6%) Frame = -2 Query: 236 TGAVPPPG-----RAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 T V PPG P + PP+P PP PPPPPPP PP LPP +V S + Sbjct: 198 TPLVSPPGPLTKGNLPVVAPPVPCAPPPPPPPPPPTPPPLPPASVLSDKAVKPQLAPLHL 257 Query: 71 PVRERPSTGGPPCPETCRRGQPA 3 P P PPC + +PA Sbjct: 258 PPIPPPLPLLPPCGYPGLKAEPA 280 [102][TOP] >UniRef100_UPI00005A3937 PREDICTED: similar to formin-like 2 isoform B n=1 Tax=Canis lupus familiaris RepID=UPI00005A3937 Length = 1119 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/60 (45%), Positives = 30/60 (50%) Frame = -2 Query: 203 SLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTGGPPCPET 24 S+TPP+P PP PPPPPPPPPP PPP A P+ P PP P T Sbjct: 573 SVTPPMPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAP-----PLPPPPPPSAPPLPGT 627 [103][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 4/50 (8%) Frame = -2 Query: 260 QSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPP----PPPPELPPP 123 +S + G+VPPP P PPLP PP PPPPPP PPPP LPPP Sbjct: 65 ESWQCSSTLGSVPPPPPLPP-PPPLPPPPPLPPPPPPPPPLPPPPPLPPP 113 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 P L +PPP P PP P PP PP PPPPPPP LPPP Sbjct: 80 PPLPPPPPLPPPPPLPPPPPPPPPLPPPPPLPPPPPPPPLPPP 122 [104][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/41 (60%), Positives = 26/41 (63%) Frame = -2 Query: 230 AVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 A PPP P PP P PP PPPPPPPPPP PPPA +R Sbjct: 304 ASPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPAFEAR 341 [105][TOP] >UniRef100_Q4U2V8 Hydroxyproline-rich glycoprotein GAS28 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V8_CHLRE Length = 433 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/73 (41%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = -2 Query: 245 LTVTGAVPPPGRAPSL-TPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWP 69 +++ G PPP +PS +PP P PP P PPPPPPP PPP A D P Sbjct: 212 VSILGNAPPPPPSPSPPSPPSPSPPPPPSPPPPPPPTPSPPPPELPPAQPDA-------P 264 Query: 68 VRERPSTGGPPCP 30 R+RP P P Sbjct: 265 ARKRPPPPASPPP 277 [106][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP +PS PP P PP PPPPPPPPPP PPP Sbjct: 209 PPPPPSPS-PPPSPPPPPSPPPPPPPPPPPSPPP 241 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP +P +PP P PP PPPPPPPP P PPP Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPP 244 [107][TOP] >UniRef100_A8J788 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J788_CHLRE Length = 433 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/73 (41%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = -2 Query: 245 LTVTGAVPPPGRAPSL-TPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWP 69 +++ G PPP +PS +PP P PP P PPPPPPP PPP A D P Sbjct: 212 VSILGNAPPPPPSPSPPSPPSPSPPPPPSPPPPPPPTPSPPPPELPPAQPDA-------P 264 Query: 68 VRERPSTGGPPCP 30 R+RP P P Sbjct: 265 ARKRPPPPASPPP 277 [108][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/72 (40%), Positives = 31/72 (43%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP P PP P PP PPPPPPPPPP PPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP-------------PPPPPPPPP 77 Query: 44 GPPCPETCRRGQ 9 PP P+ C G+ Sbjct: 78 PPPPPQLCCFGR 89 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 [109][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/46 (54%), Positives = 26/46 (56%) Frame = -2 Query: 260 QSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 QS A + PPP P PP P PP PPPPPPPPPP PPP Sbjct: 38 QSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 [110][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 PPP P PP P PP PPPPPPPPPP PPP + R Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQSFR 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [111][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 PPP P PP P PP PPPPPPPPPP PPP R Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQR 108 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 [112][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 PPP P PP P PP PPPPPPPPPP PPP + + Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLCN 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [113][TOP] >UniRef100_B7PAV3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PAV3_IXOSC Length = 86 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/50 (54%), Positives = 27/50 (54%), Gaps = 7/50 (14%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPE-------LPPPAVASRAGRD 96 PPP P PP P PP PPPPPPPPPPE PPAV R RD Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPENNEVYVQADPPAVPDRHRRD 53 [114][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 PPP P PP P PP PPPPPPPPPP PPP + Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHI 59 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 [115][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 PPP P+ PP P PP PPPPPPPPPP PPP R Sbjct: 112 PPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPR 150 [116][TOP] >UniRef100_B8ZZV2 HCG38312, isoform CRA_b n=1 Tax=Homo sapiens RepID=B8ZZV2_HUMAN Length = 483 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/83 (38%), Positives = 38/83 (45%), Gaps = 5/83 (6%) Frame = -2 Query: 236 TGAVPPPG-----RAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 T V PPG P + PP+P PP PPPPPPP PP LPP +V S + Sbjct: 198 TPLVSPPGPLTKGNLPVVAPPVPCAPPPPPPPPPPTPPPLPPASVLSDKAVKPQLAPLHL 257 Query: 71 PVRERPSTGGPPCPETCRRGQPA 3 P P PPC + +PA Sbjct: 258 PPIPPPLPLLPPCGYPGLKAEPA 280 [117][TOP] >UniRef100_Q0U2K7 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0U2K7_PHANO Length = 390 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRD 96 P P AP PP PP PPPPPPPPPP PPP+ S GRD Sbjct: 141 PSPAPAPVPAPP----PPPPPPPPPPPPPPPPPPSGPSGRGRD 179 [118][TOP] >UniRef100_B2W6F1 Putative uncharacterized protein n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2W6F1_PYRTR Length = 622 Score = 54.7 bits (130), Expect = 3e-06 Identities = 35/98 (35%), Positives = 40/98 (40%), Gaps = 16/98 (16%) Frame = -2 Query: 251 PALTVTGAVPPP-------GRAPSLTPPLP*R----PPHPPPPPPPPPP-----ELPPPA 120 P L +PPP R + PPLP PP PPPPPPPPPP +PPP Sbjct: 419 PPLPPAHNIPPPPPLPPSSSRPAPIPPPLPPTSNVAPPPPPPPPPPPPPSMPGRSIPPPP 478 Query: 119 VASRAGRDYCSSH*RWPVRERPSTGGPPCPETCRRGQP 6 +G P PS+G PP P G P Sbjct: 479 PMPNSGAP--------PPPPMPSSGAPPPPPMPNSGAP 508 [119][TOP] >UniRef100_A6NGB9 WAS/WASL-interacting protein family member 3 n=1 Tax=Homo sapiens RepID=WIPF3_HUMAN Length = 483 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/83 (38%), Positives = 38/83 (45%), Gaps = 5/83 (6%) Frame = -2 Query: 236 TGAVPPPG-----RAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 T V PPG P + PP+P PP PPPPPPP PP LPP +V S + Sbjct: 198 TPLVSPPGPLTKGNLPVVAPPVPCAPPPPPPPPPPTPPPLPPASVLSDKAVKPQLAPLHL 257 Query: 71 PVRERPSTGGPPCPETCRRGQPA 3 P P PPC + +PA Sbjct: 258 PPIPPPLPLLPPCGYPGLKAEPA 280 [120][TOP] >UniRef100_Q08RT8 Putative uncharacterized protein n=1 Tax=Stigmatella aurantiaca DW4/3-1 RepID=Q08RT8_STIAU Length = 909 Score = 54.3 bits (129), Expect = 4e-06 Identities = 31/69 (44%), Positives = 37/69 (53%), Gaps = 8/69 (11%) Frame = +1 Query: 97 SLPALLATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGG--------TAPVTVKAG 252 S+P+ GGGS GGGGGGGGGG GG YG G G GGG PV V+A Sbjct: 300 SIPSYGGGGGGGSCGGGGGGGGGG-GGGYGGQGYGDGGSGGGGGSCDETPPAPPVIVEAT 358 Query: 253 WLWKSRQRQ 279 W + S + + Sbjct: 359 WQYGSTRHE 367 [121][TOP] >UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001982D5B Length = 1269 Score = 54.3 bits (129), Expect = 4e-06 Identities = 35/86 (40%), Positives = 37/86 (43%), Gaps = 3/86 (3%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPP---PPELPPPAVASRAGRDYCSSH 81 PA GA PPP P T PL PP PPPPPPPP PP PPP + Sbjct: 716 PAPKPPGAPPPPPPPPPTTKPLGAHPPPPPPPPPPPAPKPPGAPPPPPKPPSAPP----- 770 Query: 80 *RWPVRERPSTGGPPCPETCRRGQPA 3 P +P G PP P G PA Sbjct: 771 ---PPPPKP-PGAPPPPPPKLPGAPA 792 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/80 (40%), Positives = 36/80 (45%), Gaps = 2/80 (2%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPP--PPPELPPPAVASRAGRDYCSSH* 78 PA GA PPP + PS PP P +PP PPPPPP P PPP+ + G Sbjct: 751 PAPKPPGAPPPPPKPPSAPPPPPPKPPGAPPPPPPKLPGAPAPPPSHVTVPGPP------ 804 Query: 77 RWPVRERPSTGGPPCPETCR 18 P T PP P T R Sbjct: 805 --PPPGAKGTNAPPPPPTGR 822 [122][TOP] >UniRef100_UPI000161FB4F predicted protein n=1 Tax=Physcomitrella patens subsp. patens RepID=UPI000161FB4F Length = 616 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/58 (44%), Positives = 30/58 (51%) Frame = -2 Query: 254 HPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH 81 HP L + PP PS TPP P P PPPP PPPP PPP ++ G +SH Sbjct: 413 HPPLPPLPPISPPPPPPSETPPPPPSSPPPPPPMPPPPSSPPPPLPSTPHGFSAHASH 470 [123][TOP] >UniRef100_UPI0000F2E6D0 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2E6D0 Length = 358 Score = 54.3 bits (129), Expect = 4e-06 Identities = 35/88 (39%), Positives = 38/88 (43%) Frame = -2 Query: 269 LDFQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYC 90 LD P V + P P PP P PP PPPPPPPPPP LPPP R G Sbjct: 15 LDPTPWPGRAVVLSFPWPWWGTLFWPPFPFLPPVPPPPPPPPPP-LPPPPPQPRWG---- 69 Query: 89 SSH*RWPVRERPSTGGPPCPETCRRGQP 6 P+R + G P T RG P Sbjct: 70 ----LLPLRPARNLGVPTVAWTPERGDP 93 [124][TOP] >UniRef100_UPI000179D080 UPI000179D080 related cluster n=1 Tax=Bos taurus RepID=UPI000179D080 Length = 540 Score = 54.3 bits (129), Expect = 4e-06 Identities = 33/85 (38%), Positives = 41/85 (48%), Gaps = 4/85 (4%) Frame = -2 Query: 251 PALTVTGAVPPP--GRAPSLTPPLP*RP-PHPPPPPPPPPPELPPPAVASRAGRDYCSSH 81 P G +PPP G +LT P P PPPPPPPPPP+ PPP +G Y Sbjct: 33 PTAPGPGPLPPPPVGSVGALTAAFPFAALPPPPPPPPPPPPQQPPPPPPPSSGSSYSPPQ 92 Query: 80 -*RWPVRERPSTGGPPCPETCRRGQ 9 P+ +R S PP P+ R+ Q Sbjct: 93 PPPPPLYQRVSPPQPPPPQPPRQDQ 117 [125][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 [126][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/34 (67%), Positives = 23/34 (67%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P PP PPPPPPPPPP PPP Sbjct: 96 PPPPPPPSPPPPSP-PPPSPPPPPPPPPPPSPPP 128 [127][TOP] >UniRef100_Q01AC1 Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01AC1_OSTTA Length = 872 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 PPP P PP P PP PPPPP PPPP PPP V Sbjct: 570 PPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPV 605 [128][TOP] >UniRef100_B8AQT2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=B8AQT2_ORYSI Length = 486 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/66 (39%), Positives = 34/66 (51%), Gaps = 7/66 (10%) Frame = -2 Query: 263 FQSHPALTVTGAVPPPGRAP-------SLTPPLP*RPPHPPPPPPPPPPELPPPAVASRA 105 +Q+HP + G++PPP P +L P P PP PPPPP PPP P P A Sbjct: 57 YQAHPQYPMPGSLPPPPPRPPSFAPENALPPSSPPPPPPPPPPPSSPPPVPPSPTAAPTT 116 Query: 104 GRDYCS 87 G+ + S Sbjct: 117 GQSWNS 122 [129][TOP] >UniRef100_Q9GM99 Huntingtin n=1 Tax=Sus scrofa RepID=Q9GM99_PIG Length = 3139 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = -2 Query: 227 VPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVA 114 +PPP P PP PP PPPPPPPPPP P PAVA Sbjct: 36 LPPPPPQPPQPPPQTQPPPQPPPPPPPPPPPPPGPAVA 73 [130][TOP] >UniRef100_Q17G68 Formin 1,2/cappuccino n=1 Tax=Aedes aegypti RepID=Q17G68_AEDAE Length = 891 Score = 54.3 bits (129), Expect = 4e-06 Identities = 36/87 (41%), Positives = 38/87 (43%), Gaps = 17/87 (19%) Frame = -2 Query: 239 VTGAVPPPGRAPSLTPPLP*RPPHPPPPPP----------------PPPPELPPPAVASR 108 V PPP P L PPLP PPHPPPPPP PPPP PPP ++S Sbjct: 292 VEAETPPP---PPLPPPLP--PPHPPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPPISS- 345 Query: 107 AGRDYCSSH*RWPVRERPST-GGPPCP 30 V PST GGPP P Sbjct: 346 -------------VSIPPSTSGGPPAP 359 [131][TOP] >UniRef100_B7PS04 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PS04_IXOSC Length = 76 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 34 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 35 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 36 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 37 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 38 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 39 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP P PP P PP PPPPPPPPPP PPP Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 [132][TOP] >UniRef100_B3M020 GF18870 n=1 Tax=Drosophila ananassae RepID=B3M020_DROAN Length = 1097 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/41 (56%), Positives = 24/41 (58%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAG 102 PPP P+ TPP P PP PPPP PPPP PPP S G Sbjct: 423 PPPPSLPAPTPPPPTPPPPTPPPPTPPPPTQPPPPPESNTG 463 [133][TOP] >UniRef100_C0SFQ9 Putative uncharacterized protein n=1 Tax=Paracoccidioides brasiliensis Pb03 RepID=C0SFQ9_PARBP Length = 675 Score = 54.3 bits (129), Expect = 4e-06 Identities = 34/73 (46%), Positives = 35/73 (47%), Gaps = 8/73 (10%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPP----PPPPPPPE----LPPPAVASRAGRDYCSSH*RWP 69 PPPG APS P P PP PPP PPPPPPP PPP A A SH P Sbjct: 495 PPPGPAPSTAVPPPPPPPPPPPSGSAPPPPPPPSGSAPPPPPHPAPSA------SHSPPP 548 Query: 68 VRERPSTGGPPCP 30 PS+ PP P Sbjct: 549 PLSAPSSSPPPPP 561 [134][TOP] >UniRef100_UPI0000E12BCF Os07g0596300 n=1 Tax=Oryza sativa Japonica Group RepID=UPI0000E12BCF Length = 754 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/85 (41%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPEL---PPPAVASRAGRDYCSSH 81 P +T +GA P P PS PP P P PPPPPPPP PPP GR S+ Sbjct: 162 PPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRP--SAP 219 Query: 80 *RWPVRERPSTGGPPCPETCRRGQP 6 P R S PP P + R G P Sbjct: 220 PLPPPGGRASAPPPPPPPSTRLGAP 244 [135][TOP] >UniRef100_UPI0000DB6FAC PREDICTED: similar to Protein cappuccino n=1 Tax=Apis mellifera RepID=UPI0000DB6FAC Length = 1007 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/74 (41%), Positives = 32/74 (43%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RW 72 PA G PP GR PP P PPPPPPPPPP PPP +S AG Sbjct: 433 PATATRG--PPLGRLSFTLPPSPLAASPPPPPPPPPPPPPPPPTQSSAAG---------- 480 Query: 71 PVRERPSTGGPPCP 30 GGPP P Sbjct: 481 --------GGPPPP 486 [136][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PPP P L PPLP P PP PPP PPP LPPP+ Sbjct: 32 PPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPS 66 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 P + + PPP +PS PP P P PPPPPPPPPP PP+ Sbjct: 189 PPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPS 232 [137][TOP] >UniRef100_Q10Q04 Os03g0214900 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q10Q04_ORYSJ Length = 979 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/66 (42%), Positives = 36/66 (54%), Gaps = 7/66 (10%) Frame = -2 Query: 263 FQSHPALTVTGAVPPPG-RAPSLTP-----PLP*RPPHPPPPPPPPPPELPP-PAVASRA 105 +Q+HP + G++PPP R PS P P PP PPPPPP PP +PP P A Sbjct: 107 YQAHPQYPMPGSLPPPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPPVPPSPTAAPTT 166 Query: 104 GRDYCS 87 G+ + S Sbjct: 167 GQSWNS 172 [138][TOP] >UniRef100_B9FY87 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FY87_ORYSJ Length = 1589 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/85 (41%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPEL---PPPAVASRAGRDYCSSH 81 P +T +GA P P PS PP P P PPPPPPPP PPP GR S+ Sbjct: 997 PPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRP--SAP 1054 Query: 80 *RWPVRERPSTGGPPCPETCRRGQP 6 P R S PP P + R G P Sbjct: 1055 PLPPPGGRASAPPPPPPPSTRLGAP 1079 [139][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -2 Query: 251 PALTVTGAVPPPGR-APSLTPPLP*RPPHPPPPPPPPPPELPP 126 PA V + PPP PS PP P PP PPPPPPPPPP PP Sbjct: 397 PAPPVPPSPPPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPP 439 [140][TOP] >UniRef100_A7XQ02 Latex protein n=1 Tax=Morus alba RepID=A7XQ02_MORAL Length = 415 Score = 53.9 bits (128), Expect = 5e-06 Identities = 32/89 (35%), Positives = 38/89 (42%), Gaps = 1/89 (1%) Frame = -2 Query: 284 CD*RCLDFQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRA 105 C +C P+ PPP P +PP P PP PPPP PPPP PPP+ Sbjct: 60 CQSQCWSSPPPPSPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPG 119 Query: 104 GRDYCSSH*RWPVRERPSTGGPPC-PETC 21 G + R R + G PPC P C Sbjct: 120 GPE------RPDHRCGRALGNPPCNPGRC 142 [141][TOP] >UniRef100_B4LU87 GJ17267 n=1 Tax=Drosophila virilis RepID=B4LU87_DROVI Length = 1229 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/65 (44%), Positives = 33/65 (50%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 P P AP++ PP P PP PPPPPPPPP PPP + + A P P G Sbjct: 660 PAPEAAPAIAPPPP--PPPPPPPPPPPP---PPPGMTAAAAPP--------PPPPPPPGG 706 Query: 44 GPPCP 30 GPP P Sbjct: 707 GPPPP 711 [142][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/41 (58%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPP-PPPPPELPPPAVASRA 105 PPP P PP P PP PPPPP PPPP +LPPP +RA Sbjct: 369 PPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAGARA 409 [143][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 P+ A+P G + PP P PP PPPPPPPPPP PPPA+ Sbjct: 454 PSYPCHSAIPHAGASLPPPPPPPLPPPPPPPPPPPPPPPPPPPAL 498 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/60 (45%), Positives = 29/60 (48%), Gaps = 13/60 (21%) Frame = -2 Query: 263 FQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPP-------------PPPELPPP 123 + H A+ GA PP P L PP P PP PPPPPPP PPP LPPP Sbjct: 456 YPCHSAIPHAGASLPPPPPPPLPPPPPPPPPPPPPPPPPPPALDVGETSSLQPPPPLPPP 515 [144][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 P+ A+P G + PP P PP PPPPPPPPPP PPPA+ Sbjct: 825 PSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPPAL 869 [145][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 P+ A+P G + PP P PP PPPPPPPPPP PPPA+ Sbjct: 903 PSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPPAL 947 [146][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 P+ A+P G + PP P PP PPPPPPPPPP PPPA+ Sbjct: 903 PSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPPAL 947 [147][TOP] >UniRef100_B6QV40 Cytokinesis protein SepA/Bni1 n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6QV40_PENMQ Length = 1782 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/54 (50%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = -2 Query: 266 DFQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPP------PPPPPELPPP 123 D S PA+T PPP P PP P PP PPPPP PPPPP PPP Sbjct: 1022 DEVSKPAVTAVPPPPPPPPPPPPPPPPPPPPPPPPPPPMSAGGIPPPPPPPPPP 1075 [148][TOP] >UniRef100_Q84ZL0-2 Isoform 2 of Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=Q84ZL0-2 Length = 1627 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/85 (41%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPEL---PPPAVASRAGRDYCSSH 81 P +T +GA P P PS PP P P PPPPPPPP PPP GR S+ Sbjct: 1035 PPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRP--SAP 1092 Query: 80 *RWPVRERPSTGGPPCPETCRRGQP 6 P R S PP P + R G P Sbjct: 1093 PLPPPGGRASAPPPPPPPSTRLGAP 1117 [149][TOP] >UniRef100_Q84ZL0 Formin-like protein 5 n=1 Tax=Oryza sativa Japonica Group RepID=FH5_ORYSJ Length = 1627 Score = 53.9 bits (128), Expect = 5e-06 Identities = 35/85 (41%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPEL---PPPAVASRAGRDYCSSH 81 P +T +GA P P PS PP P P PPPPPPPP PPP GR S+ Sbjct: 1035 PPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRP--SAP 1092 Query: 80 *RWPVRERPSTGGPPCPETCRRGQP 6 P R S PP P + R G P Sbjct: 1093 PLPPPGGRASAPPPPPPPSTRLGAP 1117 [150][TOP] >UniRef100_B6T025 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B6T025_MAIZE Length = 98 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = +1 Query: 97 SLPALLATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGG 225 ++ A +A GGG GGGGGGGGGGCGG G GG G GGG Sbjct: 56 AVSAAIAAGGGGGCGGGGGGGGGGCGGGGGGGG---GCGGGGG 95 [151][TOP] >UniRef100_UPI000194BDE1 PREDICTED: zinc finger homeodomain 4 n=1 Tax=Taeniopygia guttata RepID=UPI000194BDE1 Length = 3535 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = -2 Query: 257 SHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGR 99 S PAL+++ A P + TPP P PP PPPPPPPPPP PPP +S +G+ Sbjct: 3050 SSPALSLSSA---PSKPLLQTPPPPPPPPPPPPPPPPPPP--PPPPSSSLSGQ 3097 [152][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/48 (52%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = -2 Query: 257 SHPALTVTGAVPPPGR---APSLTPPLP*RPPHPPPPPPPPPPELPPP 123 S P+ + + PPP R PSL P P P PPPPPPPPPP PPP Sbjct: 454 STPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPP 501 [153][TOP] >UniRef100_UPI0000D9A7E7 PREDICTED: similar to SH3 domain binding protein CR16 isoform 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9A7E7 Length = 486 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Frame = -2 Query: 236 TGAVPPPG-----RAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 T V PPG P + PP P PP PPPPPPP PP LPP +V S Sbjct: 198 TPLVSPPGPLTKGNLPVVAPPAPCAPPPPPPPPPPTPPPLPPASVLS 244 [154][TOP] >UniRef100_UPI0000D9A7E6 PREDICTED: similar to SH3 domain binding protein CR16 isoform 2 n=1 Tax=Macaca mulatta RepID=UPI0000D9A7E6 Length = 486 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/47 (53%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Frame = -2 Query: 236 TGAVPPPG-----RAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 T V PPG P + PP P PP PPPPPPP PP LPP +V S Sbjct: 198 TPLVSPPGPLTKGNLPVVAPPAPCAPPPPPPPPPPTPPPLPPASVLS 244 [155][TOP] >UniRef100_UPI00001809D7 UPI00001809D7 related cluster n=1 Tax=Rattus norvegicus RepID=UPI00001809D7 Length = 3593 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -2 Query: 239 VTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPP 126 + V P +AP TPP P PP PPPPPPPPPP PP Sbjct: 2007 IPNTVSAPLQAPPPTPPPPPPPPPPPPPPPPPPPSAPP 2044 [156][TOP] >UniRef100_UPI0001B798A6 UPI0001B798A6 related cluster n=1 Tax=Homo sapiens RepID=UPI0001B798A6 Length = 625 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 11/45 (24%) Frame = -2 Query: 224 PPPGRAPS-----------LTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS +TPP+P PP PPPPPPPPPP PPP Sbjct: 67 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 111 [157][TOP] >UniRef100_UPI0000EE3DB8 zinc finger homeodomain 4 n=1 Tax=Homo sapiens RepID=UPI0000EE3DB8 Length = 3571 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -2 Query: 239 VTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 + V P +AP TPP P PP PPPPPPPPPP PP V Sbjct: 1982 IPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQV 2022 [158][TOP] >UniRef100_UPI00004576BB Zinc finger homeobox protein 4 (Zinc finger homeodomain protein 4) (ZFH-4). n=1 Tax=Homo sapiens RepID=UPI00004576BB Length = 3567 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -2 Query: 239 VTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 + V P +AP TPP P PP PPPPPPPPPP PP V Sbjct: 1982 IPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQV 2022 [159][TOP] >UniRef100_UPI00016E72DF UPI00016E72DF related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E72DF Length = 570 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/52 (50%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = -2 Query: 257 SHPALTVTGAVPPPGRAPSLTPPLP*R---PPHPPPPPPPPPPELPPPAVAS 111 +H + PPP P PPLP PP PPPPPPPPPP PPP +AS Sbjct: 15 NHTGVAAGMPAPPPPPPP---PPLPVNGTSPPPPPPPPPPPPPPPPPPGLAS 63 [160][TOP] >UniRef100_UPI000179CB3D inverted formin 2 isoform 1 n=1 Tax=Bos taurus RepID=UPI000179CB3D Length = 1211 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -2 Query: 224 PPPGRAPSLT-PPLP*RPPHPPPPPPPPPPELPPPAVASRA 105 PPP AP L P RPP PPPPPPPPPP PPP RA Sbjct: 418 PPPPPAPPLPGPTTAPRPPPPPPPPPPPPPPPPPPLPGMRA 458 [161][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PPP P +PP P PP PPPPPP PPP PPP+ Sbjct: 2267 PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPS 2301 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/48 (52%), Positives = 28/48 (58%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH 81 PPP P PP P PP PPPPPPP PP PPP + + GR C S+ Sbjct: 226 PPPPSPPPPPPPSP-PPPSPPPPPPPSPPPPPPPPLPTPTGRS-CFSY 271 [162][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PPP P +PP P PP PPPPP PPPP PPP+ Sbjct: 139 PPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPS 173 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PPP P +PP P PP P PPPPPPPP PPP+ Sbjct: 134 PPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPS 168 [163][TOP] >UniRef100_A3PW04 U5 snRNP spliceosome subunit-like protein n=1 Tax=Mycobacterium sp. JLS RepID=A3PW04_MYCSJ Length = 137 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/49 (48%), Positives = 28/49 (57%) Frame = -2 Query: 257 SHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 S P + A+PPP P PP PP PPPPPPPPP +PPP V + Sbjct: 72 SDPFAYLNEALPPPPPPPPPPPPGAPPPPPPPPPPPPPPVYVPPPPVGN 120 [164][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/60 (48%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = -2 Query: 266 DFQSHPAL-TVT----GAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAG 102 DF +H L T+T G PPP PP P PP PPPPPPPPPP PPP G Sbjct: 205 DFNTHSILGTLTYNFGGEAPPP------PPPPPPPPPPPPPPPPPPPPPPPPPPPPCNTG 258 [165][TOP] >UniRef100_A5AJX1 Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AJX1_VITVI Length = 341 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -2 Query: 239 VTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 VT PPP P PP P PP PPPPPPPPPP P +AS Sbjct: 38 VTAVNPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIKLIAS 80 [166][TOP] >UniRef100_A4S9A6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S9A6_OSTLU Length = 4076 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/66 (39%), Positives = 31/66 (46%) Frame = -2 Query: 320 TLAVWPRGRRRHCD*RCLDFQSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPP 141 T+ V PR R C ++ + PPP P +PP P PP PP PPPP P Sbjct: 52 TITVKPRNGGRSCGAYEGQTRTENCEGIANCSPPPSPPPPPSPPPPPSPPPPPSPPPPSP 111 Query: 140 PELPPP 123 P PPP Sbjct: 112 PPSPPP 117 [167][TOP] >UniRef100_A4RWC6 Predicted protein n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4RWC6_OSTLU Length = 4003 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -2 Query: 242 TVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 TV PPP PS PP P PP PPPPPPPP P PPP+ Sbjct: 1541 TVPTPSPPPSPPPSPPPPSP--PPSPPPPPPPPSPPPPPPS 1579 [168][TOP] >UniRef100_Q5CS67 Signal peptide containing large protein with proline stretches n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CS67_CRYPV Length = 1884 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PPP S PP P PP PPPPPPPPPP PPP+ Sbjct: 1536 PPPSSGSSAPPPPP--PPPPPPPPPPPPPPSPPPS 1568 [169][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 53.5 bits (127), Expect = 7e-06 Identities = 29/67 (43%), Positives = 30/67 (44%) Frame = -2 Query: 230 AVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPS 51 A PPP P PP P PP PPPPPPPPPP+ P P G RP Sbjct: 52 APPPPPPPPPPPPPPP--PPPPPPPPPPPPPQQPLPGNPGPPG--------------RPG 95 Query: 50 TGGPPCP 30 GPP P Sbjct: 96 PAGPPGP 102 [170][TOP] >UniRef100_Q86UP3 Zinc finger homeobox protein 4 n=1 Tax=Homo sapiens RepID=ZFHX4_HUMAN Length = 3567 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/41 (56%), Positives = 25/41 (60%) Frame = -2 Query: 239 VTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAV 117 + V P +AP TPP P PP PPPPPPPPPP PP V Sbjct: 1982 IPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPPPSAPPQV 2022 [171][TOP] >UniRef100_Q96PY5-3 Isoform 2 of Formin-like protein 2 n=1 Tax=Homo sapiens RepID=Q96PY5-3 Length = 1092 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 11/45 (24%) Frame = -2 Query: 224 PPPGRAPS-----------LTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS +TPP+P PP PPPPPPPPPP PPP Sbjct: 529 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 573 [172][TOP] >UniRef100_Q96PY5 Formin-like protein 2 n=1 Tax=Homo sapiens RepID=FMNL2_HUMAN Length = 1086 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 11/45 (24%) Frame = -2 Query: 224 PPPGRAPS-----------LTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS +TPP+P PP PPPPPPPPPP PPP Sbjct: 529 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 573 [173][TOP] >UniRef100_Q6H7U3 Formin-like protein 10 n=1 Tax=Oryza sativa Japonica Group RepID=FH10_ORYSJ Length = 881 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -2 Query: 209 APSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAG 102 AP L PP P PP PPPPPPPPPP PPP + G Sbjct: 348 APKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKG 383 [174][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVAS 111 PP +AP PP P PP PPPPPPPPPP PPP AS Sbjct: 346 PPAAQAP---PPPPPPPPPPPPPPPPPPPPPPPPPPAS 380 [175][TOP] >UniRef100_UPI0000D9A3B3 PREDICTED: short stature homeobox 2 isoform 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9A3B3 Length = 355 Score = 53.1 bits (126), Expect = 9e-06 Identities = 44/108 (40%), Positives = 54/108 (50%), Gaps = 11/108 (10%) Frame = +1 Query: 97 SLPALLATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGGTAPV-TVKAGWLWKSRQ 273 S PA+ A GGG GGGGGGGGGG GG G GG GA GGG +PV + G +SR+ Sbjct: 52 SSPAVRAAGGGG--GGGGGGGGGGGGGGVGGGGAGGGA--GGGRSPVRELDMGAAERSRE 107 Query: 274 ----RQSQWRLLP---RGQTANVRPG---CFYVHPRIPPSPPSSSGDE 387 R ++ R P R Q + PG F V P + + G E Sbjct: 108 PGSPRLTEGRRKPTKARVQATLLLPGEAFRFLVSPELKDRKEDAKGME 155 [176][TOP] >UniRef100_UPI0000DBF1EE UPI0000DBF1EE related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000DBF1EE Length = 101 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/34 (70%), Positives = 24/34 (70%) Frame = +1 Query: 124 GGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGG 225 GGG GGGGGGGGGG GGRYG GG G GGG Sbjct: 10 GGGGGGGGGGGGGGGGGGRYGGGGGGGGDGGGGG 43 [177][TOP] >UniRef100_B9HNL0 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HNL0_POPTR Length = 265 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +1 Query: 112 LATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGGT 228 +A AGGG GGG GGGGGG GGR G GG G GGGT Sbjct: 23 IAAAGGGGGGGGRGGGGGGGGGRGGGGGKGGGPARGGGT 61 [178][TOP] >UniRef100_B7Q9J5 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q9J5_IXOSC Length = 120 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +1 Query: 100 LPALLATAGGGSSGGGGGGGGGGCGGRYGSGGVRLGARPGGG 225 +P L +T GGG GGGGGGGGGG GG G GG G GGG Sbjct: 59 IPGLGSTGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 100 [179][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -2 Query: 230 AVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 + P P SL PP P PP PPPPPPPPPP PPP Sbjct: 449 SAPIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPP 484 [180][TOP] >UniRef100_UPI00005A6010 PREDICTED: similar to CG1 protein (F18) n=1 Tax=Canis lupus familiaris RepID=UPI00005A6010 Length = 829 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = -2 Query: 230 AVPPPGRAPSLTP---PLP*RPPHPPPPPPPPPPELPPPAV 117 ++PPPG +PS P P P PP PPPPPPPPPP+ P ++ Sbjct: 271 SLPPPGPSPSYRPVPSPHPPPPPPPPPPPPPPPPQFSPQSL 311 [181][TOP] >UniRef100_UPI000025003E PREDICTED: similar to Homeobox protein engrailed-1 (Mo-En-1) isoform 2 n=1 Tax=Rattus norvegicus RepID=UPI000025003E Length = 409 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Frame = -2 Query: 230 AVPPPGRAPSLTPPL---P*RPPHPPPPPPPPPPELPPPAVASRA 105 A P P AP L PPL P PPHPPPPPPPPPP PP +A+ A Sbjct: 60 APPSPPAAPCL-PPLAHHPNLPPHPPPPPPPPPPPPPPQHLAAPA 103 [182][TOP] >UniRef100_UPI00016EA76C UPI00016EA76C related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016EA76C Length = 776 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/49 (48%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPL--P*RPPHPPPPPPPPPPELPPPAVAS 111 P + PPP A + PP P PP PPPPPPP PP LPPP ++S Sbjct: 593 PVQIFSAPPPPPSPASATCPPALPPPPPPPPPPPPPPLPPTLPPPPISS 641 [183][TOP] >UniRef100_UPI00016EA76B UPI00016EA76B related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016EA76B Length = 745 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/49 (48%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPL--P*RPPHPPPPPPPPPPELPPPAVAS 111 P + PPP A + PP P PP PPPPPPP PP LPPP ++S Sbjct: 531 PVQIFSAPPPPPSPASATCPPALPPPPPPPPPPPPPPLPPTLPPPPISS 579 [184][TOP] >UniRef100_UPI00016EA501 UPI00016EA501 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016EA501 Length = 787 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/49 (48%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPL--P*RPPHPPPPPPPPPPELPPPAVAS 111 P + PPP A + PP P PP PPPPPPP PP LPPP ++S Sbjct: 596 PVQIFSAPPPPPSPASATCPPALPPPPPPPPPPPPPPLPPTLPPPPISS 644 [185][TOP] >UniRef100_UPI00016E98C2 UPI00016E98C2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C2 Length = 500 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/59 (42%), Positives = 28/59 (47%), Gaps = 7/59 (11%) Frame = -2 Query: 257 SHPALTVTGAVPPPGRAPSLTPP-------LP*RPPHPPPPPPPPPPELPPPAVASRAG 102 S P ++ PPP R P PP P PP PPPPPP PPP PPP + G Sbjct: 337 SRPGISAPPPPPPPSRPPPPPPPSIPSGGGAPPPPPPPPPPPPGPPPPAPPPTSDANGG 395 [186][TOP] >UniRef100_UPI000184A3E6 Protein CG1 (F18). n=1 Tax=Canis lupus familiaris RepID=UPI000184A3E6 Length = 781 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = -2 Query: 230 AVPPPGRAPSLTP---PLP*RPPHPPPPPPPPPPELPPPAV 117 ++PPPG +PS P P P PP PPPPPPPPPP+ P ++ Sbjct: 319 SLPPPGPSPSYRPVPSPHPPPPPPPPPPPPPPPPQFSPQSL 359 [187][TOP] >UniRef100_Q0C0P5 OmpA family protein n=1 Tax=Hyphomonas neptunium ATCC 15444 RepID=Q0C0P5_HYPNA Length = 387 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/56 (46%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -2 Query: 266 DFQSHPA---LTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 ++Q H A L + A PP P PP P PP PPPPPPPPPPE P +A + Sbjct: 214 NYQDHSATLGLRYSFAAPPAPPPPPPPPPPPPPPPPPPPPPPPPPPEETTPPLAQQ 269 [188][TOP] >UniRef100_B0T2W0 OmpA/MotB domain protein n=1 Tax=Caulobacter sp. K31 RepID=B0T2W0_CAUSK Length = 401 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -2 Query: 230 AVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASR 108 A PPP P PP PP PPPPPPPPPP PPPA +R Sbjct: 257 ASPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPAYEAR 293 [189][TOP] >UniRef100_B5FWY8 OmpA family protein n=1 Tax=Riemerella anatipestifer RepID=B5FWY8_RIEAN Length = 384 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/56 (50%), Positives = 30/56 (53%) Frame = -2 Query: 260 QSHPALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDY 93 QSH TVT + A PP P PP PPPPPPPPPP PPP A A R + Sbjct: 226 QSH---TVTLGLRYAFGAEPAAPPPPPPPPPPPPPPPPPPPPPPPPPPAKPAARQF 278 [190][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 53.1 bits (126), Expect = 9e-06 Identities = 28/65 (43%), Positives = 30/65 (46%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSSH*RWPVRERPSTG 45 PPP R P +PP P PP PPPP PPPPP PPP P R P + Sbjct: 315 PPPPRPPPPSPPPP-SPPPPPPPSPPPPPSPPPPP----------------PPRPPPPSP 357 Query: 44 GPPCP 30 PP P Sbjct: 358 PPPSP 362 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P RPP P PPPP PPP PPP Sbjct: 372 PPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP 405 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPP 123 PPP PS PP P RPP P PPPP PPP PPP Sbjct: 403 PPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP 436 [191][TOP] >UniRef100_Q00ZZ2 Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins (ISS) n=1 Tax=Ostreococcus tauri RepID=Q00ZZ2_OSTTA Length = 685 Score = 53.1 bits (126), Expect = 9e-06 Identities = 32/76 (42%), Positives = 35/76 (46%), Gaps = 4/76 (5%) Frame = -2 Query: 251 PALTVTGAVPP----PGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPAVASRAGRDYCSS 84 P + A+PP RA S TPP P PP PPPPPPPPPP PPP + Sbjct: 501 PGSSAPMAMPPVTLASARAASTTPPPP--PPPPPPPPPPPPPPPPPPPTTTGG------- 551 Query: 83 H*RWPVRERPSTGGPP 36 VR PS PP Sbjct: 552 -----VRSPPSHPPPP 562 [192][TOP] >UniRef100_B9HGL7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HGL7_POPTR Length = 1486 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 6/43 (13%) Frame = -2 Query: 233 GAVPPPGRAPSLTPPLP*RPPHPPPPPPPP-PPEL-----PPP 123 G+ PPP +P PPLP PP PPPPPPPP PP+L PPP Sbjct: 1200 GSPPPPPDSPPPPPPLPSSPPPPPPPPPPPLPPQLSTSLSPPP 1242 [193][TOP] >UniRef100_B9G7A3 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9G7A3_ORYSJ Length = 1224 Score = 53.1 bits (126), Expect = 9e-06 Identities = 34/87 (39%), Positives = 39/87 (44%), Gaps = 13/87 (14%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELP----PPAVASRAGRDYCS- 87 P + +VPPP P PPLP PPPPPPPPPP LP PP A G + + Sbjct: 599 PPILPNRSVPPPPPPP---PPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAP 655 Query: 86 --------SH*RWPVRERPSTGGPPCP 30 S R P S+ GPP P Sbjct: 656 PPPPPPPRSSSRTPTGAATSSKGPPPP 682 [194][TOP] >UniRef100_A8HYC3 Hydroxyproline-rich glycoprotein n=1 Tax=Chlamydomonas reinhardtii RepID=A8HYC3_CHLRE Length = 612 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPPPA 120 PAL PPP PS PP P PP PPPP PPPP PPPA Sbjct: 499 PALCCPSPPPPPPLPPSPPPPSP--PPPSPPPPSPPPPSPPPPA 540 [195][TOP] >UniRef100_Q7YY78 Protease, possible n=2 Tax=Cryptosporidium parvum RepID=Q7YY78_CRYPV Length = 1562 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELPP 126 PPP + S +PP P PP PPPPPPPPPP PP Sbjct: 1529 PPPSSSSSPSPPPPPPPPPPPPPPPPPPPPPPP 1561 [196][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/38 (63%), Positives = 24/38 (63%), Gaps = 5/38 (13%) Frame = -2 Query: 221 PPGRAPSLTPPLP*RPPHPPPPPP-----PPPPELPPP 123 P G P LTPP P PP PPPPPP PPPP LPPP Sbjct: 1200 PAGPPPPLTPPPPPLPPPPPPPPPLPPPPPPPPPLPPP 1237 [197][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPPPPPPPPELP--PPA 120 PPP PS PP P PP PPPPPPPPPP P PPA Sbjct: 311 PPPPPLPSPPPPPPTPPPPPPPPPPPPPPNPPFIPPA 347 [198][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/39 (61%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -2 Query: 224 PPPGRAPSLTPPLP*RPPHPPPP-PPPPPPELPPPAVAS 111 PPP PS PLP PP PPPP PPPPPP PPP +S Sbjct: 32 PPPPPPPSPPSPLPPSPPPPPPPSPPPPPPSQPPPPPSS 70 [199][TOP] >UniRef100_Q7G6K7 Formin-like protein 3 n=1 Tax=Oryza sativa Japonica Group RepID=FH3_ORYSJ Length = 1234 Score = 53.1 bits (126), Expect = 9e-06 Identities = 34/87 (39%), Positives = 39/87 (44%), Gaps = 13/87 (14%) Frame = -2 Query: 251 PALTVTGAVPPPGRAPSLTPPLP*RPPHPPPPPPPPPPELP----PPAVASRAGRDYCS- 87 P + +VPPP P PPLP PPPPPPPPPP LP PP A G + + Sbjct: 609 PPILPNRSVPPPPPPP---PPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAP 665 Query: 86 --------SH*RWPVRERPSTGGPPCP 30 S R P S+ GPP P Sbjct: 666 PPPPPPPRSSSRTPTGAATSSKGPPPP 692