[UP]
[1][TOP] >UniRef100_O35328 Proline-rich protein 9-1 (Fragment) n=1 Tax=Mus musculus RepID=O35328_MOUSE Length = 181 Score = 66.6 bits (161), Expect = 8e-10 Identities = 31/53 (58%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = -3 Query: 320 QARLNARRPPSHGSRRCPPPPAPPSQP--PPPLLQPLPPTPPPPPPRPSLQTP 168 +AR+ RPP H RR PPPP PP +P PP L P PP+PPPPPPRPS P Sbjct: 123 RARVLPLRPPPHRPRRPPPPPPPPRRPLLPPLLPPPTPPSPPPPPPRPSEGKP 175 [2][TOP] >UniRef100_UPI0000500D8A UPI0000500D8A related cluster n=1 Tax=Rattus norvegicus RepID=UPI0000500D8A Length = 169 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 2/49 (4%) Frame = -3 Query: 320 QARLNARRPPSHGSRRCPPPPAPPSQP--PPPLLQPLPPTPPPPPPRPS 180 +AR+ RPP H RR PPPP PP +P PP L P PP+PPPPPPRPS Sbjct: 121 RARVLPLRPPPHRPRRPPPPPPPPRRPLLPPLLPPPTPPSPPPPPPRPS 169 [3][TOP] >UniRef100_Q4U2V7 Hydroxyproline-rich glycoprotein GAS31 n=1 Tax=Chlamydomonas reinhardtii RepID=Q4U2V7_CHLRE Length = 647 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/68 (44%), Positives = 32/68 (47%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAI 120 RPP PPPP PP PPPP P PP PPPPPP P L PL + P D + Sbjct: 240 RPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSPCDCL 299 Query: 119 LIFAANSS 96 N S Sbjct: 300 SPLIDNHS 307 [4][TOP] >UniRef100_B7Q6P6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q6P6_IXOSC Length = 97 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/70 (45%), Positives = 35/70 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP PPPP PP PPPP P PP PPPPPP P P Q Q +VDA+ Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCSQQAQRRVDAVE 77 Query: 116 IFAANSSEQP 87 + A SS P Sbjct: 78 V-APRSSVWP 86 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 P +R PPPP PP PPPP P PP PPPPPP P P Sbjct: 9 PVASTRETPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [5][TOP] >UniRef100_B3RJQ3 Putative uncharacterized protein n=1 Tax=Trichoplax adhaerens RepID=B3RJQ3_TRIAD Length = 706 Score = 60.8 bits (146), Expect = 4e-08 Identities = 30/59 (50%), Positives = 32/59 (54%) Frame = -3 Query: 308 NARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHK 132 N +PPS + PPPP PP PPPP PLPP PPPPPP P LQ QHK Sbjct: 261 NTFQPPSLPPQPPPPPPPPPPLPPPPPPPPLPPQPPPPPPPP----------LQPQQHK 309 [6][TOP] >UniRef100_B0TGJ1 Putative uncharacterized protein n=1 Tax=Heliobacterium modesticaldum Ice1 RepID=B0TGJ1_HELMI Length = 256 Score = 60.5 bits (145), Expect = 6e-08 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP R CPPPP PP PPPP P PP PPPPPP P P Sbjct: 59 PPPPPPRPCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPPRP P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCPPPP 71 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP +P PP PPPPPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPRPCPPPPPPPPPPPPPPPP 83 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/42 (54%), Positives = 23/42 (54%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 P R PPPP PP PPPP P PP PPPPPP P P Sbjct: 16 PIAPERIIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRPCP 68 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPPRP P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPP--PPPPPPPPPPPPRPCPPPP 109 [7][TOP] >UniRef100_UPI0000DB6CCB PREDICTED: hypothetical protein n=1 Tax=Apis mellifera RepID=UPI0000DB6CCB Length = 394 Score = 60.1 bits (144), Expect = 8e-08 Identities = 27/47 (57%), Positives = 28/47 (59%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 PP PPPP PP PPPPL P PP PP PPP PSL PL +T Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTT 296 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP PPPP PP PPPP P PP PPPPPP P L P S L P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLP 294 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P L P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/85 (35%), Positives = 34/85 (40%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP PPPP PP PPPP P PP PPPPPP P P L P + L Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPL 293 Query: 116 IFAANSSEQPREQKPKLSGLAPNRS 42 + + P +P P S Sbjct: 294 PTTSATVAPPSTSQPTQLSTTPTSS 318 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 [8][TOP] >UniRef100_UPI0000D9ED10 PREDICTED: similar to activating transcription factor 5 isoform 1 n=1 Tax=Macaca mulatta RepID=UPI0000D9ED10 Length = 288 Score = 59.7 bits (143), Expect = 1e-07 Identities = 38/92 (41%), Positives = 44/92 (47%), Gaps = 10/92 (10%) Frame = -3 Query: 266 PPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQ--HKVDAILIFAANSSE 93 PPP+PP PPPP PP PPPPPP PSL PL S L P +D + I+ N + Sbjct: 123 PPPSPPPPPPPP-----PPPPPPPPPGPSLSLPLPSFDLPQPPVLDTLDLLAIYCRNEAG 177 Query: 92 Q--------PREQKPKLSGLAPNRSAWHPELH 21 Q P Q+P L L P S P H Sbjct: 178 QGEVGMPPLPMPQQP-LPPLPPQPSRLAPYPH 208 [9][TOP] >UniRef100_A6UHC7 Outer membrane autotransporter barrel domain n=1 Tax=Sinorhizobium medicae WSM419 RepID=A6UHC7_SINMW Length = 864 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/43 (60%), Positives = 27/43 (62%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP S PPPP+PP PPPP P PP PPPPPP PS TP Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/48 (50%), Positives = 29/48 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 PP PPPP PPS PPPP P PP PPPPPP P +P++ ++ Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSV 543 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PPS PPPP P PP PPPPPP P P Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 [10][TOP] >UniRef100_Q5VR02 Hydroxyproline-rich glycoprotein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q5VR02_ORYSJ Length = 1026 Score = 59.3 bits (142), Expect = 1e-07 Identities = 32/61 (52%), Positives = 33/61 (54%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 RQA A PP+ S P PPAPP PPPP L P P PPPPPP PS PL S Sbjct: 511 RQAASRAPSPPAPPSPPAPSPPAPP--PPPPALSP--PAPPPPPPAPSPPAPLPPPPAPS 566 Query: 143 P 141 P Sbjct: 567 P 567 [11][TOP] >UniRef100_B7P5E7 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7P5E7_IXOSC Length = 129 Score = 59.3 bits (142), Expect = 1e-07 Identities = 34/90 (37%), Positives = 39/90 (43%), Gaps = 1/90 (1%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP PPPP PP PPPP P PP PPPPPP P P T + P + Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPHITKISLPFFNALIEI 73 Query: 116 IFAANSSEQPREQKP-KLSGLAPNRSAWHP 30 IF ++ P E L L P + HP Sbjct: 74 IFLITNTLPPEEPASLHLPELPPVTAVAHP 103 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 [12][TOP] >UniRef100_UPI000176023F PREDICTED: similar to protein kinase beta like (3E511) n=1 Tax=Danio rerio RepID=UPI000176023F Length = 639 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/47 (61%), Positives = 31/47 (65%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 PS G+ PPPAPP QPPPP P PP PPPPPP PS PLSS + Sbjct: 346 PSPGTA---PPPAPPPQPPPP---PPPPPPPPPPPPPSRCNPLSSLI 386 [13][TOP] >UniRef100_UPI00005A3EA7 PREDICTED: similar to mastermind-like 2 n=1 Tax=Canis lupus familiaris RepID=UPI00005A3EA7 Length = 1136 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = -3 Query: 335 GQRLRQARLNARRPPS-HGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSS 159 GQ++ A + +P H +++ PPP PP QPPPP QP P PPPPPP+P P S Sbjct: 579 GQQMPSALPSQSKPSLLHYTQQQPPPAQPPPQPPPPPPQPQPQPPPPPPPQPQ-PPPSSV 637 Query: 158 TLLQSPQ 138 + Q PQ Sbjct: 638 SAQQQPQ 644 [14][TOP] >UniRef100_Q9FXA1 AT1G49750 protein n=1 Tax=Arabidopsis thaliana RepID=Q9FXA1_ARATH Length = 494 Score = 58.9 bits (141), Expect = 2e-07 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP CPPPP+PP PPPP L P P PPP PP+P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 [15][TOP] >UniRef100_Q53N23 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q53N23_ORYSJ Length = 376 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/61 (47%), Positives = 32/61 (52%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 RQA A PP+ S PPP P PPPP P PP PPPPPP P TP + Q+ Sbjct: 68 RQAASPAPSPPAPPSPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPPPCPPTPPKTRSRQA 127 Query: 143 P 141 P Sbjct: 128 P 128 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 P + P PPAPPS PPPP P PP PPPPPP PS P Sbjct: 66 PGRQAASPAPSPPAPPSPPPPP-PAPSPPAPPPPPPAPSPPAP 107 [16][TOP] >UniRef100_Q7YYP5 Hydroxyproline-rich glycoprotein dz-hrgp, probable n=1 Tax=Cryptosporidium parvum RepID=Q7YYP5_CRYPV Length = 203 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/56 (50%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQP----LPPTPPPPPPRPSLQTPLSSTLLQSP 141 P G PPPP PP PPPPL P PP PPPPPP P L +P TL P Sbjct: 68 PYQSGGSTFPPPPPPPPPPPPPLQAPSNEDFPPPPPPPPPPPPLPSPPPPTLPPPP 123 [17][TOP] >UniRef100_Q5CWS3 Putative uncharacterized protein (Fragment) n=1 Tax=Cryptosporidium parvum Iowa II RepID=Q5CWS3_CRYPV Length = 296 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/56 (50%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQP----LPPTPPPPPPRPSLQTPLSSTLLQSP 141 P G PPPP PP PPPPL P PP PPPPPP P L +P TL P Sbjct: 161 PYQSGGSTFPPPPPPPPPPPPPLQAPSNEDFPPPPPPPPPPPPLPSPPPPTLPPPP 216 [18][TOP] >UniRef100_Q852P0 Pherophorin n=1 Tax=Volvox carteri f. nagariensis RepID=Q852P0_VOLCA Length = 606 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/43 (58%), Positives = 26/43 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP S PPPP PP PPPP P PP+PPPPPP PS P Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPP 265 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP S PPPP PP PPPP P PP+PPPPPP P +P Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP+PPPPPP P +P Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP P PPPP P PP PPPPPP PS P Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/44 (56%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLP-PTPPPPPPRPSLQTP 168 PP PPPP PPS PPPP P P P PPPPPP PS P Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PPS PPPP P P+PPPPPP PS P Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPP--PPPSPSPPPPPPSPSPPPP 276 [19][TOP] >UniRef100_C5YTP4 Putative uncharacterized protein Sb08g006730 n=1 Tax=Sorghum bicolor RepID=C5YTP4_SORBI Length = 380 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHK 132 PPPP PP PPPP P PP PPPPPP P P S +L +P ++ Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPANR 56 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPS 180 PP PPPP PP PPPP P PP PPPPPP+PS Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPS 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/52 (46%), Positives = 27/52 (51%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP PPPP PP PPPP P PP PPPPPP P L + ++P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPSEILPAPANRAP 58 [20][TOP] >UniRef100_C5XW81 Putative uncharacterized protein Sb04g005115 n=1 Tax=Sorghum bicolor RepID=C5XW81_SORBI Length = 782 Score = 58.5 bits (140), Expect = 2e-07 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 PPPP PP PPPP P PPTPPPPPPRP P+ Sbjct: 420 PPPPPPPPPPPPPPPPPPPPTPPPPPPRPPSPPPV 454 [21][TOP] >UniRef100_UPI0000F2E472 PREDICTED: hypothetical protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2E472 Length = 551 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPP 189 RPPS + PPPP PP PPPP + PLPP PPPPPP Sbjct: 416 RPPSPAAPS-PPPPPPPPPPPPPHMSPLPPPPPPPPP 451 [22][TOP] >UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86 RepID=Q4A2B5_EHV86 Length = 2332 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/53 (54%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPP-PPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPS PP P PPS PP PP PLPP+PPPPPP P L P S Q P Sbjct: 2178 PPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPPPPSPPPSQPP 2230 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPP--PPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP PPPP+PP+ PP PP PLPP P PPPP P P S L SP Sbjct: 2156 PPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSPLPPSP 2209 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/53 (50%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -3 Query: 296 PPSHGSRRCP-PPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPS P PPP+PP PPPPL P PP+PPPP P P + P S L P Sbjct: 1582 PPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPP 1634 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP+PP PPPP P PP PPPP P P L P Sbjct: 687 PPSPSPPPSPPPPSPPPSPPPP--SPPPPLPPPPLPPPPLPPP 727 Score = 54.3 bits (129), Expect = 4e-06 Identities = 35/87 (40%), Positives = 44/87 (50%), Gaps = 4/87 (4%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPP--PPRPSLQTPLSSTLLQSPQHKVDA 123 PP S PPPP+ PPPP L P PP PPP PP PS TP + P+ + + Sbjct: 1831 PPPPSSSPSPPPPSSSPSPPPPSLSPSPPPSPPPSSPPPPSPPTPPA-----PPRPFLVS 1885 Query: 122 ILIFAAN-SSEQPREQKPKL-SGLAPN 48 + I A SS P E+ P + SG P+ Sbjct: 1886 LDIIATQPSSSNPPERYPYIGSGATPD 1912 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP+ PPP PP PPPPL P PP+PPPP P P L P Sbjct: 805 PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPP 847 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP+ PPP PP PPPPL P PP+PPPP P P L P Sbjct: 896 PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPP 938 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP+ PPP PP PPPPL P PP+PPPP P P L P Sbjct: 983 PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPP 1025 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP+ PPP PP PPPPL P PP+PPPP P P L P Sbjct: 1074 PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPP 1116 [23][TOP] >UniRef100_B7QC44 Proline-rich protein, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QC44_IXOSC Length = 116 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/53 (52%), Positives = 30/53 (56%) Frame = -3 Query: 326 LRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 L+Q+R NA PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 36 LQQSR-NAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/55 (47%), Positives = 27/55 (49%) Frame = -3 Query: 332 QRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 Q+ R A PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 37 QQSRNAHSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQ 174 PP PPPP PP PPPP P PP PPPPPP P Q Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 99 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQWEP 102 [24][TOP] >UniRef100_A8NTE1 Formin Homology 2 Domain containing protein n=1 Tax=Brugia malayi RepID=A8NTE1_BRUMA Length = 1113 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPT---PPPPPPRPSLQTPL 165 PP+ G + PPPP PP PPPPL LPP+ PPPPPP P PL Sbjct: 510 PPAPGHQIAPPPPPPPPPPPPPLPPSLPPSGSCPPPPPPPPPPPPPL 556 [25][TOP] >UniRef100_A8NM82 Formin Homology 2 Domain containing protein (Fragment) n=1 Tax=Brugia malayi RepID=A8NM82_BRUMA Length = 1023 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/47 (55%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPT---PPPPPPRPSLQTPL 165 PP+ G + PPPP PP PPPPL LPP+ PPPPPP P PL Sbjct: 565 PPAPGHQIAPPPPPPPPPPPPPLPPSLPPSGSCPPPPPPPPPPPPPL 611 [26][TOP] >UniRef100_UPI0001982DE4 PREDICTED: similar to leucine-rich repeat family protein n=1 Tax=Vitis vinifera RepID=UPI0001982DE4 Length = 569 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PPS PPPP P PP PPPPPP P P Sbjct: 157 PPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 199 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/70 (44%), Positives = 34/70 (48%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP S PPPP+PP PPPP P PP PPPPPP P P+ K AI Sbjct: 160 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVDRNARLKIALK--AIR 217 Query: 116 IFAANSSEQP 87 IF A + P Sbjct: 218 IFQAKITVDP 227 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PP CPPPP P PPPP P PP+PPPPPP PS P S Sbjct: 122 PPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPPPP-PSPPPPPS 165 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP CPPPP P PPPP P PP PP PPP PS P Sbjct: 113 PPPEYEEGCPPPPPEPECPPPPPPSPPPPPPPSPPPPPSPPPP 155 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PPS PPPP P PP PPPPP P P Sbjct: 143 PPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPP 185 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS P PP PPS PPPP P PP PPPPPP P P Sbjct: 149 PPSPPPPPPPSPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 191 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS P PP PPS PPPP P PP PPPPP PS P Sbjct: 135 PPSPPPPPPPSPPPPPSPPPPPPPSPPPPPSPPPPPPPSPPPP 177 [27][TOP] >UniRef100_UPI0000F2AE0C PREDICTED: similar to hCG1781691 n=1 Tax=Monodelphis domestica RepID=UPI0000F2AE0C Length = 358 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/86 (36%), Positives = 38/86 (44%), Gaps = 1/86 (1%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS-STLLQSPQHKVDAIL 117 P G C P P QPPPP P PP PPPPPP P +P S LL H+ Sbjct: 2 PESGQEPCSNPSTQPPQPPPPPPPPPPPPPPPPPPPPPKDSPFSIKNLLNGDHHRA---- 57 Query: 116 IFAANSSEQPREQKPKLSGLAPNRSA 39 P++Q+P + AP +A Sbjct: 58 --------PPKQQQPPRTLFAPASAA 75 [28][TOP] >UniRef100_UPI0000E7FF26 PREDICTED: similar to MSC protein n=1 Tax=Gallus gallus RepID=UPI0000E7FF26 Length = 558 Score = 57.8 bits (138), Expect = 4e-07 Identities = 31/81 (38%), Positives = 41/81 (50%), Gaps = 1/81 (1%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 R R +AR + RCP PP PP+ PPPP Q PPPPPP ++ T S + Sbjct: 310 RSPRASARTLRGGAAPRCPQPPRPPALPPPPPPQQQQQQPPPPPPPGAMSTGSGSEAEEL 369 Query: 143 PQHKVDAI-LIFAANSSEQPR 84 P+ + A+ L + A QPR Sbjct: 370 PEMDLRALQLDYPAAGKRQPR 390 [29][TOP] >UniRef100_UPI0000D9EC9F PREDICTED: similar to Myb protein P42POP n=1 Tax=Macaca mulatta RepID=UPI0000D9EC9F Length = 468 Score = 57.8 bits (138), Expect = 4e-07 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 6/110 (5%) Frame = -3 Query: 362 CTWRDNVCHGQRLRQARLNARRPPSHGSRRC--PPPPAPPSQPPPPLLQ--PLPPTPPPP 195 CT ++ C + R++ + P R PPPPAPP PPPPL Q P PP+PPPP Sbjct: 188 CTPQEGGCPRPKERESPPPSALQPVQLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPP 247 Query: 194 P-PRPSLQ-TPLSSTLLQSPQHKVDAILIFAANSSEQPREQKPKLSGLAP 51 P P P+L + S L++ Q +AI A + + LS L P Sbjct: 248 PRPPPTLSASDPSLDFLRAQQETANAIRELAGTLRQGLAKLSEALSALLP 297 [30][TOP] >UniRef100_Q9XER9 Putative transcription factor n=1 Tax=Arabidopsis thaliana RepID=Q9XER9_ARATH Length = 1392 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/46 (60%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLP-PTPPPPPPRPSLQTPLS 162 PP + PP P PPSQPPPP L P P P PPPPPP SL T LS Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPSQSLTTQLS 1137 [31][TOP] >UniRef100_Q7XNA5 OSJNBa0011E07.13 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XNA5_ORYSJ Length = 547 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/58 (50%), Positives = 32/58 (55%) Frame = -3 Query: 314 RLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 R A R PS + PP P+PP+ PPPP P PP PPPPPP PS P S SP Sbjct: 68 RQAASRAPSLPAPLSPPAPSPPAPPPPPPA-PSPPVPPPPPPAPSSPAPPSPPAPSSP 124 [32][TOP] >UniRef100_Q3HTL0 Pherophorin-V1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q3HTL0_VOLCA Length = 590 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP S PPPP PP PPPP P PP+PPPPP P PL + SP Sbjct: 221 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSP 272 Score = 56.2 bits (134), Expect = 1e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 P S S+ PPPP PP P PP P PP+PPPPPP P +P Sbjct: 197 PTSRASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSP 239 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PPS PPPP P PPPP P PP PPPPPP PS P S Sbjct: 212 PPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPS 256 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP S PP P PP PPPP P PP+PPPPPP P +P Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 251 [33][TOP] >UniRef100_Q01DC8 Plg protein (ISS) n=1 Tax=Ostreococcus tauri RepID=Q01DC8_OSTTA Length = 3738 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/39 (61%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -3 Query: 272 CPPPPAPPSQPPPPL----LQPLPPTPPPPPPRPSLQTP 168 CPPPPAPPS PPPP P PP+PPPPPP P +P Sbjct: 4 CPPPPAPPSPPPPPSPPPPPSPAPPSPPPPPPSPPPPSP 42 [34][TOP] >UniRef100_Q010M7 Predicted membrane protein (Patched superfamily) (ISS) n=1 Tax=Ostreococcus tauri RepID=Q010M7_OSTTA Length = 1449 Score = 57.8 bits (138), Expect = 4e-07 Identities = 29/52 (55%), Positives = 29/52 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPS PPPP PP PPPP P PPTPP PPP PS P SS SP Sbjct: 796 PPSPPPPPSPPPPPPPPSPPPP---PNPPTPPSPPPPPSPPPPPSSPPPPSP 844 Score = 53.5 bits (127), Expect = 7e-06 Identities = 32/62 (51%), Positives = 34/62 (54%) Frame = -3 Query: 326 LRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQ 147 L QAR + PPS PPPP PPS PPPP P PP PP PPP P+ TP S Sbjct: 780 LGQARQSP--PPS------PPPPLPPSPPPPP-SPPPPPPPPSPPPPPNPPTPPSPPPPP 830 Query: 146 SP 141 SP Sbjct: 831 SP 832 [35][TOP] >UniRef100_A8P059 Pherophorin-dz1 protein, putative n=1 Tax=Brugia malayi RepID=A8P059_BRUMA Length = 351 Score = 57.8 bits (138), Expect = 4e-07 Identities = 24/43 (55%), Positives = 27/43 (62%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP + CPPPP+PP PPPP QP PP P PPP P+ TP Sbjct: 146 PPPPPPKPCPPPPSPPPCPPPPPPQPCPPPPLPPPCPPTYCTP 188 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/54 (50%), Positives = 29/54 (53%), Gaps = 11/54 (20%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPP-----SQPPPPLLQPLP------PTPPPPPPRPSLQTP 168 PP + CPPPPAPP S PPPPL P P P PPPPPP+P P Sbjct: 105 PPPLPPKPCPPPPAPPPCPPQSCPPPPLPPPCPKPPPPIPCPPPPPPKPCPPPP 158 [36][TOP] >UniRef100_C9J4Y2 Putative uncharacterized protein ENSP00000410265 (Fragment) n=1 Tax=Homo sapiens RepID=C9J4Y2_HUMAN Length = 253 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPP PPS PPPPLL P PP P PPPP P P Sbjct: 118 PPSPPPPPLSPPPPPPSPPPPPLLSPPPPPPSPPPPPPPSPPP 160 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPP--TPPPPPPRPSLQTP 168 PPS PPPP PPS PPPP QP PP +PPPPPP PS P Sbjct: 45 PPS------PPPPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPP 83 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/55 (50%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = -3 Query: 296 PPSHGSRRCPPP---PAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP S PPP P PPS PPPP P PP PPPP P P L +P L SP Sbjct: 50 PPPPPSPPPPPPSQPPPPPSSPPPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSP 104 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPPP PPS PPPP P PP P PPPP P P L SP Sbjct: 72 PPPPPPPSPPPPPPPSPPPPLPSPPPPPPLPSPPPPPPLPSSP 114 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/49 (55%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPL------LQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PPS PPPPL P PP PPPPPP PS P Sbjct: 195 PPS------PPPPPPPSPPPPPLPSPPAPSPPSPPLPPPPPPPPSPPPP 237 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPP 189 PPPP PPS PPPP P PP+PPPPPP Sbjct: 226 PPPPPPPSPPPPPPPSPPPPSPPPPPP 252 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 PP PPPP+ P PPPP P PP+PPPPPP PS +PL Sbjct: 2 PPPPSPPPPPPPPSSPPPPPPPSPPPPPPSPPPPPP-PSPPSPL 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP+PP PPP PLPP+PPPPPP PS P Sbjct: 18 PPPPPPSPPPPPPSPPPPPPPSPPSPLPPSPPPPPP-PSPPPP 59 [37][TOP] >UniRef100_Q9P6T1 Putative uncharacterized protein 15E6.220 n=1 Tax=Neurospora crassa RepID=Q9P6T1_NEUCR Length = 1992 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 26/108 (24%) Frame = -3 Query: 332 QRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPP------------ 189 Q+ ++ + ++PP PPPP PP+ PPPP P PP PPPPPP Sbjct: 30 QQHQEQKQQQQQPP-------PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Query: 188 ---RPSLQTPLSSTL------LQSPQHKVDAILI-----FAANSSEQP 87 PS P S L L +P HK+D++ + + NS +P Sbjct: 83 PPETPSQSQPQQSLLQPQPQVLDAPAHKLDSVALENGISYTLNSPPRP 130 [38][TOP] >UniRef100_A7UWD4 Predicted protein n=1 Tax=Neurospora crassa RepID=A7UWD4_NEUCR Length = 1895 Score = 57.8 bits (138), Expect = 4e-07 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 26/108 (24%) Frame = -3 Query: 332 QRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPP------------ 189 Q+ ++ + ++PP PPPP PP+ PPPP P PP PPPPPP Sbjct: 30 QQHQEQKQQQQQPP-------PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Query: 188 ---RPSLQTPLSSTL------LQSPQHKVDAILI-----FAANSSEQP 87 PS P S L L +P HK+D++ + + NS +P Sbjct: 83 PPETPSQSQPQQSLLQPQPQVLDAPAHKLDSVALENGISYTLNSPPRP 130 [39][TOP] >UniRef100_Q86VE0 Myb-related transcription factor, partner of profilin n=1 Tax=Homo sapiens RepID=MYPOP_HUMAN Length = 399 Score = 57.8 bits (138), Expect = 4e-07 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 6/110 (5%) Frame = -3 Query: 362 CTWRDNVCHGQRLRQARLNARRPPSHGSRRC--PPPPAPPSQPPPPLLQ--PLPPTPPPP 195 CT ++ C + R++ + P R PPPPAPP PPPPL Q P PP+PPPP Sbjct: 187 CTPQEGGCPRPKERESPPPSALQPVQLPRLALSPPPPAPPLPPPPPLAQVAPSPPSPPPP 246 Query: 194 P-PRPSLQ-TPLSSTLLQSPQHKVDAILIFAANSSEQPREQKPKLSGLAP 51 P P P+L + S L++ Q +AI A + + LS L P Sbjct: 247 PRPPPTLSASDPSLDFLRAQQETANAIRELAGTLRQGLAKLSEALSALLP 296 [40][TOP] >UniRef100_UPI0001868DB9 hypothetical protein BRAFLDRAFT_129698 n=1 Tax=Branchiostoma floridae RepID=UPI0001868DB9 Length = 491 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/64 (45%), Positives = 32/64 (50%), Gaps = 7/64 (10%) Frame = -3 Query: 338 HGQRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLP-------PTPPPPPPRPS 180 H Q++ QA +A PPS PPP PP PPPP P P P PPPPPP PS Sbjct: 12 HMQQVSQASTSAPPPPSPTPGGMAPPPPPPPPPPPPSNIPAPPPPPTSAPNPPPPPPAPS 71 Query: 179 LQTP 168 P Sbjct: 72 SNAP 75 [41][TOP] >UniRef100_Q7T318 Wiskott-Aldrich syndrome (Eczema-thrombocytopenia) n=1 Tax=Danio rerio RepID=Q7T318_DANRE Length = 479 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQ----PPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 P H +R PPPP PPSQ PPPP+ PP PPPPPP PS SS+ + S Sbjct: 338 PAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPPPSSSGNFSSSPVSS 392 [42][TOP] >UniRef100_B0S5G8 Wiskott-Aldrich syndrome (Eczema-thrombocytopenia) n=1 Tax=Danio rerio RepID=B0S5G8_DANRE Length = 479 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQ----PPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 P H +R PPPP PPSQ PPPP+ PP PPPPPP PS SS+ + S Sbjct: 338 PAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPPPSSSGNFSSSPVSS 392 [43][TOP] >UniRef100_B0S5G7 Wiskott-Aldrich syndrome (Eczema-thrombocytopenia) (Fragment) n=1 Tax=Danio rerio RepID=B0S5G7_DANRE Length = 271 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/55 (50%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQ----PPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 P H +R PPPP PPSQ PPPP+ PP PPPPPP PS SS+ + S Sbjct: 200 PAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPPPSSSGNFSSSPVSS 254 [44][TOP] >UniRef100_C1EA37 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EA37_9CHLO Length = 1765 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/44 (59%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPP-PRPSLQTP 168 PPS S PPPP PPS PPPP P PP PPPPP P P + P Sbjct: 1085 PPSPPSPPSPPPPPPPSPPPPPPPSPPPPRPPPPPSPPPPVHEP 1128 [45][TOP] >UniRef100_Q0UMH1 Putative uncharacterized protein n=1 Tax=Phaeosphaeria nodorum RepID=Q0UMH1_PHANO Length = 347 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/54 (51%), Positives = 31/54 (57%), Gaps = 4/54 (7%) Frame = -3 Query: 305 ARRPPSHGSRRCPPPPAPPSQ----PPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 AR PP G PPPAPPS PPPP +PP PPPPPP + +TP ST Sbjct: 112 ARAPPVPGGAPPAPPPAPPSSTPSAPPPPPPGAVPPAPPPPPPSSAPRTPARST 165 [46][TOP] >UniRef100_P21997 Sulfated surface glycoprotein 185 n=1 Tax=Volvox carteri RepID=SSGP_VOLCA Length = 485 Score = 57.4 bits (137), Expect = 5e-07 Identities = 27/56 (48%), Positives = 28/56 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKV 129 PPS PPPP PP PPPP P PP PPPPPP P +P SP V Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPV 310 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP PPPP PP PPPP P PP PPPPPP P P S + P Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 RPPS PP P PPS PPP P PP PPPPPP P P Sbjct: 240 RPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPP 283 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/56 (48%), Positives = 28/56 (50%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHK 132 RPPS PPP PP PPPP P PP+PPPPPP P P SP K Sbjct: 249 RPPSPPPPSPSPPPPPPPPPPPP--PPPPPSPPPPPPPPPPPPPPPPPPSPSPPRK 302 [47][TOP] >UniRef100_P48038 Acrosin heavy chain n=1 Tax=Oryctolagus cuniculus RepID=ACRO_RABIT Length = 431 Score = 57.4 bits (137), Expect = 5e-07 Identities = 26/60 (43%), Positives = 34/60 (56%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAI 120 RPP + + PPPP PP PPPP P PP PPPPPP S + P + + + Q V+ + Sbjct: 342 RPPQPPAAQAPPPPPPPPPPPPPPPPPPPPPPPPPPP-ASTKPPQALSFAKRLQQLVEVL 400 [48][TOP] >UniRef100_P10323 Acrosin heavy chain n=1 Tax=Homo sapiens RepID=ACRO_HUMAN Length = 421 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/49 (57%), Positives = 30/49 (61%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 RPP+ R PPP+PP PPPP PLPP PPPPPP PS T L L Sbjct: 338 RPPAAQPR---PPPSPPPPPPPPA-SPLPPPPPPPPPTPSSTTKLPQGL 382 [49][TOP] >UniRef100_UPI0001924514 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra magnipapillata RepID=UPI0001924514 Length = 490 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PP S PPPP PP PPPP P PP PPPPPP P+ +P S Sbjct: 374 PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTS 418 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/51 (50%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = -3 Query: 308 NARRPPSHGSRRC----PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 NA PP + C PPPP PP PPPP P PP+PPPPPP P P Sbjct: 342 NACCPPPPSANPCQPCPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 392 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/60 (45%), Positives = 28/60 (46%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP PPPP PP PPPP P PP PPPPPP P S T H D +L Sbjct: 371 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCPASCSPTSCGFGCHYRDRLL 430 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PPS PPPP P PP PPPPPP P P Sbjct: 363 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP+PP PPPP P PP PPPPPP P P Sbjct: 366 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 362 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 404 [50][TOP] >UniRef100_Q7XRA9 Os04g0438101 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XRA9_ORYSJ Length = 171 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/61 (42%), Positives = 30/61 (49%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP H PPPP PP PPPP P PP PPPPPP P P P + + I+ Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPNNIVVIV 76 Query: 116 I 114 + Sbjct: 77 V 77 [51][TOP] >UniRef100_P93797 Pherophorin-S n=1 Tax=Volvox carteri RepID=P93797_VOLCA Length = 599 Score = 57.0 bits (136), Expect = 6e-07 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP+PP PPPP P PP PPPPPP P +P Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PP PPPP P PP PPPPPP P P Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 PP PPPP PPS PPPP P PP PPPPPP P P+ Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPV 303 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 [52][TOP] >UniRef100_B7QF53 Putative uncharacterized protein n=1 Tax=Ixodes scapularis RepID=B7QF53_IXOSC Length = 958 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS-STLLQSPQ 138 PP PPPP PP PPPP P PP PPPPPP PS +S TL++ Q Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSIPTLIEEAQ 545 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/41 (58%), Positives = 24/41 (58%) Frame = -3 Query: 290 SHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 SH S PPPP PP PPPP P PP PPPPPP P P Sbjct: 484 SHLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/53 (47%), Positives = 28/53 (52%) Frame = -3 Query: 341 CHGQRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 C +L + L+ PP PPPP PP PPPP P PP PPPPPP P Sbjct: 476 CIDVQLVFSHLSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/48 (50%), Positives = 26/48 (54%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 PP PPPP PP PPPP P PP PPPPPP P T S ++ Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSTHKSMSI 537 [53][TOP] >UniRef100_B7PNV6 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PNV6_IXOSC Length = 74 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQH 135 PPPP PP PPPP P PP PPPPPP P Q L+ +PQH Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTQEDLAGG--NAPQH 43 [54][TOP] >UniRef100_UPI0001661EAE PREDICTED: similar to Putative acrosin-like protease n=1 Tax=Homo sapiens RepID=UPI0001661EAE Length = 355 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/49 (57%), Positives = 30/49 (61%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 RPP+ R PPP+PP PPPP PLPP PPPPPP PS T L L Sbjct: 272 RPPAAQPR---PPPSPPPPPPPPP-SPLPPPPPPPPPTPSSTTKLPQGL 316 [55][TOP] >UniRef100_Q9M3G8 Putative proline-rich protein n=1 Tax=Arabidopsis thaliana RepID=Q9M3G8_ARATH Length = 219 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 14/66 (21%) Frame = -3 Query: 287 HGSRRCPPPPAPPSQPPPPLLQPL--------------PPTPPPPPPRPSLQTPLSSTLL 150 H RR PPPP PP PPP + P+ PP PPPPPP P++ P+++T Sbjct: 114 HHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPPVTTTTT 173 Query: 149 QSPQHK 132 H+ Sbjct: 174 GHHHHR 179 [56][TOP] >UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q8L685_VOLCA Length = 1009 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP PLPP+PPPPPP P P Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP L P PP PPPPPP P P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PP PPPP P PP PPPPPP P P Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP PPPP PP PPPP P PP PPPPPP P P L SP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP S P PP PP PPPPL P PP PPPPPP P P Sbjct: 218 PPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 PP PPPP PPS PPPP P PP PPPPPP P Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 [57][TOP] >UniRef100_Q6SSE6 Plus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE6_CHLRE Length = 3409 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS S R P PP P PPPPLL P PP PPP PP P P Sbjct: 473 PPSPPSPRPPRPPPLPPSPPPPLLPPSPPVPPPSPPSPPSPPP 515 [58][TOP] >UniRef100_C5YH07 Putative uncharacterized protein Sb07g003820 n=1 Tax=Sorghum bicolor RepID=C5YH07_SORBI Length = 640 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/46 (54%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPR--PSLQTPL 165 PP +G PPPP P PPPP P P PPPPPP PS+Q PL Sbjct: 89 PPPYGGTSNPPPPPPSVPPPPPSPPPAAPPPPPPPPAQPPSVQAPL 134 [59][TOP] >UniRef100_B9RLU7 Putative uncharacterized protein n=1 Tax=Ricinus communis RepID=B9RLU7_RICCO Length = 1550 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/46 (54%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPP-----TPPPPPPRPSLQ 174 PP SR PPPP PP PPPP L+ PP +PPPPPP P L+ Sbjct: 894 PPPPPSRAAPPPPPPPPPPPPPPLRATPPPPLQGSPPPPPPPPQLR 939 [60][TOP] >UniRef100_Q01I59 H0315A08.9 protein n=2 Tax=Oryza sativa RepID=Q01I59_ORYSA Length = 168 Score = 56.6 bits (135), Expect = 8e-07 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP H PPPP PP PPPP P PP PPPPPP P P Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPS 180 PP PPPP PP PPPP P PP PPPPPP P+ Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPN 67 [61][TOP] >UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8J1N3_CHLRE Length = 527 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP+ S PPPP PP PPPP P PP P PPPP P +P Sbjct: 417 PPAPPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSP 459 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/45 (55%), Positives = 25/45 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PP P PPAPPS PPPP P PP PPPPPP P P S Sbjct: 406 PPPSPYPPSPAPPAPPSPPPPP--PPPPPPPPPPPPFPPFPPPPS 448 [62][TOP] >UniRef100_A8IZG7 Plus agglutinin protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IZG7_CHLRE Length = 559 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS S R P PP P PPPPLL P PP PPP PP P P Sbjct: 473 PPSPPSPRPPRPPPLPPSPPPPLLPPSPPVPPPSPPSPPSPPP 515 [63][TOP] >UniRef100_C3XQI3 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae RepID=C3XQI3_BRAFL Length = 628 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/58 (44%), Positives = 29/58 (50%), Gaps = 10/58 (17%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPP----------LLQPLPPTPPPPPPRPS 180 RQ + PP G PPPP PP PPPP + QP PP PPPPPP P+ Sbjct: 186 RQELIEHEEPPIQGDYEEPPPPPPPPPPPPPPPPEPIQPPVVRQPPPPPPPPPPPAPA 243 [64][TOP] >UniRef100_B7PDJ0 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PDJ0_IXOSC Length = 84 Score = 56.6 bits (135), Expect = 8e-07 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P L+ P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAP 42 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPPP PP PPPP P PP PPPPPP P PL + ++P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLRAPKGRAP 47 [65][TOP] >UniRef100_B4IT81 GE19010 n=1 Tax=Drosophila yakuba RepID=B4IT81_DROYA Length = 446 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/45 (55%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPP----PPRPSLQ 174 PP+ PP P P SQPPPP PLPPTPPPP PP P +Q Sbjct: 189 PPAQSQPPLPPSPPPTSQPPPPRQPPLPPTPPPPSQPSPPPPPMQ 233 [66][TOP] >UniRef100_B3N423 GG10874 n=1 Tax=Drosophila erecta RepID=B3N423_DROER Length = 395 Score = 56.6 bits (135), Expect = 8e-07 Identities = 33/77 (42%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = -3 Query: 392 RGVALPES*RCTWRDNVCHGQRLRQARLNARRPPSHGSRRCPP-PPAPPSQPPPPLLQPL 216 RG L + WR+ +R R ARL PP PP P+ PPPP Q Sbjct: 254 RGSPLCDGCSSWWRN-----ERQRLARLQEEEEALWAPPPQPPLPPKTPAPPPPPPTQTP 308 Query: 215 PPTPPPPPPRPSLQTPL 165 PP PPPPPP P QTPL Sbjct: 309 PPPPPPPPPPPRTQTPL 325 [67][TOP] >UniRef100_Q1DV84 Putative uncharacterized protein n=1 Tax=Coccidioides immitis RepID=Q1DV84_COCIM Length = 641 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS P PPAPP PPPP P PP PPPPPP PS P Sbjct: 486 PPSSSGPPAPGPPAPPPPPPPPSAAPAPP-PPPPPPMPSSSGP 527 [68][TOP] >UniRef100_Q2II18 Sporulation related protein n=1 Tax=Anaeromyxobacter dehalogenans 2CP-C RepID=Q2II18_ANADE Length = 242 Score = 56.2 bits (134), Expect = 1e-06 Identities = 44/113 (38%), Positives = 58/113 (51%), Gaps = 1/113 (0%) Frame = -2 Query: 339 SRPAAATGPTQRAATAVAWLQAVSPAASATVSAA-ATPATTATSDATTAAAAAVSANPPV 163 +RPAAA P AA A + A +PAA A + A A PA TA AT AAA + PP Sbjct: 98 ARPAAAPAPAPAAAPAPSAAPAPAPAAPAVAATAPAKPAATAAPAATPKPAAAPAPTPPA 157 Query: 162 QHLAPIPSTQG*RNLDLRSEFIRAAQGAEAEAERVSPK*KRLAP*IAQAELLG 4 AP P+ G + L AA + EAER++ K + L+P I A++ G Sbjct: 158 A-AAPKPAAAGAFAVQL------AATQSRTEAERIAAKYRALSPRIEAADVPG 203 [69][TOP] >UniRef100_UPI0001797C9D PREDICTED: similar to Protein enabled homolog n=1 Tax=Equus caballus RepID=UPI0001797C9D Length = 600 Score = 56.2 bits (134), Expect = 1e-06 Identities = 35/80 (43%), Positives = 40/80 (50%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAILI 114 P+ S PPPP PP PPPPL PP PPPPPP P+ P P + A Sbjct: 332 PAQASATLPPPPGPP--PPPPLPSSGPPPPPPPPPLPNQVPPPPP---PPPAPPLPASGF 386 Query: 113 FAANSSEQPREQKPKLSGLA 54 FAA+ SE R L+GLA Sbjct: 387 FAASMSEDNR----PLTGLA 402 [70][TOP] >UniRef100_UPI00016E7C99 UPI00016E7C99 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7C99 Length = 130 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 PPPP PP PPPP L P PP PPPPPP P L PL L Sbjct: 90 PPPPLPPPPPPPPPLPPPPPLPPPPPP-PPLPPPLPPPL 127 [71][TOP] >UniRef100_Q8PPF4 Putative uncharacterized protein n=1 Tax=Xanthomonas axonopodis pv. citri RepID=Q8PPF4_XANAC Length = 266 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/34 (64%), Positives = 22/34 (64%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P Q P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQPP 265 [72][TOP] >UniRef100_Q8LK02 Putative uncharacterized protein S126P21.5 n=1 Tax=Sorghum bicolor RepID=Q8LK02_SORBI Length = 769 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/99 (33%), Positives = 46/99 (46%), Gaps = 9/99 (9%) Frame = -3 Query: 308 NARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPP---------TPPPPPPRPSLQTPLSST 156 NA PP+ + PPP PP PPPP P PP PPPPPP P +P S+ Sbjct: 472 NAGSPPTPAAATPTPPPPPPRSPPPPPRSPTPPPRSPTPKRSAPPPPPPAP--PSPKSAW 529 Query: 155 LLQSPQHKVDAILIFAANSSEQPREQKPKLSGLAPNRSA 39 + SP + S ++ +++PK S P ++A Sbjct: 530 SVPSPPKR---------GSQKRSAQERPKSSVPPPKKAA 559 [73][TOP] >UniRef100_Q53LC9 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q53LC9_ORYSJ Length = 1779 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/69 (43%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPP--------SQPPPPLLQPLPPTPPPPPPRPSLQTP 168 RQA A PP+ S P PPAPP S PPPP P P PPPPPP P P Sbjct: 1345 RQAAFRAPSPPAPPSPPAPSPPAPPPPPAAPSPSAPPPPPAAPSPLAPPPPPPPPCPPAP 1404 Query: 167 LSSTLLQSP 141 + Q+P Sbjct: 1405 PKTRSRQAP 1413 [74][TOP] >UniRef100_Q2R967 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2R967_ORYSJ Length = 1775 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/69 (43%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPP--------SQPPPPLLQPLPPTPPPPPPRPSLQTP 168 RQA A PP+ S P PPAPP S PPPP P P PPPPPP P P Sbjct: 1341 RQAAFRAPSPPAPPSPPAPSPPAPPPPPAAPSPSAPPPPPAAPSPLAPPPPPPPPCPPAP 1400 Query: 167 LSSTLLQSP 141 + Q+P Sbjct: 1401 PKTRSRQAP 1409 [75][TOP] >UniRef100_Q2QVU2 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2QVU2_ORYSJ Length = 1008 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/71 (42%), Positives = 33/71 (46%), Gaps = 10/71 (14%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQ----------PPPPLLQPLPPTPPPPPPRPSLQ 174 RQA A PP+ S P PPAPP PPPP P PP PPPPPP P Sbjct: 519 RQAASRAPSPPAPPSPPAPTPPAPPPPPPAPSPLAPLPPPPAPSPPPPPPPPPPPPPCPP 578 Query: 173 TPLSSTLLQSP 141 P + Q+P Sbjct: 579 APPKTRSRQAP 589 [76][TOP] >UniRef100_B9RYC5 Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RYC5_RICCO Length = 510 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPS 180 PPS + PPPP PPS PPPP PP PPPPPPRP+ Sbjct: 93 PPSPPPPKHPPPPPPPSPPPPP-----PPPPPPPPPRPT 126 [77][TOP] >UniRef100_B7U9A4 Huntingtin n=1 Tax=Ovis aries RepID=B7U9A4_SHEEP Length = 3127 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/67 (40%), Positives = 36/67 (53%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 +Q + ++PP PPPP PP PPPP QP PP PPPPPP P + + L Sbjct: 19 QQQQQQQQQPP-------PPPPQPPQPPPPPQAQP-PPQPPPPPPPPPVGPAAAEEPLHR 70 Query: 143 PQHKVDA 123 P+ ++ A Sbjct: 71 PKKELSA 77 [78][TOP] >UniRef100_Q38EF1 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei RepID=Q38EF1_9TRYP Length = 576 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/56 (48%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Frame = -3 Query: 308 NARRPPSHGSRRCPPPP-----APPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 NA PP G PPPP APP + PPP + P PP PPPPPP P P T Sbjct: 515 NAPAPPQKGGVPPPPPPPPPPKAPPPKGPPPKVAPPPPPPPPPPPAPGKLPPKRKT 570 [79][TOP] >UniRef100_C9ZY65 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei gambiense DAL972 RepID=C9ZY65_TRYBG Length = 576 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/56 (48%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Frame = -3 Query: 308 NARRPPSHGSRRCPPPP-----APPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 NA PP G PPPP APP + PPP + P PP PPPPPP P P T Sbjct: 515 NAPAPPQKGGVPPPPPPPPPPKAPPPKGPPPKVAPPPPPPPPPPPAPGKLPPKRKT 570 [80][TOP] >UniRef100_B7QJX3 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QJX3_IXOSC Length = 86 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/71 (39%), Positives = 32/71 (45%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP PPPP PP PPPP P PP PPPPPP P PL + + Q + Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGSNMSYMQKPPRRHI 67 Query: 116 IFAANSSEQPR 84 F E+ R Sbjct: 68 AFTGGGYEENR 78 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/51 (50%), Positives = 26/51 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 PP PPPP PP PPPP P PP PPPPPP P P LL S Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLLGS 54 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 [81][TOP] >UniRef100_B7Q0P2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q0P2_IXOSC Length = 170 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/46 (54%), Positives = 26/46 (56%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSS 159 PP PPPP PP PPPP P PP PPPPPPR PLS+ Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTSRPLSA 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/51 (49%), Positives = 26/51 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 PP PPPP PP PPPP P PP PPPPPP P P L+ S Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRLVTS 103 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 [82][TOP] >UniRef100_B7PG51 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PG51_IXOSC Length = 84 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/62 (41%), Positives = 30/62 (48%) Frame = -3 Query: 302 RRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDA 123 R PP PPPP PP PPPP P PP PPPPPP P P + P ++ Sbjct: 1 RVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRDQTRYPPRRLSG 60 Query: 122 IL 117 +L Sbjct: 61 VL 62 [83][TOP] >UniRef100_B7PC88 Protein tonB, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC88_IXOSC Length = 88 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P +TP Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKTP 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 PPPP PP PPPP P PP PPPPPP P P T Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKT 46 [84][TOP] >UniRef100_A8QF93 EBNA-2 nuclear protein, putative n=1 Tax=Brugia malayi RepID=A8QF93_BRUMA Length = 101 Score = 56.2 bits (134), Expect = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -3 Query: 272 CPPPPAPPSQPPPPLLQPLPPTPPPPPPRPS 180 CPPPP PP PPPP P PP PPPPPP P+ Sbjct: 37 CPPPPPPPPPPPPPPPPPPPPPPPPPPPPPA 67 [85][TOP] >UniRef100_B7Z9A8 cDNA FLJ58392 n=1 Tax=Homo sapiens RepID=B7Z9A8_HUMAN Length = 688 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/49 (51%), Positives = 28/49 (57%) Frame = -3 Query: 287 HGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 H PPPP PP PPPP P PP PPPPPP P+L +S+L P Sbjct: 464 HAGASLPPPPPPPLPPPPP--PPPPPPPPPPPPPPALDVGETSSLQPPP 510 [86][TOP] >UniRef100_B7Z847 cDNA FLJ52583 n=1 Tax=Homo sapiens RepID=B7Z847_HUMAN Length = 1059 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/49 (51%), Positives = 27/49 (55%) Frame = -3 Query: 287 HGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 H PPPP PP PPPP P PP PPPPPP P+L +S L P Sbjct: 835 HAGASLPPPPPPPPPPPPP--PPPPPPPPPPPPPPALDVGETSNLQPPP 881 [87][TOP] >UniRef100_B7Z804 cDNA FLJ61626 n=1 Tax=Homo sapiens RepID=B7Z804_HUMAN Length = 1137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/49 (51%), Positives = 27/49 (55%) Frame = -3 Query: 287 HGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 H PPPP PP PPPP P PP PPPPPP P+L +S L P Sbjct: 913 HAGASLPPPPPPPPPPPPP--PPPPPPPPPPPPPPALDVGETSNLQPPP 959 [88][TOP] >UniRef100_B1AKD6 Asparagine-linked glycosylation 13 homolog (S. cerevisiae) n=1 Tax=Homo sapiens RepID=B1AKD6_HUMAN Length = 1137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/49 (51%), Positives = 27/49 (55%) Frame = -3 Query: 287 HGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 H PPPP PP PPPP P PP PPPPPP P+L +S L P Sbjct: 913 HAGASLPPPPPPPPPPPPP--PPPPPPPPPPPPPPALDVGETSNLQPPP 959 [89][TOP] >UniRef100_UPI00017F092D PREDICTED: similar to zinc finger protein 462 n=1 Tax=Sus scrofa RepID=UPI00017F092D Length = 2101 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQP---LPPTPPPPPPRPSLQTP 168 PPPP PPSQP PP LQP +PP P PPPP P Q P Sbjct: 549 PPPPPPPSQPQPPQLQPPHQVPPQPQPPPPPPPTQVP 585 [90][TOP] >UniRef100_UPI0000F2AF8E PREDICTED: similar to mKIAA0940 protein n=1 Tax=Monodelphis domestica RepID=UPI0000F2AF8E Length = 757 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/92 (35%), Positives = 45/92 (48%), Gaps = 4/92 (4%) Frame = -3 Query: 269 PPPPAPPSQPPPP----LLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAILIFAAN 102 PPPPAP QPPPP QP PP P PPPP+ ++P+S PQ AA Sbjct: 229 PPPPAPQPQPPPPPPQQQQQPPPPQPQPPPPQ-QRRSPVSPNQASYPQRNA------AAY 281 Query: 101 SSEQPREQKPKLSGLAPNRSAWHPELHKRNSW 6 S + KP + + + S+W+ H+ +W Sbjct: 282 SHQPIMTSKPSSASASSSSSSWNN--HQNAAW 311 [91][TOP] >UniRef100_UPI0000EBE712 PREDICTED: similar to MYST histone acetyltransferase (monocytic leukemia) 3 n=1 Tax=Bos taurus RepID=UPI0000EBE712 Length = 2018 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -3 Query: 296 PPSHGSRRCPPP-PAPPSQPPPPLLQPLPPTPPP----PPPRPSLQTPLS 162 PP S++ PPP P PP+ PPPP P PP PPP PPP P Q PLS Sbjct: 1668 PPPQPSQQPPPPQPQPPAPPPPPAQPPPPPPPPPQQPQPPPPPQQQPPLS 1717 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/86 (39%), Positives = 39/86 (45%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAI 120 RPPS + PPPP P QPPPP QP PP PPPPP +P P Q P Sbjct: 1660 RPPS---TQQPPPPQPSQQPPPP--QPQPPAPPPPPAQPPPPPPPPPQQPQPP------- 1707 Query: 119 LIFAANSSEQPREQKPKLSGLAPNRS 42 P +Q+P LS + N S Sbjct: 1708 ---------PPPQQQPPLSQCSMNNS 1724 [92][TOP] >UniRef100_UPI000179CEFB UPI000179CEFB related cluster n=1 Tax=Bos taurus RepID=UPI000179CEFB Length = 2012 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = -3 Query: 296 PPSHGSRRCPPP-PAPPSQPPPPLLQPLPPTPPP----PPPRPSLQTPLS 162 PP S++ PPP P PP+ PPPP P PP PPP PPP P Q PLS Sbjct: 1662 PPPQPSQQPPPPQPQPPAPPPPPAQPPPPPPPPPQQPQPPPPPQQQPPLS 1711 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/86 (39%), Positives = 39/86 (45%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAI 120 RPPS + PPPP P QPPPP QP PP PPPPP +P P Q P Sbjct: 1654 RPPS---TQQPPPPQPSQQPPPP--QPQPPAPPPPPAQPPPPPPPPPQQPQPP------- 1701 Query: 119 LIFAANSSEQPREQKPKLSGLAPNRS 42 P +Q+P LS + N S Sbjct: 1702 ---------PPPQQQPPLSQCSMNNS 1718 [93][TOP] >UniRef100_Q8LJ56 Putative uncharacterized protein OSJNBb0024F06.11 n=1 Tax=Oryza sativa Japonica Group RepID=Q8LJ56_ORYSJ Length = 812 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/53 (49%), Positives = 28/53 (52%), Gaps = 12/53 (22%) Frame = -3 Query: 305 ARRPPSHGSRRCPPPPAPPSQPPP------------PLLQPLPPTPPPPPPRP 183 +R+PP SR PPPP PP Q PP PL P PP PPPPPP P Sbjct: 652 SRKPPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPPPPP 704 [94][TOP] >UniRef100_Q0JLP7 Os01g0584100 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group RepID=Q0JLP7_ORYSJ Length = 263 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/53 (49%), Positives = 28/53 (52%), Gaps = 12/53 (22%) Frame = -3 Query: 305 ARRPPSHGSRRCPPPPAPPSQPPP------------PLLQPLPPTPPPPPPRP 183 +R+PP SR PPPP PP Q PP PL P PP PPPPPP P Sbjct: 103 SRKPPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPPPPP 155 [95][TOP] >UniRef100_C5Y6N1 Putative uncharacterized protein Sb05g005783 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5Y6N1_SORBI Length = 192 Score = 55.8 bits (133), Expect = 1e-06 Identities = 32/99 (32%), Positives = 43/99 (43%), Gaps = 11/99 (11%) Frame = -3 Query: 383 ALPES*RCTWRDNVCHG--QRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPP 210 ALP S C + N + + + A+ P PP P PP PP P P PP Sbjct: 7 ALPCSWPCAYAGNTSPSFPAEIATSGIKAKLPSHRSKSLSPPDPPPPPSPPDPPPPPSPP 66 Query: 209 TPPPPPPRPSL---------QTPLSSTLLQSPQHKVDAI 120 PPPPPP PS + P +T + + K+DA+ Sbjct: 67 HPPPPPPPPSQSHQPLAPRPKPPTLTTRMSKAEEKLDAL 105 [96][TOP] >UniRef100_C5XK05 Putative uncharacterized protein Sb03g034303 (Fragment) n=1 Tax=Sorghum bicolor RepID=C5XK05_SORBI Length = 115 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 P+ G PPPP PP QPP P P PP PPPPPP P P Sbjct: 4 PTSGDSVPPPPPLPPPQPPRPSRHPAPPPPPPPPPPPPPPPP 45 [97][TOP] >UniRef100_C1MY88 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1MY88_9CHLO Length = 1591 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -3 Query: 296 PPSHGSRRCPPPPAP-PSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP R PPPP+P P PPPP PLPP P PPPP PS P Sbjct: 1199 PPGQPPRPAPPPPSPPPPPPPPPPPPPLPPPPSPPPPPPSPPPP 1242 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PP PPPPL P PP+PPPPPP P +P Sbjct: 1210 PPS------PPPPPPPPPPPPPL--PPPPSPPPPPPSPPPPSP 1244 [98][TOP] >UniRef100_C1E4Y1 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E4Y1_9CHLO Length = 1031 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/46 (56%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = -3 Query: 296 PPSHG---SRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP G +R PPPP PS+PPPP P PP PPPPPPRP P Sbjct: 445 PPKPGPAREKRSPPPPPEPSRPPPP-PPPPPPPPPPPPPRPPPPNP 489 [99][TOP] >UniRef100_A2ZUS7 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A2ZUS7_ORYSJ Length = 792 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/53 (49%), Positives = 28/53 (52%), Gaps = 12/53 (22%) Frame = -3 Query: 305 ARRPPSHGSRRCPPPPAPPSQPPP------------PLLQPLPPTPPPPPPRP 183 +R+PP SR PPPP PP Q PP PL P PP PPPPPP P Sbjct: 632 SRKPPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPPPPP 684 [100][TOP] >UniRef100_Q559T7 Putative uncharacterized protein n=1 Tax=Dictyostelium discoideum RepID=Q559T7_DICDI Length = 242 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P L P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 PP+ PPPP PP PPPP P PP PPPPPP P PL Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 102 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 PP PPPP PP PPPP P PP PPPPPP P P L Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPSQENL 113 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP + PPPP PP PPPP P PP PPPPPP P P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 [101][TOP] >UniRef100_B7PKI2 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PKI2_IXOSC Length = 154 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/47 (53%), Positives = 26/47 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 PP PPPP PP PPPP P PP PPPPP R L P S+T Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSAT 118 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/65 (43%), Positives = 28/65 (43%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP PPPP PP PPPP P PP PPPPPP P P L P L Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQREHLPVPSSATATAL 122 Query: 116 IFAAN 102 AN Sbjct: 123 GARAN 127 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 51 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 52 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 58 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 60 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 102 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 61 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 103 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 104 [102][TOP] >UniRef100_A7UVF7 AGAP011901-PA (Fragment) n=1 Tax=Anopheles gambiae RepID=A7UVF7_ANOGA Length = 147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P L P Sbjct: 59 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 101 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 RPP PPPP PP PPPP P PP PPPPPP P P Sbjct: 26 RPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -3 Query: 311 LNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 L R PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 23 LPPRPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 PP PPPP PP PPPP P PP PPPPPP P PL Sbjct: 55 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 98 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/56 (44%), Positives = 26/56 (46%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKV 129 PP PPPP PP PPPP P PP PPPPPP P P L P + Sbjct: 50 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPRNI 105 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 41 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 83 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 46 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 47 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 89 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 48 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 49 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 [103][TOP] >UniRef100_Q96VI4 Protease 1 n=1 Tax=Pneumocystis carinii RepID=Q96VI4_PNECA Length = 938 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/54 (51%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTP-PPPPPRPSLQTPLSSTLLQSPQ 138 P S S PPP PP PPPP P PP P PPPPPRP L+ P + Q PQ Sbjct: 774 PTSTSSSEPPPPSPPPPPPPPPAPAPAPPPPPPPPPPRPELE-PEPEPVPQPPQ 826 [104][TOP] >UniRef100_C6H7E8 Predicted protein n=1 Tax=Ajellomyces capsulatus H143 RepID=C6H7E8_AJECH Length = 552 Score = 55.8 bits (133), Expect = 1e-06 Identities = 33/84 (39%), Positives = 40/84 (47%), Gaps = 8/84 (9%) Frame = -3 Query: 320 QARLNARRPPSHGSRRCPPPPA--------PPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 Q + R+PP S PPPP+ PP PPPP P PP PPPPPP S P Sbjct: 126 QTVIVTRQPPHTPSSPPPPPPSSAPLPQPPPPPPPPPPASAPPPPPPPPPPPPISPSLPP 185 Query: 164 SSTLLQSPQHKVDAILIFAANSSE 93 S+ + + AI+ A SSE Sbjct: 186 SNPPDRGGAFTLPAIMSLTAVSSE 209 [105][TOP] >UniRef100_Q6P9Q4 FH1/FH2 domain-containing protein 1 n=1 Tax=Mus musculus RepID=FHOD1_MOUSE Length = 1197 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/60 (46%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPP------PPRPSLQTPLSSTLLQSPQH 135 PP GS CPPPP PP PP P PP PPPP PP P L P + + L P+H Sbjct: 595 PPITGS--CPPPPPPPLPPPATGSCPPPPPPPPPPIIGSCPPPPPLAAPFTHSALDGPRH 652 [106][TOP] >UniRef100_UPI000192638B PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI000192638B Length = 557 Score = 52.0 bits (123), Expect(2) = 2e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 272 CPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 CPPP PP PPPP P PP PPPPPP P Sbjct: 253 CPPPCPPPCPPPPPPPPPPPPPPPPPPPPP 282 Score = 23.5 bits (49), Expect(2) = 2e-06 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 172 PPCPAPCSNP 143 PPCP PC P Sbjct: 281 PPCPPPCPPP 290 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 PP CPPPP PP PPPP P PP PP PPP P Sbjct: 296 PPPPPPPPCPPPPPPPPPPPPPCPPPPPPPPPCPPPCP 333 [107][TOP] >UniRef100_UPI00017C39A3 PREDICTED: similar to phosphodiesterase 4D isoform 1 n=1 Tax=Bos taurus RepID=UPI00017C39A3 Length = 806 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/58 (46%), Positives = 28/58 (48%) Frame = -3 Query: 356 WRDNVCHGQRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 WR H LRQ + P H PPPP P QP PL P PP PPPPPP P Sbjct: 33 WRHEQHHQYPLRQPQFRLLHPHHH----LPPPPPPSPQPQCPLQPPPPPLPPPPPPPP 86 [108][TOP] >UniRef100_UPI0000E817A4 PREDICTED: similar to KIAA0904 protein n=1 Tax=Gallus gallus RepID=UPI0000E817A4 Length = 1032 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/73 (43%), Positives = 37/73 (50%), Gaps = 7/73 (9%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPL--LQPLPPTPPPPPPRPSLQTPLS-----STLLQSPQ 138 PP S + PPPP P + PPPP L PLPP+P PP PS QTP+ T L S Sbjct: 529 PPPLPSIKSPPPPLPTTTPPPPTPPLPPLPPSPAVPPLPPSQQTPIQVPPSVPTSLSSSS 588 Query: 137 HKVDAILIFAANS 99 H + L NS Sbjct: 589 HPRTSTLSSQVNS 601 [109][TOP] >UniRef100_UPI0000E498A8 PREDICTED: hypothetical protein, partial n=1 Tax=Strongylocentrotus purpuratus RepID=UPI0000E498A8 Length = 58 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 PP PPPP PP PPPP P PP PPPPPPRP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRP 58 [110][TOP] >UniRef100_UPI00005EB969 PREDICTED: similar to SET binding protein 1 n=1 Tax=Monodelphis domestica RepID=UPI00005EB969 Length = 1549 Score = 55.5 bits (132), Expect = 2e-06 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P +TP Sbjct: 1475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPRTP 1508 [111][TOP] >UniRef100_UPI0001951234 Ras-associated and pleckstrin homology domains-containing protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein). n=1 Tax=Canis lupus familiaris RepID=UPI0001951234 Length = 1045 Score = 55.5 bits (132), Expect = 2e-06 Identities = 34/95 (35%), Positives = 43/95 (45%), Gaps = 5/95 (5%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP S PPPP PP PPPP PP PPPP P P+ PL++T SP Sbjct: 853 PPPESSLVFPPPPPPPPPPPPP-----PPPPPPPAPAPA-PPPLTATPTVSPASDKSGSP 906 Query: 116 IFAANSSEQPREQKP-----KLSGLAPNRSAWHPE 27 + + P +KP + S + + A HPE Sbjct: 907 GKKTSKTSSPGAKKPPPTPQRNSSIKSSSCAEHPE 941 [112][TOP] >UniRef100_UPI0000ECA020 UPI0000ECA020 related cluster n=1 Tax=Gallus gallus RepID=UPI0000ECA020 Length = 1043 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/73 (43%), Positives = 37/73 (50%), Gaps = 7/73 (9%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPL--LQPLPPTPPPPPPRPSLQTPLS-----STLLQSPQ 138 PP S + PPPP P + PPPP L PLPP+P PP PS QTP+ T L S Sbjct: 530 PPPLPSIKSPPPPLPTTTPPPPTPPLPPLPPSPAVPPLPPSQQTPIQVPPSVPTSLSSSS 589 Query: 137 HKVDAILIFAANS 99 H + L NS Sbjct: 590 HPRTSTLSSQVNS 602 [113][TOP] >UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2S9_EHV86 Length = 621 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/44 (52%), Positives = 26/44 (59%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 +PP PPPP+PP PPP P PP+PPPPPP PS P Sbjct: 124 QPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPP 167 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/52 (50%), Positives = 27/52 (51%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPS PPP PP PPPP P PP+PPPPPP P P S SP Sbjct: 285 PPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPPPSPPPSPPPPSPPPPSP 334 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/52 (50%), Positives = 27/52 (51%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPS PPP PP PPPP P PP+PPPPPP P P S SP Sbjct: 341 PPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPPPSPPPSPPPPSPPPPSP 390 [114][TOP] >UniRef100_B0T428 Glycoside hydrolase family 16 n=1 Tax=Caulobacter sp. K31 RepID=B0T428_CAUSK Length = 608 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/51 (47%), Positives = 29/51 (56%) Frame = -3 Query: 320 QARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 Q ++ R +H + PPPP PP PPPP P PP PPPPPP P +P Sbjct: 453 QLEIDYVRTYAHDASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVETSP 503 [115][TOP] >UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK6_CHLRE Length = 738 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/45 (53%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PP PPPP PPS PPPP +P PP+PPPP P P P S Sbjct: 394 PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 438 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PPS PPPP +P PP+PPPP P P P Sbjct: 363 PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPP 405 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP PPPP PPS PPPP P PP PP PPP P P S SP Sbjct: 251 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSP 302 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/45 (53%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PPS P PP PPS PPPP +P PP+PPPP P P P S Sbjct: 327 PPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPS 371 [116][TOP] >UniRef100_Q2QZM4 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2QZM4_ORYSJ Length = 661 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/53 (50%), Positives = 29/53 (54%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 RQA A PP+ S P PP PP +PP P PP PPPPPP PS PL Sbjct: 414 RQAASRAPSPPALPSPPAPSPPVPPPRPP----APSPPAPPPPPPAPSPPAPL 462 [117][TOP] >UniRef100_C5XBT9 Putative uncharacterized protein Sb02g005130 n=1 Tax=Sorghum bicolor RepID=C5XBT9_SORBI Length = 984 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 P+ G PPPP PP QPP P P PP PPPPPP P P Sbjct: 4 PTPGDSVPPPPPLPPPQPPRPSRHPAPPPPPPPPPPPPPPPP 45 [118][TOP] >UniRef100_A0D550 Chromosome undetermined scaffold_38, whole genome shotgun sequence n=1 Tax=Paramecium tetraurelia RepID=A0D550_PARTE Length = 493 Score = 55.5 bits (132), Expect = 2e-06 Identities = 32/94 (34%), Positives = 40/94 (42%) Frame = -3 Query: 332 QRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 Q+ +Q ++ P ++ PPPP PP PPP P PP PPPPPP P P Sbjct: 343 QQPQQQQIQQPPPQQQQNKSAPPPPPPPPPPPPKGAPPPPPPPPPPPPPPG---PPPPGQ 399 Query: 152 LQSPQHKVDAILIFAANSSEQPREQKPKLSGLAP 51 L P A L+ N+ KP AP Sbjct: 400 LPPPPAGARAKLLDDLNTDNPLARLKPVNKNKAP 433 [119][TOP] >UniRef100_A5DTF7 Putative uncharacterized protein n=1 Tax=Lodderomyces elongisporus RepID=A5DTF7_LODEL Length = 361 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/44 (56%), Positives = 29/44 (65%) Frame = +1 Query: 145 DWSKVLDRGVCRDGRGGGGGGVGGSGCSRGGGG*DGGAGGGGHR 276 ++SK + G GGGGGG GGSG GGGG GGAGGGGH+ Sbjct: 181 NFSKASGGALLSSGGGGGGGGKGGSGSGGGGGGAGGGAGGGGHK 224 [120][TOP] >UniRef100_UPI0000E4A1BC PREDICTED: similar to myosin XV n=2 Tax=Strongylocentrotus purpuratus RepID=UPI0000E4A1BC Length = 2270 Score = 55.1 bits (131), Expect = 2e-06 Identities = 33/91 (36%), Positives = 44/91 (48%), Gaps = 10/91 (10%) Frame = -3 Query: 305 ARRPPSHGSRRCPPPPAPPSQPP--PPLLQ--------PLPPTPPPPPPRPSLQTPLSST 156 A PPS PPPP PP +PP PP+ P PP PPPPPP + T Sbjct: 1144 APSPPS------PPPPPPPQEPPTPPPVAPVVHVVSAVPTPPPPPPPPPPLPVMTEHKEM 1197 Query: 155 LLQSPQHKVDAILIFAANSSEQPREQKPKLS 63 L+Q+ Q K++++ I A Q E P ++ Sbjct: 1198 LVQTIQTKMESVDILKAQGIIQEIEDTPSVT 1228 [121][TOP] >UniRef100_UPI00016E7DED UPI00016E7DED related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E7DED Length = 658 Score = 55.1 bits (131), Expect = 2e-06 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSS 159 PPPP PP PPPP + P PPPPPP PS+ TP S+ Sbjct: 474 PPPPPPPPPPPPPAARTNVPPPPPPPPPPSMPTPGSA 510 [122][TOP] >UniRef100_UPI000179DCA7 Zinc finger homeodomain 4 n=1 Tax=Bos taurus RepID=UPI000179DCA7 Length = 2098 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 11/65 (16%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPS----LQTPLS-------STLL 150 PP PP PAP PPPP P PP PPPPPP PS +Q P+S S ++ Sbjct: 789 PPPPPLPPAPPQPAPAPTPPPPPPPPPPPPPPPPPPPPSAPPQVQLPVSLDLPLFPSIMM 848 Query: 149 QSPQH 135 QS QH Sbjct: 849 QSVQH 853 [123][TOP] >UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f. nagariensis RepID=Q9SBM1_VOLCA Length = 409 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 102 PPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPP 144 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PPS PPPP P PP PPPPP P +P Sbjct: 108 PPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSP 150 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PP PPPP P PP+PPPPPP P P Sbjct: 82 PPSPSPPPPPPPPVPPPPPPPP-PPPPPPSPPPPPPPPPPPPP 123 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P P Sbjct: 97 PPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPP 130 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PPS R PPP PP +PPPP P PP PPPP P P L P S Sbjct: 238 PPSPPPPRPPPPAPPPPRPPPP--SPPPPLPPPPSPPPPLPPPPS 280 [124][TOP] >UniRef100_Q3HTK2 Pherophorin-C5 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK2_CHLRE Length = 541 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PP PPPP PPS PPPP P PP+PPPP P P P S Sbjct: 192 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 236 [125][TOP] >UniRef100_Q33AC7 Transposon protein, putative, CACTA, En/Spm sub-class n=2 Tax=Oryza sativa Japonica Group RepID=Q33AC7_ORYSJ Length = 1874 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/69 (43%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPS--QPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLL 150 RQA A PP+ S P PP PP+ PPPP P PP PP PP S Q P + Sbjct: 1481 RQAAFRAPSPPAPPSPTAPSPPPPPAAPSPPPPPPPPPPPCPPAPPKTRSRQAPPLARTR 1540 Query: 149 QSPQHKVDA 123 + + KVDA Sbjct: 1541 ATKKAKVDA 1549 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/56 (46%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPS----QPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 P + R P PPAPPS PPPP P PP PPPPPP P P + Q+P Sbjct: 1479 PRRQAAFRAPSPPAPPSPTAPSPPPPPAAPSPPPPPPPPPPPCPPAPPKTRSRQAP 1534 [126][TOP] >UniRef100_Q2R0D0 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q2R0D0_ORYSJ Length = 957 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/71 (43%), Positives = 35/71 (49%), Gaps = 10/71 (14%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPP---------APPSQPPPPLL-QPLPPTPPPPPPRPSLQ 174 RQA A PP+ S P PP +PPS PPPPL P P PPPPPP P Sbjct: 468 RQAASRAPSPPAPPSPPAPSPPVPLPRPPAPSPPSPPPPPLAPSPPAPPPPPPPPPPCPP 527 Query: 173 TPLSSTLLQSP 141 PL + Q+P Sbjct: 528 APLKTRSRQAP 538 [127][TOP] >UniRef100_C5YU09 Putative uncharacterized protein Sb08g008380 n=1 Tax=Sorghum bicolor RepID=C5YU09_SORBI Length = 149 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = -3 Query: 287 HGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQ 174 HG RR PPPP PP PPPP PP PPPPP PSL+ Sbjct: 4 HGRRRPPPPPPPPPPPPPP-----PPPPPPPPLSPSLR 36 [128][TOP] >UniRef100_C1EC93 Predicted protein n=1 Tax=Micromonas sp. RCC299 RepID=C1EC93_9CHLO Length = 402 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/54 (50%), Positives = 29/54 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQH 135 PP + PPPP+PPS PP P P PP PPP PP P PL S SP H Sbjct: 279 PPWPDAPSPPPPPSPPSPPPSPPAPPPPPRPPPSPPNP--PPPLPSPPPPSPPH 330 [129][TOP] >UniRef100_B9S5R2 Actin binding protein, putative n=1 Tax=Ricinus communis RepID=B9S5R2_RICCO Length = 210 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/78 (43%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPL--PPTPPPPPPRPSLQTPLS--STLLQSPQHKVDAILIFAAN 102 PPPP PP PPPP P PP PPPPPP PS P S S+LL P A+ Sbjct: 42 PPPPPPPPSPPPPSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPP----PAS 97 Query: 101 SSEQPREQKPKLSGLAPN 48 SS P P S P+ Sbjct: 98 SSSPPPPPPPPPSSPPPS 115 [130][TOP] >UniRef100_B9I9M7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I9M7_POPTR Length = 184 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSL 177 PP CPPPP PPS PPP + + PP PPP PP P++ Sbjct: 52 PPPPAIPECPPPPPPPSPPPPAIPECPPPAPPPSPPPPAI 91 [131][TOP] >UniRef100_B4JJI1 GH12253 n=1 Tax=Drosophila grimshawi RepID=B4JJI1_DROGR Length = 374 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = -3 Query: 305 ARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 +RRP + PPPP PP PPPP P PP PPPPPP P P Sbjct: 66 SRRPAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 111 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/55 (43%), Positives = 28/55 (50%) Frame = -3 Query: 347 NVCHGQRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 N+ + R+ + PP PPPP PP PPPP P PP PPPPPP P Sbjct: 59 NIIGAKTSRRPAMMMTTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 113 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P + P Sbjct: 84 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRRP 117 [132][TOP] >UniRef100_A8MSW5 Putative uncharacterized protein TNRC18 n=1 Tax=Homo sapiens RepID=A8MSW5_HUMAN Length = 1308 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/51 (50%), Positives = 26/51 (50%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 P R PPPP PP PPPP PLPP P PPPP P PL L P Sbjct: 1120 PGRPHRPPPPPPHPPPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRP 1170 [133][TOP] >UniRef100_A7EUH8 Putative uncharacterized protein n=1 Tax=Sclerotinia sclerotiorum 1980 UF-70 RepID=A7EUH8_SCLS1 Length = 1723 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/59 (44%), Positives = 32/59 (54%) Frame = -3 Query: 311 LNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQH 135 +NA P G PPPP PP PPPP + +PP PPPPPP P + +S L P + Sbjct: 1017 MNAPVAPGFGG---PPPPPPP--PPPPGMPGMPPPPPPPPPPPGMPGKMSGHFLAQPSY 1070 [134][TOP] >UniRef100_Q8LRM7 Mastigoneme-like protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q8LRM7_CHLRE Length = 1997 Score = 50.8 bits (120), Expect(2) = 3e-06 Identities = 26/41 (63%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -3 Query: 299 RPPSHG--SRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 RPPS S R PP PAPPS PPP QP P P PPPPRP Sbjct: 1881 RPPSPNPPSPR-PPSPAPPSPNPPPTSQPPSPPPSPPPPRP 1920 Score = 23.5 bits (49), Expect(2) = 3e-06 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 211 RRHHRRRRGRLCKPPCPAPCSNPLN 137 RR H RR PP P P S +N Sbjct: 1924 RRPHPARRPPTALPPPPPPASPAIN 1948 [135][TOP] >UniRef100_B3NWP2 GG19507 n=1 Tax=Drosophila erecta RepID=B3NWP2_DROER Length = 159 Score = 54.7 bits (130), Expect = 3e-06 Identities = 41/94 (43%), Positives = 47/94 (50%), Gaps = 5/94 (5%) Frame = +1 Query: 58 NPLSFGFCSL-GCSDEFAAKIKIASTLC*GDWSKV-LDRGVCRDGRGGGGGGVGGSGCSR 231 NP F F D A + T C G +V + G R+GRGGGGGG GG G Sbjct: 45 NPPGFAFVEFEDRRDAEDATRGLDGTRCCGTRIRVEMSSGRSREGRGGGGGGGGGGGGGS 104 Query: 232 GGGG*DGGAG---GGGHRLEPCDGGRRALSRACR 324 GGGG GG+G GGG R DGG R SR+ R Sbjct: 105 GGGGRGGGSGARAGGGGRAG--DGGGRYRSRSPR 136 [136][TOP] >UniRef100_UPI0001553827 PREDICTED: additional sex combs like 3 n=1 Tax=Mus musculus RepID=UPI0001553827 Length = 1791 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPP--PPPRPSLQTP 168 PPPP PP PPPPL P PP PPP PPP P+++ P Sbjct: 1557 PPPPPPPPPPPPPLALPPPPPPPPPLPPPLPTVEVP 1592 [137][TOP] >UniRef100_Q2N5D9 Autotransporter n=1 Tax=Erythrobacter litoralis HTCC2594 RepID=Q2N5D9_ERYLH Length = 1819 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/47 (55%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPP-PPPRPSLQTPLSS 159 PP PPPP PP PPPP P PPTPPP PPP P P+SS Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISS 1457 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 PP PPPP PP PPPP P PP PPPPPP S T L T+ Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSGTGLFPTV 1465 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P P Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -3 Query: 284 GSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPS 180 G+ PPPP PP PPPP P PP PPPPPP P+ Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPT 1440 [138][TOP] >UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9T0K5_ARATH Length = 760 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPP 189 PP PPPP PP PPPP+ P PP+PPPPPP Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -3 Query: 266 PPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPP PP PPPP+ P PP PPPPPP P P Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPP 483 [139][TOP] >UniRef100_Q948Y6 VMP4 protein n=1 Tax=Volvox carteri f. nagariensis RepID=Q948Y6_VOLCA Length = 1143 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/57 (49%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPP---PPPRPSLQTPLSSTLLQSPQH 135 PP S PP P PP PPPP P PP+PPP PPP PS P S SP+H Sbjct: 531 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRH 587 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 311 LNARRPPS-HGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 L + RPPS R PP P PP PPPP P PP+PPPPP P +P Sbjct: 507 LTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 555 [140][TOP] >UniRef100_Q3HTK4 Cell wall protein pherophorin-C3 n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK4_CHLRE Length = 443 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 RP + S PPPP PP PPPP P PP PPPPPP P Sbjct: 218 RPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P +P Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPPP PP PPPP P PP PPPPPP P P S SP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP S PPPP PP PPPP P PP+P PPPP+ TP Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTP 279 [141][TOP] >UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8JFD4_CHLRE Length = 898 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/55 (50%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQT--PLSSTLLQSP 141 RPPS PPP PP PPPP P PP+PPPP P P + P ST+L SP Sbjct: 257 RPPSPPPPSPPPPSPPPPSPPPP--SPPPPSPPPPSPSPPTPSPPPPPSTVLTSP 309 [142][TOP] >UniRef100_A8J790 Hydroxyproline-rich glycoprotein, stress-induced n=1 Tax=Chlamydomonas reinhardtii RepID=A8J790_CHLRE Length = 472 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PPS PPPP P PP PPPPPP PS P Sbjct: 250 PPPSPLPPSPPPPPPPSPPPPPPPPP-PPPPPPPPPSPSPPPP 291 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/47 (55%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 296 PPSHGSRRCPPP-PAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSS 159 PPS PPP P PPS PPPP P PP PPPPPP P P S Sbjct: 241 PPSPAPPSPPPPSPLPPSPPPPPPPSPPPPPPPPPPPPPPPPPPSPS 287 [143][TOP] >UniRef100_Q4CNT9 Dispersed gene family protein 1 (DGF-1), putative (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CNT9_TRYCR Length = 1508 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 PPPP PP PPPP PLPP PPPPPP P Sbjct: 1217 PPPPPPPLPPPPPPPPPLPPPPPPPPPPP 1245 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPP 189 PPPP PP PPPP L P PP PPPPPP Sbjct: 1220 PPPPLPPPPPPPPPLPPPPPPPPPPPP 1246 [144][TOP] >UniRef100_B7PC66 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7PC66_IXOSC Length = 81 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 PP PPPP PP PPPP P PP PPPPPP P PL Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 48 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 [145][TOP] >UniRef100_B5DH56 GA25354 n=1 Tax=Drosophila pseudoobscura pseudoobscura RepID=B5DH56_DROPS Length = 195 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/42 (54%), Positives = 24/42 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQT 171 PP + PPPP PP PPPP P PP PPPPPP P T Sbjct: 112 PPPIFTPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPRFTT 153 [146][TOP] >UniRef100_C5P6Q6 WH1 domain containing protein n=1 Tax=Coccidioides posadasii C735 delta SOWgp RepID=C5P6Q6_COCP7 Length = 604 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS P PP PP PPPP P PP PPPPPP PS P Sbjct: 450 PPSSSGPPAPGPPPPPPPPPPPSAAPAPP-PPPPPPMPSSSGP 491 [147][TOP] >UniRef100_A8NE03 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NE03_COPC7 Length = 434 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/52 (50%), Positives = 29/52 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PP + P PP PP +PPP L P PPT PPPPP P PL T+L P Sbjct: 362 PPPPSTEPPPLPPPPPDEPPP--LPPPPPTEPPPPPPPLPPPPLPPTVLPPP 411 [148][TOP] >UniRef100_Q0GNC1-3 Isoform 2 of Inverted formin-2 n=1 Tax=Mus musculus RepID=Q0GNC1-3 Length = 1264 Score = 54.7 bits (130), Expect = 3e-06 Identities = 34/86 (39%), Positives = 41/86 (47%), Gaps = 4/86 (4%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPT----PPPPPPRPSLQTPLSSTLLQSPQHKV 129 PP GS PPP PP PPPPL PLP + PPPPPP P PL T SP Sbjct: 459 PPLPGSGTTSPPPPPP--PPPPLPPPLPGSGTISPPPPPPPP----PLPGTGAVSPPPPP 512 Query: 128 DAILIFAANSSEQPREQKPKLSGLAP 51 + ++ ++ P P L G+ P Sbjct: 513 PLPSLPDSHKTQPPPPPPPPLPGMCP 538 [149][TOP] >UniRef100_Q0GNC1 Inverted formin-2 n=1 Tax=Mus musculus RepID=INF2_MOUSE Length = 1273 Score = 54.7 bits (130), Expect = 3e-06 Identities = 34/86 (39%), Positives = 41/86 (47%), Gaps = 4/86 (4%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPT----PPPPPPRPSLQTPLSSTLLQSPQHKV 129 PP GS PPP PP PPPPL PLP + PPPPPP P PL T SP Sbjct: 459 PPLPGSGTTSPPPPPP--PPPPLPPPLPGSGTISPPPPPPPP----PLPGTGAVSPPPPP 512 Query: 128 DAILIFAANSSEQPREQKPKLSGLAP 51 + ++ ++ P P L G+ P Sbjct: 513 PLPSLPDSHKTQPPPPPPPPLPGMCP 538 [150][TOP] >UniRef100_Q8C4A5 Putative Polycomb group protein ASXL3 n=2 Tax=Mus musculus RepID=ASXL3_MOUSE Length = 2259 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPP--PPPRPSLQTP 168 PPPP PP PPPPL P PP PPP PPP P+++ P Sbjct: 2025 PPPPPPPPPPPPPLALPPPPPPPPPLPPPLPTVEVP 2060 [151][TOP] >UniRef100_C4IYG5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4IYG5_MAIZE Length = 678 Score = 51.6 bits (122), Expect(2) = 3e-06 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 7/50 (14%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPP-------PPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PPS PP PP L P P PPPPPP PS P Sbjct: 374 PPLPSDSPPPPPPLPPSPPPVTPPPPPPPPLSPASPPPPPPPPLPSGPPP 423 Score = 22.7 bits (47), Expect(2) = 3e-06 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 169 PCPAPCSNPLNTRLTQS*SSQRIHPSSPGSRS 74 P P P PL T++T S PSSP S S Sbjct: 421 PPPQPAPPPLATQVTPLPSIPPPVPSSPPSLS 452 [152][TOP] >UniRef100_C5GB40 Actin associated protein Wsp1 n=1 Tax=Ajellomyces dermatitidis ER-3 RepID=C5GB40_AJEDR Length = 673 Score = 53.1 bits (126), Expect(2) = 3e-06 Identities = 23/38 (60%), Positives = 26/38 (68%), Gaps = 4/38 (10%) Frame = -3 Query: 281 SRRCPPPPAPPSQP----PPPLLQPLPPTPPPPPPRPS 180 S + PPPPAP S P PPP+ P PPTPPPPPP P+ Sbjct: 453 SSQPPPPPAPVSVPGRQLPPPISAPAPPTPPPPPPAPA 490 Score = 21.2 bits (43), Expect(2) = 3e-06 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 172 PPCPAPCSNP 143 PP PAP S+P Sbjct: 486 PPAPAPSSSP 495 [153][TOP] >UniRef100_UPI0001926FBD PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata RepID=UPI0001926FBD Length = 268 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/35 (62%), Positives = 22/35 (62%) Frame = -3 Query: 272 CPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 CPPPPAP PPPP LPP PPPPPP P P Sbjct: 175 CPPPPAPCPPPPPPPPMCLPPPPPPPPPPPPCPLP 209 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -3 Query: 272 CPPPPAPPS--QPPPPLLQPLPPTPPPPPPRPSLQTP 168 CPPPP PP PPPP+ P PP PPPPPP P P Sbjct: 119 CPPPPPPPPVCPPPPPMCAPPPPPPPPPPPPPPPPPP 155 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = -3 Query: 272 CPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 C PPP PP PPPP P PP PPPPPP P + P Sbjct: 136 CAPPPPPPPPPPPPPPPPPPPPPPPPPPPPVVFCP 170 [154][TOP] >UniRef100_UPI0001923E9F PREDICTED: similar to nematocyst outer wall antigen n=1 Tax=Hydra magnipapillata RepID=UPI0001923E9F Length = 735 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/44 (54%), Positives = 25/44 (56%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQ 138 PPPP PP PPPP P PP PPPPP P P S+ L PQ Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPLLPPPPPPSISSFLVPPQ 469 [155][TOP] >UniRef100_UPI0001923DA0 PREDICTED: similar to predicted protein n=1 Tax=Hydra magnipapillata RepID=UPI0001923DA0 Length = 1853 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PS + PPPP P PPPP P PP PPPPPP P LQ P Sbjct: 1384 PSQPTYFPPPPPHLPLPPPPPPPPPPPPPPPPPPPSPPLQIP 1425 [156][TOP] >UniRef100_UPI000186983E hypothetical protein BRAFLDRAFT_104497 n=1 Tax=Branchiostoma floridae RepID=UPI000186983E Length = 1411 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 925 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAPPP 967 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 854 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 896 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 855 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 897 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 856 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 898 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 857 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 899 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 858 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 900 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 859 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 901 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 860 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 902 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 861 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 903 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 862 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 904 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 863 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 905 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 864 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 906 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 865 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 907 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 866 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 908 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 867 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 909 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 868 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 910 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 869 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 911 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 870 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 912 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 871 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 913 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 872 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 914 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 873 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 915 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 874 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 916 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 875 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 917 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 876 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 918 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 877 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 919 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 878 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 920 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 879 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 921 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 880 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 922 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 881 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 923 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 882 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 924 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 883 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 925 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 884 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 926 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 885 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 927 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 886 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 928 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 887 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 929 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 888 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 930 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 889 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 931 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 890 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 932 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 891 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 933 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 892 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 934 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 893 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 935 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 894 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 936 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 895 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 937 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 896 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 938 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 897 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 939 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 898 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 940 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 899 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 900 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 901 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 902 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 903 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 904 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 946 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 905 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 947 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 906 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 948 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 907 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 949 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 908 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 950 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 909 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 951 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 910 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 952 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 911 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 953 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 912 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 954 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 913 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 955 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 914 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 956 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 915 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 957 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 916 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 958 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 917 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 959 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 918 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 960 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 961 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 962 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGAP 965 [157][TOP] >UniRef100_UPI0000F2BFBF PREDICTED: similar to bromodomain PHD finger transcription factor n=1 Tax=Monodelphis domestica RepID=UPI0000F2BFBF Length = 3059 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/38 (57%), Positives = 24/38 (63%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 PPPP PP PPPP P PP PPPPPP P ++ST Sbjct: 2800 PPPPPPPPTPPPPPPPPPPPPPPPPPPPPQHSINVTST 2837 [158][TOP] >UniRef100_UPI0000E21CCC PREDICTED: similar to BAI 1, partial n=1 Tax=Pan troglodytes RepID=UPI0000E21CCC Length = 635 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = -3 Query: 305 ARRPPSHGSRRCPP--PPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 +R+PPS G PP PP PP PPPP QPLPP P P PSL P Sbjct: 446 SRQPPSSGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDP 493 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = -3 Query: 320 QARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 +A L AR PPS PP APP+QPPPP PP PPPPP +P Sbjct: 436 EASLPARSPPSRQPPSSGPPEAPPAQPPPP-----PPPPPPPPQQP 476 [159][TOP] >UniRef100_UPI0000DB6FAC PREDICTED: similar to Protein cappuccino n=1 Tax=Apis mellifera RepID=UPI0000DB6FAC Length = 1007 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/89 (35%), Positives = 37/89 (41%), Gaps = 8/89 (8%) Frame = -3 Query: 314 RLNARRPPSHGSRRCPPPPAPPSQPPPPLLQ--------PLPPTPPPPPPRPSLQTPLSS 159 RL+ PPS + PPPP PP PPPP P PP PPPPPP P + P Sbjct: 444 RLSFTLPPSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVP--- 500 Query: 158 TLLQSPQHKVDAILIFAANSSEQPREQKP 72 P +FA +QP P Sbjct: 501 -----PPPPPPPPSVFAGGQQQQPPPPPP 524 [160][TOP] >UniRef100_Q69ZN8 MKIAA1205 protein (Fragment) n=3 Tax=Mus musculus RepID=Q69ZN8_MOUSE Length = 1848 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/58 (48%), Positives = 32/58 (55%), Gaps = 7/58 (12%) Frame = -3 Query: 293 PSHGSRRCPPPPA-----PPSQPPPPLLQPLPPTPPPPPPRPSL--QTPLSSTLLQSP 141 PS S P PP PP+ PP P QP PP PPPPPP P+L TPL + + SP Sbjct: 1244 PSSNSSGTPEPPLLEEKPPPTPPPAPTPQPAPPPPPPPPPVPALPSPTPLVTPVASSP 1301 [161][TOP] >UniRef100_UPI000023CEC4 hypothetical protein FG02536.1 n=1 Tax=Gibberella zeae PH-1 RepID=UPI000023CEC4 Length = 2370 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 PP G PPPP PPSQ PPP P P PPPPP PS TP T Sbjct: 5 PPPPGWGNNPPPPPPPSQAPPP---PRTPAPPPPPSLPSQATPAFHT 48 [162][TOP] >UniRef100_Q4RE14 Chromosome undetermined SCAF15155, whole genome shotgun sequence. (Fragment) n=1 Tax=Tetraodon nigroviridis RepID=Q4RE14_TETNG Length = 334 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/67 (43%), Positives = 33/67 (49%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAILIFAANSSEQ 90 PPPP PP PPPP PL P PPPPPP P+ T + LL Q + N Sbjct: 2 PPPPPPPPPPPPP---PLAPAPPPPPP-PTAVTRHRNALLADIQKGAKLRKVTQVNDRSA 57 Query: 89 PREQKPK 69 P +KPK Sbjct: 58 PVVEKPK 64 [163][TOP] >UniRef100_C5B4P6 Putative uncharacterized protein n=1 Tax=Methylobacterium extorquens AM1 RepID=C5B4P6_METEA Length = 435 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P + P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPP 366 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = -3 Query: 308 NARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 + +PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 317 DVEQPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQ 174 PP PPPP PP PPPP P PP PPPPPP P Q Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPQ 368 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEP 365 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPP 367 [164][TOP] >UniRef100_C5NKF6 Intracellular motility protein A n=1 Tax=Burkholderia mallei PRL-20 RepID=C5NKF6_BURMA Length = 375 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/56 (42%), Positives = 28/56 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKV 129 PP PPP PP PPPP P PP+PPPP P P TP ++T H + Sbjct: 96 PPPPPPPSPPPPSPPPPSPPPPPPPPPPPSPPPPSPPPPTTTPPTTTTPTPSMHPI 151 [165][TOP] >UniRef100_C2LUZ5 Lpxtg cell wall surface protein, collagen binding domain protein n=1 Tax=Streptococcus salivarius SK126 RepID=C2LUZ5_STRSL Length = 1014 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Frame = -3 Query: 299 RPPSHGSRRCPP-PPAPPSQPP-PPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQ 138 +PP+ + PP PP PPS PP PP++ P PPTPP PP P P+ S+ PQ Sbjct: 922 KPPTPPTPPTPPTPPTPPSVPPKPPVVPPTPPTPPTPPVTPKPAKPVQSSEKSGPQ 977 [166][TOP] >UniRef100_A3WEW6 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WEW6_9SPHN Length = 370 Score = 54.3 bits (129), Expect = 4e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = -3 Query: 284 GSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQT 171 G PPPP PP PPPP P PP PPPPPP P T Sbjct: 220 GGEAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCNT 257 [167][TOP] >UniRef100_Q60F05 Putative hydroxyproline-rich glycoprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q60F05_ORYSJ Length = 914 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/62 (48%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAP-PSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQ 147 RQA A PP+ P PPAP PS PPP P PP PPPPPP P L P + Q Sbjct: 464 RQAASRAPSPPAP-----PSPPAPYPSVPPPRPPAPSPPAPPPPPPPPCLPAPPKTRSHQ 518 Query: 146 SP 141 +P Sbjct: 519 AP 520 [168][TOP] >UniRef100_C1E755 Putative uncharacterized protein n=1 Tax=Micromonas sp. RCC299 RepID=C1E755_9CHLO Length = 336 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/46 (56%), Positives = 27/46 (58%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPR 186 R A L A +P R PPPP PP PPPP QP PP PPPPPR Sbjct: 29 RPAELPASQPRRAAPPRQPPPPPPPPPPPPP--QPPPPPRPPPPPR 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 PP PPPP PP QPPPP P PP PPPPP P Sbjct: 43 PPRQPPPPPPPPPPPPPQPPPPPRPPPPPRSPPPPPPP 80 [169][TOP] >UniRef100_B9GW18 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GW18_POPTR Length = 167 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = -3 Query: 308 NARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 N PPS PP P PPS PPPP P PP+PPPPPP P Sbjct: 31 NGPSPPSPPPSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPPP 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP+PP PPP P PP PPPPPP P ++P Sbjct: 38 PPPSPPPPFPPPPSPPPPPPPLPPPPSPPPPPPPPPPPPSKSP 80 [170][TOP] >UniRef100_A8ISR1 Predicted protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8ISR1_CHLRE Length = 2032 Score = 54.3 bits (129), Expect = 4e-06 Identities = 32/85 (37%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRP--SLQTPLSSTLLQSPQHKVDAILIFAANSS 96 PPPP PPS PPP++ P PP PPP PPRP + +T S L Q+ +L +A+ S Sbjct: 619 PPPPQPPS--PPPVVSPPPPPPPPQPPRPKSATRTARLSDLAQTVLPYAHGVLGVSADLS 676 Query: 95 EQPREQKPKLSGLAPNRSAWHPELH 21 P +S P W H Sbjct: 677 AYAGGMPPLVSVDKPRGFVWAATSH 701 [171][TOP] >UniRef100_A7R7G2 Chromosome undetermined scaffold_1755, whole genome shotgun sequence n=1 Tax=Vitis vinifera RepID=A7R7G2_VITVI Length = 185 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/49 (48%), Positives = 26/49 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLL 150 PP PPPP PP PPPP P PP PPPPPP P P+ L+ Sbjct: 73 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVPGYLV 121 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 72 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 114 [172][TOP] >UniRef100_C5KAT0 Putative uncharacterized protein n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5KAT0_9ALVE Length = 475 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/64 (43%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -3 Query: 329 RLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP----SLQTPLS 162 R R+ R R G PPP PP PPPP P PP PPPPPP P +LQT + Sbjct: 79 RARRKRNRTRNRNGDGVSSLQPPPPPPPPPPPPPPPPPPPPPPPPPPPPGSAEALQTDEA 138 Query: 161 STLL 150 T + Sbjct: 139 LTAM 142 [173][TOP] >UniRef100_B7QFW8 Putative uncharacterized protein (Fragment) n=1 Tax=Ixodes scapularis RepID=B7QFW8_IXOSC Length = 185 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSL 177 PP PPPP PP PPPP P PP PPPPPP P L Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQL 84 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 67 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 68 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 69 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 70 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 71 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 72 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 73 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 75 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 76 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 36 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 78 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 79 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 80 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 39 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 81 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 40 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/41 (56%), Positives = 23/41 (56%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQ 174 PP PPPP PP PPPP P PP PPPPPP P Q Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ 83 [174][TOP] >UniRef100_B4JSH2 GH18083 n=1 Tax=Drosophila grimshawi RepID=B4JSH2_DROGR Length = 550 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/53 (45%), Positives = 27/53 (50%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 R +N PP S CPP APP PPP PP PPPPPP P + P+ Sbjct: 376 RPPPINMAPPPPPPSAVCPPAAAPPPPPPPAPPAVAPPPPPPPPPMPVAEMPI 428 [175][TOP] >UniRef100_A7SGL4 Predicted protein n=1 Tax=Nematostella vectensis RepID=A7SGL4_NEMVE Length = 620 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP CPPPP PP PPPP P PP PPPPPP P P Sbjct: 420 PPPPCPVPCPPPPPPP--PPPPCPVPCPPPPPPPPPSPPPPPP 460 Score = 48.9 bits (115), Expect(2) = 9e-06 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 P P PPS PPPP P PP PPPPPP P Sbjct: 411 PAPYTPPSPPPPPCPVPCPPPPPPPPPPP 439 Score = 23.9 bits (50), Expect(2) = 9e-06 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 172 PPCPAPCSNP 143 PPCP PC P Sbjct: 438 PPCPVPCPPP 447 [176][TOP] >UniRef100_Q7RWH7 Cytokinesis protein sepA n=1 Tax=Neurospora crassa RepID=Q7RWH7_NEUCR Length = 1817 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSL 177 PP G+ PPPP PP PP P + +PP PPPPPP P + Sbjct: 1082 PPMPGAGGPPPPPPPPPPPPMPGMAGMPPPPPPPPPMPGM 1121 [177][TOP] >UniRef100_A8NHF1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NHF1_COPC7 Length = 261 Score = 54.3 bits (129), Expect = 4e-06 Identities = 35/85 (41%), Positives = 38/85 (44%), Gaps = 8/85 (9%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQ----TPLSSTLLQSPQHKVDAILIFAAN 102 PPPP PP PPPP P PP PPPPPP +L+ P SS P + Sbjct: 146 PPPPPPPPPPPPP---PPPPPPPPPPPPTTLEPPPPPPTSSEPPPPPSTSATPTSSAVPS 202 Query: 101 SSEQPREQKPKLSG----LAPNRSA 39 SS P E LSG L P SA Sbjct: 203 SSVVPSEASSTLSGSGASLRPTASA 227 [178][TOP] >UniRef100_A6RRD1 Putative uncharacterized protein n=1 Tax=Botryotinia fuckeliana B05.10 RepID=A6RRD1_BOTFB Length = 436 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 7/65 (10%) Frame = -3 Query: 314 RLNARRPPSHGSRR------CPPPPAPPS-QPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 R+ + PP G+R+ PPPP PP+ PPPP P PP PPPPP P+ + P + Sbjct: 221 RIGKKPPPPPGTRKPSSALSTPPPPPPPAFAPPPPSSAPPPPVAPPPPPSPAPRPPSNPP 280 Query: 155 LLQSP 141 +P Sbjct: 281 RSHAP 285 [179][TOP] >UniRef100_A4RC14 Predicted protein n=1 Tax=Magnaporthe grisea RepID=A4RC14_MAGGR Length = 429 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 6/49 (12%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQ--PLPPTPPPPPPR----PSLQTPLSSTLLQSP 141 PPPP PP PPPP P PP PPPPPP+ P Q P +ST +P Sbjct: 355 PPPPPPPPPPPPPASSGSPAPPPPPPPPPKTTMVPQPQPPTTSTTTSAP 403 [180][TOP] >UniRef100_P21260 Uncharacterized proline-rich protein (Fragment) n=1 Tax=Owenia fusiformis RepID=YPRO_OWEFU Length = 141 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/48 (50%), Positives = 26/48 (54%) Frame = -3 Query: 311 LNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 L++ PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 4 LHSLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/66 (40%), Positives = 28/66 (42%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PP PPPP PP PPPP P PP PPPPPP P P H + L Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRARIHHNIPLFL 71 Query: 116 IFAANS 99 F S Sbjct: 72 RFFKKS 77 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [181][TOP] >UniRef100_Q9FPQ6 Vegetative cell wall protein gp1 n=1 Tax=Chlamydomonas reinhardtii RepID=GP1_CHLRE Length = 555 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/47 (51%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPP----PLLQPLPPTPPPPPPRPSLQTP 168 PPS PPPP+PP PPP P P+PP+PP PPP P+ TP Sbjct: 256 PPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTP 302 [182][TOP] >UniRef100_UPI0000D9E82E PREDICTED: similar to additional sex combs like 1 isoform 4 n=1 Tax=Macaca mulatta RepID=UPI0000D9E82E Length = 2250 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPP--PPPRPSLQTP 168 PPPP PP PPPPL P PP PPP PPP P+ + P Sbjct: 2018 PPPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVP 2053 [183][TOP] >UniRef100_UPI0000D9E82D PREDICTED: similar to additional sex combs like 1 isoform 2 n=3 Tax=Macaca mulatta RepID=UPI0000D9E82D Length = 2249 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/36 (61%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPP--PPPRPSLQTP 168 PPPP PP PPPPL P PP PPP PPP P+ + P Sbjct: 2017 PPPPPPPPPPPPPLALPPPPPPPPPLPPPLPNAEVP 2052 [184][TOP] >UniRef100_UPI00002109E8 brain-specific angiogenesis inhibitor 1 precursor n=1 Tax=Homo sapiens RepID=UPI00002109E8 Length = 1584 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = -3 Query: 305 ARRPPSHGSRRCPP--PPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 +R+PPS G PP PP PP PPPP QPLPP P P PSL P Sbjct: 1395 SRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDP 1442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = -3 Query: 320 QARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 +A L AR PPS PP APP+QPPPP PP PPPPP +P Sbjct: 1385 EASLPARSPPSRQPPSGGPPEAPPAQPPPP-----PPPPPPPPQQP 1425 [185][TOP] >UniRef100_Q7ZYY2 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q7ZYY2_DANRE Length = 518 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPP-----SQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS G + PPPP PP S P PP + PP PPPPPP P P Sbjct: 354 PPSRGPTQAPPPPPPPHSASISPPAPPSIGGAPPPPPPPPPPPGPPPP 401 [186][TOP] >UniRef100_Q6NYX7 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q6NYX7_DANRE Length = 518 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPP-----SQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS G + PPPP PP S P PP + PP PPPPPP P P Sbjct: 354 PPSRGPTQAPPPPPPPHSASISPPAPPSIGGAPPPPPPPPPPPGPPPP 401 [187][TOP] >UniRef100_Q5RGR6 Wiskott-Aldrich syndrome, like n=1 Tax=Danio rerio RepID=Q5RGR6_DANRE Length = 518 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPP-----SQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS G + PPPP PP S P PP + PP PPPPPP P P Sbjct: 354 PPSRGPTQAPPPPPPPHSASISPPAPPSIGGAPPPPPPPPPPPGPPPP 401 [188][TOP] >UniRef100_Q4A2Z7 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2Z7_EHV86 Length = 516 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPS S PPP A PS PPP P PP PPPPPP P P Sbjct: 189 PPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPP 231 [189][TOP] >UniRef100_C4B111 Intracellular motility protein A n=4 Tax=Burkholderia mallei RepID=C4B111_BURMA Length = 373 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPP--PLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKV 129 PP PPPP PPS PPP P P PP+PPPP P P TP ++T H + Sbjct: 92 PPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTPTPSMHPI 149 [190][TOP] >UniRef100_Q8LSR0 Putative hydroxyproline-rich glycoprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q8LSR0_ORYSJ Length = 1449 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/52 (53%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQP---LPPTPPPPPPRPSLQTPLSSTLL 150 P + R P PPAPPS PP PL +P PP PPPPPP PS PL+ LL Sbjct: 964 PRRQVASRAPSPPAPPS-PPVPLPRPPAPSPPAPPPPPPAPSPPAPLAPPLL 1014 [191][TOP] >UniRef100_Q7G491 Transposon protein, putative, CACTA, En/Spm sub-class n=1 Tax=Oryza sativa Japonica Group RepID=Q7G491_ORYSJ Length = 1443 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/52 (53%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQP---LPPTPPPPPPRPSLQTPLSSTLL 150 P + R P PPAPPS PP PL +P PP PPPPPP PS PL+ LL Sbjct: 958 PRRQVASRAPSPPAPPS-PPVPLPRPPAPSPPAPPPPPPAPSPPAPLAPPLL 1008 [192][TOP] >UniRef100_Q6ZD62 Os08g0108300 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6ZD62_ORYSJ Length = 342 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPP---PPP--PRPSLQTPLSSTLLQSPQH 135 PP RR PPPPA P PPPP P PP+PP PPP PRP P S L P H Sbjct: 109 PPPPPPRRAPPPPATP--PPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPH 165 [193][TOP] >UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE Length = 3889 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = -3 Query: 275 RCPPPPAPPSQPPPPLLQPLPPTP----PPPPPRPSLQTP 168 R PP P PPS PPPP L P PP+P PPPPP PS+ P Sbjct: 745 RPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPP 784 [194][TOP] >UniRef100_Q6L4M1 Putative hydroxyproline-rich glycoprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q6L4M1_ORYSJ Length = 984 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/61 (44%), Positives = 31/61 (50%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 RQA A PP+ S P PP PP +PP P PP PPPPPP P P + Q+ Sbjct: 538 RQAASRAPSPPALPSPPAPSPPVPPPRPP----APSPPAPPPPPPPPCPPAPPKTRSRQA 593 Query: 143 P 141 P Sbjct: 594 P 594 [195][TOP] >UniRef100_Q5ZBJ7 Phosphatase 2C-like protein n=1 Tax=Oryza sativa Japonica Group RepID=Q5ZBJ7_ORYSJ Length = 1000 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/61 (45%), Positives = 31/61 (50%) Frame = -3 Query: 323 RQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQS 144 RQA A PP+ S P PPAPP PPPP P P PPPPP P P + Q+ Sbjct: 545 RQAASRAPSPPAPPSPPAPSPPAPP--PPPPAPSPPAPPAPPPPPPPCPPAPPKTRSRQA 602 Query: 143 P 141 P Sbjct: 603 P 603 [196][TOP] >UniRef100_Q5TKD9 Putative uncharacterized protein OSJNBa0017O06.10 n=1 Tax=Oryza sativa Japonica Group RepID=Q5TKD9_ORYSJ Length = 1568 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 9/58 (15%) Frame = -3 Query: 266 PPPAPPSQPPPPLLQPLPPTPPPPPP-------RPSLQTPLSS--TLLQSPQHKVDAI 120 PPP PPS PPPP P PP+PPPPPP RPS +P +S T + +P D + Sbjct: 576 PPPPPPSPPPPPPSPPPPPSPPPPPPSLYTDRRRPSSSSPPASSPTRIAAPTEAGDVL 633 [197][TOP] >UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii RepID=Q3HTK5_CHLRE Length = 853 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PPS PPPP PPS PPPP P PP+PPPP P P P S Sbjct: 335 PPS------PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 373 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PPS PPPP PPS PPPP P PP+PPPP P P P S Sbjct: 379 PPS------PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 417 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PPS PPPP P PP PP PPP P P Sbjct: 419 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 461 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPS PPPP PPS PPPP P PP PP PPP P P S SP Sbjct: 433 PPS------PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 478 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PPS PPPP PPS PPPP P PP+PPPP P P P S Sbjct: 449 PPS------PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 487 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/45 (55%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PPS PPPP PPS PPPP P PP+PPPP P P P S Sbjct: 493 PPS------PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 531 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/44 (54%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPP-PPPPRPSLQTP 168 PP PPPP PPS PPPP P PP PP PPPP P +P Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 364 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/44 (54%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPP-PPPPRPSLQTP 168 PP PPPP PPS PPPP P PP PP PPPP P +P Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 408 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/44 (54%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPP-PPPPRPSLQTP 168 PP PPPP PPS PPPP P PP PP PPPP P +P Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP 522 [198][TOP] >UniRef100_P93845 Putative uncharacterized protein n=1 Tax=Pisum sativum RepID=P93845_PEA Length = 306 Score = 53.9 bits (128), Expect = 5e-06 Identities = 33/89 (37%), Positives = 39/89 (43%), Gaps = 3/89 (3%) Frame = -3 Query: 302 RRPPSHGSRRCPPPPAPPSQPPPP---LLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHK 132 RR P RR PPPP S PPPP + P PP PPPPPP P L + P + Sbjct: 67 RRSPPPPPRRSPPPPPRRSSPPPPPPRIRSPPPPRPPPPPPPPLLFDHFKLSQTWPPTY- 125 Query: 131 VDAILIFAANSSEQPREQKPKLSGLAPNR 45 N P QK + GL P++ Sbjct: 126 ----CKLKNNDCVSPLPQKFTIHGLWPSK 150 [199][TOP] >UniRef100_B9FFB2 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=B9FFB2_ORYSJ Length = 171 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 23 PPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQ---PPPPLLQPLPPTPPPPPPRPSLQTP 168 PP H CPPPP PP PPPP P PP PPPPPP P P Sbjct: 17 PPPH----CPPPPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 [200][TOP] >UniRef100_A3BNX1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica Group RepID=A3BNX1_ORYSJ Length = 235 Score = 53.9 bits (128), Expect = 5e-06 Identities = 30/59 (50%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPP---PPP--PRPSLQTPLSSTLLQSPQH 135 PP RR PPPPA P PPPP P PP+PP PPP PRP P S L P H Sbjct: 2 PPPPPPRRAPPPPATP--PPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPH 58 [201][TOP] >UniRef100_A2XDP2 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group RepID=A2XDP2_ORYSI Length = 820 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSL 177 PS+ PPPP PP PPPP L P PPPPPP PS+ Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSV 383 [202][TOP] >UniRef100_Q9VAY4 CG5514, isoform A n=1 Tax=Drosophila melanogaster RepID=Q9VAY4_DROME Length = 1109 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPT---PPPPPPRPSLQTP 168 PP+ + + PPPPAPP+ PPP P PPT PPPPPP P+ P Sbjct: 416 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEP 461 [203][TOP] >UniRef100_Q8MRP6 GH07623p n=1 Tax=Drosophila melanogaster RepID=Q8MRP6_DROME Length = 846 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPT---PPPPPPRPSLQTP 168 PP+ + + PPPPAPP+ PPP P PPT PPPPPP P+ P Sbjct: 153 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEP 198 [204][TOP] >UniRef100_Q8IMM6 CG5514, isoform B n=1 Tax=Drosophila melanogaster RepID=Q8IMM6_DROME Length = 1150 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPT---PPPPPPRPSLQTP 168 PP+ + + PPPPAPP+ PPP P PPT PPPPPP P+ P Sbjct: 416 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEP 461 [205][TOP] >UniRef100_Q5CKJ5 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CKJ5_CRYHO Length = 996 Score = 53.9 bits (128), Expect = 5e-06 Identities = 34/80 (42%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPT--PPPPPPRPSLQTPLSSTLLQSPQHKVD 126 RPPS P P P QPPPP PLP T P PPPP P L PLS + S K Sbjct: 481 RPPSSPPPLSPTSPHPTPQPPPP--PPLPSTSFPQPPPPPPPLPIPLSESSKVSDIQKGG 538 Query: 125 AILIFAANSSEQPREQKPKL 66 I F +S P+ +KP + Sbjct: 539 PIFSFEGETS-VPKYEKPSI 557 [206][TOP] >UniRef100_C1IS34 Minicollagen-1 n=1 Tax=Malo kingi RepID=C1IS34_9CNID Length = 156 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/35 (65%), Positives = 23/35 (65%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPL 165 PPPP PP PPPP P PP PPPPPP P Q PL Sbjct: 53 PPPPPPPPPPPPP---PPPPPPPPPPPPPPPQQPL 84 [207][TOP] >UniRef100_B7Q7P5 Submaxillary gland androgen-regulated protein 3A, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q7P5_IXOSC Length = 91 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PP PPPP PP PPPP P PP PPPPPP P P S Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSS 159 PP PPPP PP PPPP P PP PPPPPP P P S Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQS 57 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 1 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 2 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 3 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 4 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 5 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 6 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 7 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 8 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPPP PP PPPP P PP PPPPPP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 [208][TOP] >UniRef100_B3N5L2 GG24240 n=1 Tax=Drosophila erecta RepID=B3N5L2_DROER Length = 374 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/44 (52%), Positives = 24/44 (54%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 RPP+ PPPP PP P PP P PP PPPPPP P P Sbjct: 298 RPPATPPPSPPPPPPPPPLPSPPPPPPTPPPPPPPPPPPPPPNP 341 [209][TOP] >UniRef100_B6Q311 Actin associated protein Wsp1, putative n=1 Tax=Penicillium marneffei ATCC 18224 RepID=B6Q311_PENMQ Length = 627 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/43 (55%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP S PPPP PP PPPP +PP PPPPPP PS P Sbjct: 464 PPPAPSSGAPPPPPPP--PPPPPSSGIPPPPPPPPPPPSSGAP 504 [210][TOP] >UniRef100_B2AB31 Predicted CDS Pa_1_5980 n=1 Tax=Podospora anserina RepID=B2AB31_PODAN Length = 752 Score = 53.9 bits (128), Expect = 5e-06 Identities = 28/70 (40%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = -3 Query: 266 PPPAPPSQPPPPLLQPLPPTPPPPPP---RPSLQTPLSSTLLQSPQHKVDAILIFAANSS 96 PPP PP PP P P PP PPPPPP P L TP + Q P FA+ + Sbjct: 651 PPPPPPPPPPTPTAPPAPPAPPPPPPLPLAPDLTTPQAPQQPQQP---------FASTPT 701 Query: 95 EQPREQKPKL 66 +P Q +L Sbjct: 702 RRPGRQTTRL 711 [211][TOP] >UniRef100_B0D333 Predicted protein n=1 Tax=Laccaria bicolor S238N-H82 RepID=B0D333_LACBS Length = 434 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/34 (61%), Positives = 22/34 (64%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P + P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPFILPP 304 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PPPP PP PPPP P PP PPPPPP P P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFILP 303 [212][TOP] >UniRef100_A8NWX4 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea okayama7#130 RepID=A8NWX4_COPC7 Length = 1693 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/44 (56%), Positives = 26/44 (59%), Gaps = 6/44 (13%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLL------QPLPPTPPPPPPRPS 180 PS S PPPP PP PPPP+L P PP PPPPPP PS Sbjct: 1189 PSICSMPSPPPPPPPPPPPPPILFSSGKTAPPPPPPPPPPPPPS 1232 [213][TOP] >UniRef100_P33485 Probable nuclear antigen n=2 Tax=Suid herpesvirus 1 RepID=VNUA_SUHVK Length = 1733 Score = 53.9 bits (128), Expect = 5e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -3 Query: 284 GSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPP 189 G R PPPP+PP +PPPPL P PP PPP PP Sbjct: 266 GDRDDPPPPSPPPRPPPPLPPPPPPPPPPQPP 297 [214][TOP] >UniRef100_Q10Q99 Formin-like protein 8 n=1 Tax=Oryza sativa Japonica Group RepID=FH8_ORYSJ Length = 892 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSL 177 PS+ PPPP PP PPPP L P PPPPPP PS+ Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSV 383 [215][TOP] >UniRef100_O14514 Brain-specific angiogenesis inhibitor 1 n=1 Tax=Homo sapiens RepID=BAI1_HUMAN Length = 1584 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = -3 Query: 305 ARRPPSHGSRRCPP--PPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 +R+PPS G PP PP PP PPPP QPLPP P P PSL P Sbjct: 1395 SRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDP 1442 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = -3 Query: 320 QARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 +A L AR PPS PP APP+QPPPP PP PPPPP +P Sbjct: 1385 EASLPARSPPSRQPPSGGPPEAPPAQPPPP-----PPPPPPPPQQP 1425 [216][TOP] >UniRef100_B7Q5A9 Glycine-rich protein GWK, putative (Fragment) n=1 Tax=Ixodes scapularis RepID=B7Q5A9_IXOSC Length = 77 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = +1 Query: 142 GDWSKVLDRGVCRDGRGGGGGGVGGSGCSRGGGG*DGGAGGGG 270 G W ++ RG G GGGGGG GG G GGGG GG GGGG Sbjct: 28 GRWGRIFSRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 [217][TOP] >UniRef100_UPI000175FBF7 PREDICTED: similar to N-acetyltransferase 6 (Fus-2 protein) (Fusion 2 protein) n=1 Tax=Danio rerio RepID=UPI000175FBF7 Length = 264 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/69 (43%), Positives = 35/69 (50%), Gaps = 3/69 (4%) Frame = -3 Query: 308 NARRPPSHGSRRCPPPPAPP---SQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQ 138 +A+ PS PPPP PP S PPPP P PPPPPP P P+S TL Q+P Sbjct: 190 HAKSTPSVLPPAPPPPPPPPQIYSSPPPPQPPISCPPPPPPPPPPLFCAPVSPTLEQTPY 249 Query: 137 HKVDAILIF 111 + IF Sbjct: 250 TDNSGLPIF 258 [218][TOP] >UniRef100_UPI0000D9F56F PREDICTED: similar to Protein CXorf45 n=1 Tax=Macaca mulatta RepID=UPI0000D9F56F Length = 676 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 P H PPPP PP PPP P PP PPPPPP P L +S L P Sbjct: 451 PIPHAGASLPPPPPPPPPPPP----PPPPPPPPPPPPPPLDVGEASNLQPPP 498 [219][TOP] >UniRef100_UPI00015DEC3D chromodomain helicase DNA binding protein 3 n=1 Tax=Mus musculus RepID=UPI00015DEC3D Length = 78 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/42 (57%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPS----QPPPPLLQPLPPTPPPPPPRP 183 PP PPPP PP PPPPL +P PP PPPPPPRP Sbjct: 37 PPPPPPLPPPPPPGPPPLPRRTPPPPLPRPPPPPPPPPPPRP 78 [220][TOP] >UniRef100_UPI00016E98C2 UPI00016E98C2 related cluster n=1 Tax=Takifugu rubripes RepID=UPI00016E98C2 Length = 500 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/52 (48%), Positives = 26/52 (50%), Gaps = 9/52 (17%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPL---------LQPLPPTPPPPPPRPSLQTP 168 PPS PPPP PPS+PPPP P PP PPPPPP P P Sbjct: 335 PPSRPGISAPPPPPPPSRPPPPPPPSIPSGGGAPPPPPPPPPPPPGPPPPAP 386 [221][TOP] >UniRef100_UPI000184A379 Huntingtin n=2 Tax=Canis lupus familiaris RepID=UPI000184A379 Length = 3136 Score = 53.5 bits (127), Expect = 7e-06 Identities = 34/85 (40%), Positives = 42/85 (49%), Gaps = 14/85 (16%) Frame = -3 Query: 266 PPPAPPSQPP-------PPLLQPLPPTPPPPPPRPSL-QTPL---SSTLLQSPQHKVDAI 120 PPP PP QPP PPL QP PP PPPPPP P++ + PL L + + +V+ Sbjct: 34 PPPPPPPQPPQPLPQAQPPLPQPPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHC 93 Query: 119 LIFAANSSEQPREQKP---KLSGLA 54 L N Q P KL G+A Sbjct: 94 LTICENIVAQSLRNSPEFQKLLGIA 118 [222][TOP] >UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86 RepID=Q4A2U1_EHV86 Length = 2873 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP PPP PP PPPP P PP PPPPP P L TP Sbjct: 221 PPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTP 263 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP+ PPPP PP PPPP P PP+PPPP P P Q P Sbjct: 2279 PPTPPPSPPPPPPTPPPSPPPP--SPPPPSPPPPSPPPPSQPP 2319 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/52 (50%), Positives = 28/52 (53%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPS PPPP+PP PPP PLPP P PPPP P +P S SP Sbjct: 2529 PPS------PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSP 2574 [223][TOP] >UniRef100_Q2W222 RTX toxins and related Ca2+-binding protein n=1 Tax=Magnetospirillum magneticum AMB-1 RepID=Q2W222_MAGSA Length = 1274 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/46 (47%), Positives = 25/46 (54%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSS 159 PP PPPP PP PP P P PP PPPPPP P P+++ Sbjct: 275 PPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAPVNN 320 [224][TOP] >UniRef100_B8H5M9 Cell surface antigen Sca2 n=2 Tax=Caulobacter vibrioides RepID=B8H5M9_CAUCN Length = 449 Score = 53.5 bits (127), Expect = 7e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQ 174 PPPP PP PPPP P PP PPPPPP P+ + Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPAFE 339 [225][TOP] >UniRef100_A4T6G5 Cell envelope-related transcriptional attenuator n=1 Tax=Mycobacterium gilvum PYR-GCK RepID=A4T6G5_MYCGI Length = 409 Score = 53.5 bits (127), Expect = 7e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = -3 Query: 305 ARRP--PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 ARRP P H +R PPPP PP +PPPP PP P PPPPRP P Sbjct: 36 ARRPIPPPHRARAVPPPP-PPRRPPPPR----PPAPRPPPPRPPAPRP 78 [226][TOP] >UniRef100_A3WBS5 Peptidoglycan-associated protein n=1 Tax=Erythrobacter sp. NAP1 RepID=A3WBS5_9SPHN Length = 378 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/39 (58%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -3 Query: 284 GSRRCPPPPAPPSQPPPPLLQPLPP-TPPPPPPRPSLQT 171 G PPPP PP PPPP PLPP PPPPPP P+ T Sbjct: 227 GQAAPPPPPPPPPPPPPPPPPPLPPPAPPPPPPAPACNT 265 [227][TOP] >UniRef100_Q9SX31 F24J5.8 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SX31_ARATH Length = 708 Score = 53.5 bits (127), Expect = 7e-06 Identities = 34/88 (38%), Positives = 44/88 (50%), Gaps = 6/88 (6%) Frame = -3 Query: 296 PPSHGSRRCP--PPPAPPSQPPPPLLQPLPPTPPP----PPPRPSLQTPLSSTLLQSPQH 135 PPS P P P P + PPP L+ PLP +PPP PPPRPS P+ L++SP Sbjct: 91 PPSTSPPPQPVIPSPPPSASPPPALVPPLPSSPPPPASVPPPRPSPSPPI---LVRSPPP 147 Query: 134 KVDAILIFAANSSEQPREQKPKLSGLAP 51 V I S++P + P S +P Sbjct: 148 SVRPIQSPPPPPSDRPTQSPPPPSPPSP 175 [228][TOP] >UniRef100_Q7XSN2 OSJNBb0028M18.5 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q7XSN2_ORYSJ Length = 927 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/62 (45%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP---SLQTPLSSTLLQSPQHKV 129 RPP+ PPPP PS P PPL P PP PP PP P S Q P ++ + + KV Sbjct: 462 RPPAQSPPAPPPPPPAPSPPAPPLPPPPPPPPPCPPALPKTRSRQAPPPASTRATKKAKV 521 Query: 128 DA 123 DA Sbjct: 522 DA 523 [229][TOP] >UniRef100_Q6EUQ1 Os02g0176100 protein n=1 Tax=Oryza sativa Japonica Group RepID=Q6EUQ1_ORYSJ Length = 795 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = -3 Query: 332 QRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 ++ ++ +N +R + PPPP PP PPP P PPTPPPPPPRP P Sbjct: 412 EKRKEHVINLQRSETEIFASTPPPPPPPPPPPP----PPPPTPPPPPPRPPPPPP 462 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/57 (45%), Positives = 32/57 (56%) Frame = -3 Query: 353 RDNVCHGQRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRP 183 +++V + QR + + A PP PPPP PP PPPP P PP PPPPPP P Sbjct: 415 KEHVINLQR-SETEIFASTPPP------PPPPPPPPPPPPPTPPPPPPRPPPPPPPP 464 [230][TOP] >UniRef100_C4IYP5 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4IYP5_MAIZE Length = 441 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/35 (62%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPP-PPRPSLQTP 168 PPP PP PPPPL+ P PP+PPPP PP P L P Sbjct: 260 PPPSPPPPSPPPPLMSPPPPSPPPPSPPPPPLLPP 294 [231][TOP] >UniRef100_C1N0Z7 Predicted protein n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N0Z7_9CHLO Length = 1128 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/56 (46%), Positives = 29/56 (51%), Gaps = 9/56 (16%) Frame = -3 Query: 308 NARRPPSHGSRRCPPPPA---------PPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 N + PPS G++R PPPP PP PPPP PP PPPPPP L P Sbjct: 405 NPQPPPSGGAKRPPPPPLGALANPPPPPPPPPPPPSGLARPPPPPPPPPPGGLAKP 460 [232][TOP] >UniRef100_C0PGT8 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C0PGT8_MAIZE Length = 787 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/55 (43%), Positives = 30/55 (54%) Frame = -3 Query: 332 QRLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTP 168 ++ ++ +N R S PPPP PP PPP PPTPPPPPP P L +P Sbjct: 408 EKRKERVINLERTESEIFAAAPPPPPPPPPPPP------PPTPPPPPPPPRLPSP 456 [233][TOP] >UniRef100_B9NFT7 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9NFT7_POPTR Length = 186 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSP 141 PPPP PP PPPP P PP PPPPPP P P + P Sbjct: 85 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTCPCCEKCRRGP 127 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/39 (56%), Positives = 23/39 (58%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPS 180 PP PPPP PP PPPP P PP PPPPPP P+ Sbjct: 78 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPT 116 [234][TOP] >UniRef100_Q10MK2 Os03g0305800 protein n=2 Tax=Oryza sativa RepID=Q10MK2_ORYSJ Length = 483 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/98 (30%), Positives = 45/98 (45%) Frame = -3 Query: 329 RLRQARLNARRPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLL 150 R+ AR +A + + PPPP+PPS PPPL P PP PP PP P+L + Sbjct: 58 RIEYARRDAPTITAVAADTSPPPPSPPSSSPPPLSFPPPPPPPSSPPPPALPVVDDHSDT 117 Query: 149 QSPQHKVDAILIFAANSSEQPREQKPKLSGLAPNRSAW 36 Q ++ + ++ P P ++G R+ W Sbjct: 118 QRSLRRLRQL-------TDSPYTLGPAVTGYDARRAEW 148 [235][TOP] >UniRef100_A0N015 Vegetative cell wall protein n=1 Tax=Chlamydomonas incerta RepID=A0N015_CHLIN Length = 613 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPP----PLLQPLPPTPPPPPPRPSLQTPLS 162 PPS PPPP+PP PPP P P+PP+PP PPP P TP S Sbjct: 295 PPSPVPPSPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPPPPTPPS 343 [236][TOP] >UniRef100_Q5CID8 Putative uncharacterized protein n=1 Tax=Cryptosporidium hominis RepID=Q5CID8_CRYHO Length = 1922 Score = 53.5 bits (127), Expect = 7e-06 Identities = 28/77 (36%), Positives = 37/77 (48%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAIL 117 PPS GS P PP P PPPP P P +PP PPP P T LS+ + + D L Sbjct: 1280 PPSSGSFAPPSPPHSPPPPPPPPPPPPPSSPPSPPPSPPTYTSLSNGIPSHISTQKDQNL 1339 Query: 116 IFAANSSEQPREQKPKL 66 ++ + + P+L Sbjct: 1340 NLSSAVGKTNHQDSPQL 1356 [237][TOP] >UniRef100_Q4CLZ3 Putative uncharacterized protein (Fragment) n=1 Tax=Trypanosoma cruzi RepID=Q4CLZ3_TRYCR Length = 624 Score = 53.5 bits (127), Expect = 7e-06 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQ 138 PPPP PP PPPP P PP PPPPPP S L ++L Q Q Sbjct: 335 PPPPPPPPSPPPP---PPPPPPPPPPPPSSFAASLVASLQQQKQ 375 [238][TOP] >UniRef100_B4IVG9 GE14936 n=1 Tax=Drosophila yakuba RepID=B4IVG9_DROYA Length = 496 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/53 (49%), Positives = 29/53 (54%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQ 138 PP+ PP P P SQPPPP PLP T PPPP +PS P + Q PQ Sbjct: 198 PPAQSQPPLPPSPPPTSQPPPPRQPPLPRT-PPPPSQPSPPPPPTQQQQQQPQ 249 [239][TOP] >UniRef100_A8K2B4 cDNA FLJ77490, highly similar to Homo sapiens enabled homolog (Drosophila) (ENAH), transcript variant 2, mRNA n=1 Tax=Homo sapiens RepID=A8K2B4_HUMAN Length = 570 Score = 53.5 bits (127), Expect = 7e-06 Identities = 34/80 (42%), Positives = 39/80 (48%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAILI 114 P+ S PPPP PP PPPPL PP PPPPPP P+ P P + A Sbjct: 323 PAQASVALPPPPGPP--PPPPLPSTGPPPPPPPPPLPNQVPPPPP---PPPAPPLPASGF 377 Query: 113 FAANSSEQPREQKPKLSGLA 54 F A+ SE R L+GLA Sbjct: 378 FLASMSEDNR----PLTGLA 393 [240][TOP] >UniRef100_Q8WZK9 Putative uncharacterized protein B14D6.190 n=2 Tax=Neurospora crassa RepID=Q8WZK9_NEUCR Length = 1176 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/91 (36%), Positives = 40/91 (43%), Gaps = 9/91 (9%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPP-----LLQPLPPTPPP--PPPRPSLQTPLSSTLLQSPQ 138 PP H S PPPP PP PPPP + P+ P P P PPP S P S L PQ Sbjct: 963 PPVHYSHHAPPPPPPPPPPPPPSARGRQMPPIQPGPSPQQPPPPASWGHPTSGPTLPPPQ 1022 Query: 137 HKVDAILIFAANSSE--QPREQKPKLSGLAP 51 + A+ + P Q P L ++P Sbjct: 1023 QARSPYIPPHAHHPQGPPPPAQPPTLPSISP 1053 [241][TOP] >UniRef100_Q5AL62 Predicted protein n=1 Tax=Candida albicans RepID=Q5AL62_CANAL Length = 115 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/44 (56%), Positives = 25/44 (56%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQ 138 PPPP PP QPPPP PP PPPPPP Q P LL PQ Sbjct: 16 PPPPPPPPQPPPP-----PPQPPPPPPSLLPQPPPPPPLLSPPQ 54 [242][TOP] >UniRef100_B2WMY2 Putative uncharacterized protein n=1 Tax=Pyrenophora tritici-repentis Pt-1C-BFP RepID=B2WMY2_PYRTR Length = 418 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/55 (47%), Positives = 28/55 (50%), Gaps = 8/55 (14%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQP--------LPPTPPPPPPRPSLQTPLSSTLLQSPQHKV 129 PPPP PP PPPP P +PP PPPPPP P Q P L +P KV Sbjct: 122 PPPPPPPPPPPPPGGIPTWVAAYGAIPPPPPPPPPPPPPQAPAQINALSTPFFKV 176 [243][TOP] >UniRef100_Q8N8S7-2 Isoform 2 of Protein enabled homolog n=1 Tax=Homo sapiens RepID=Q8N8S7-2 Length = 570 Score = 53.5 bits (127), Expect = 7e-06 Identities = 34/80 (42%), Positives = 39/80 (48%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAILI 114 P+ S PPPP PP PPPPL PP PPPPPP P+ P P + A Sbjct: 323 PAQASVALPPPPGPP--PPPPLPSTGPPPPPPPPPLPNQVPPPPP---PPPAPPLPASGF 377 Query: 113 FAANSSEQPREQKPKLSGLA 54 F A+ SE R L+GLA Sbjct: 378 FLASMSEDNR----PLTGLA 393 [244][TOP] >UniRef100_Q8N8S7 Protein enabled homolog n=1 Tax=Homo sapiens RepID=ENAH_HUMAN Length = 591 Score = 53.5 bits (127), Expect = 7e-06 Identities = 34/80 (42%), Positives = 39/80 (48%) Frame = -3 Query: 293 PSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTLLQSPQHKVDAILI 114 P+ S PPPP PP PPPPL PP PPPPPP P+ P P + A Sbjct: 323 PAQASVALPPPPGPP--PPPPLPSTGPPPPPPPPPLPNQVPPPPP---PPPAPPLPASGF 377 Query: 113 FAANSSEQPREQKPKLSGLA 54 F A+ SE R L+GLA Sbjct: 378 FLASMSEDNR----PLTGLA 393 [245][TOP] >UniRef100_Q2HEQ9 Predicted protein n=1 Tax=Chaetomium globosum RepID=Q2HEQ9_CHAGB Length = 438 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/49 (55%), Positives = 29/49 (59%) Frame = +1 Query: 184 GRGGGGGGVGGSGCSRGGGG*DGGAGGGGHRLEPCDGGRRALSRACRSR 330 G GGGGGG GG G RGGGG GG GGGG GGR L+R +R Sbjct: 372 GGGGGGGGRGGGGGGRGGGGGGGGRGGGGGGRGGGGGGRGGLNRVTTTR 420 [246][TOP] >UniRef100_UPI0001985FA6 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID=UPI0001985FA6 Length = 1312 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 22/89 (24%) Frame = -3 Query: 269 PPPPAPPSQPPPPLLQPLPPTPPPPPPR----------------------PSLQTPLSST 156 PPPP PP PPPP P PP PPPPPP P+L TP Sbjct: 335 PPPPPPPRPPPPPPPPPPPPPPPPPPPALKNVENPMIPSPPIRRPVPLKPPALTTPSRPF 394 Query: 155 LLQSPQHKVDAILIFAANSSEQPREQKPK 69 + ++ + + +++ +E+ E+ PK Sbjct: 395 VFFQNPSRLSPVALESSSKTEEKTEETPK 423 [247][TOP] >UniRef100_UPI000186A185 hypothetical protein BRAFLDRAFT_108752 n=1 Tax=Branchiostoma floridae RepID=UPI000186A185 Length = 742 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/45 (53%), Positives = 26/45 (57%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLS 162 PP + C PP PP PPP LPP PPPPPP P QTPL+ Sbjct: 571 PPPYPPPGCTLPPPPPPPPPPGPTLSLPPPPPPPPP-PGFQTPLA 614 [248][TOP] >UniRef100_UPI00015B541C PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B541C Length = 661 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/58 (46%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = -3 Query: 311 LNARRPPSHGSRRCPPPPAPP-----SQPPPPLLQPLPPTPPPPPPRPSLQTPLSSTL 153 L + +PPS PPPP PP PPPP P PP PPPPPP P + TP + L Sbjct: 56 LPSHQPPS------PPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTPAPTYL 107 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/48 (56%), Positives = 28/48 (58%) Frame = -3 Query: 299 RPPSHGSRRCPPPPAPPSQPPPPLLQPLPPTPPPPPPRPSLQTPLSST 156 RPPS S PP+ PS PPPP P PP PPPPPP PS P S T Sbjct: 469 RPPSTPSLPPSRPPSSPSPPPPP-PPPPPPRPPPPPPPPSQPPPTSLT 515 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/45 (55%), Positives = 25/45 (55%), Gaps = 7/45 (15%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPPSQPPPPLL-------QPLPPTPPPPPPRP 183 PP R PPPP PPSQPPP L P PP PPPPPP P Sbjct: 491 PPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPP 535 [249][TOP] >UniRef100_UPI00015B501E PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis RepID=UPI00015B501E Length = 406 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/46 (52%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -3 Query: 296 PPSHGSRRCPPPPAPP---SQPPPPLLQPLPPTPPPPPPRPSLQTP 168 PP++G PPPP PP PPPP P PP PPPPPP P+ P Sbjct: 203 PPAYGPPPPPPPPPPPPAYGPPPPPAYGP-PPPPPPPPPPPAYSPP 247 [250][TOP] >UniRef100_UPI000155C73A PREDICTED: similar to proline rich 8 n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C73A Length = 1236 Score = 53.1 bits (126), Expect = 9e-06 Identities = 41/110 (37%), Positives = 47/110 (42%), Gaps = 20/110 (18%) Frame = -3 Query: 353 RDNVCHGQRLRQAR--LNARRPP--SHGSRRCPPP-----PAPPSQPPP-PLLQPLPPTP 204 RDN G R++ R L +PP +H R PPP P P QP P P QP PP P Sbjct: 336 RDNSERG-RMKDHRPALLPTQPPVVTHSPRLIPPPQSQPQPQPQPQPQPQPQQQPPPPPP 394 Query: 203 PPPPPRPSLQTPLSSTL----------LQSPQHKVDAILIFAANSSEQPR 84 PPPPP P Q P+ S LQ P H + E PR Sbjct: 395 PPPPPPPQQQQPIRSLFQQQQLQPLLPLQHPHHPSPPQAMHMPPQMETPR 444